F476256
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 703 | 286 | 1408 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100336759|Ga0070670_1003367592 |
| Length | 289 |
| Sequence | MKFNFLVCYYDTMENNFLILPFLFNMPVVTAFYMTFEKELKHHYLHGHEKYLRHISVDCIIFGFHNNELKVLLLKARYAGKWALPGGFILKREHMDLAARRILKQRTGLDEIYLQQFHVFSDPGRSTKKINQQFLSNIGIKSEESWMFERFITVGYYALVDFTKVTPVPDTISDACEWFGIYDVPEMILDHNYIFDEALQNLRMQLNFHPVGFNLLPKKFTMPELQKLYETILDKRLDRRNFQRKIIATAILKRLDETKKGVAHKAPFYYKFDLPQYKKALKTGLGFEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 191 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 195 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 198 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 242 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 243 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 244 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 245 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 252 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 259 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 260 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 261 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 262 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 264 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 267 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 268 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 269 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 270 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 271 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 272 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 273 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 274 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 275 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 276 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 277 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 278 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 279 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 280 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 281 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 282 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 283 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 284 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 285 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 286 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0 |
| Isolates | 2.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.97 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 85.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100336759 | 3300005331 | Bacteria | 1324 |
| 2 | SwRhRL2b_contig_1189533 | 2162886007 | Bacteria | 1119 |
| 3 | JGI24740J21852_10002460 | 3300001979 | Bacteria | 8390 |
| 4 | JGI24740J21852_10020253 | 3300001979 | Bacteria | 2324 |
| 5 | JGI24739J22299_10013928 | 3300001989 | Bacteria | 2930 |
| 6 | JGI24739J22299_10018344 | 3300001989 | Unclassified | 2516 |
| 7 | JGI24737J22298_10000014 | 3300001990 | Bacteria | 50004 |
| 8 | JGI24735J21928_10000008 | 3300002067 | Bacteria | 319819 |
| 9 | JGI25162J39368_1000059 | 3300002737 | Bacteria | 138925 |
| 10 | JGI25162J39368_1000609 | 3300002737 | Bacteria | 25774 |
| 11 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 12 | JGI25157J39369_1004219 | 3300002741 | Bacteria | 2671 |
| 13 | JGI25406J46586_10000469 | 3300003203 | Bacteria | 18825 |
| 14 | JGI25153J46596_10012528 | 3300003215 | Bacteria | 3651 |
| 15 | JGI25153J46596_10068574 | 3300003215 | Bacteria | 929 |
| 16 | rootH1_10066643 | 3300003316 | Bacteria | 4120 |
| 17 | rootH2_10001801 | 3300003320 | Bacteria | 92828 |
| 18 | rootH2_10006838 | 3300003320 | Bacteria | 63494 |
| 19 | rootH2_10017993 | 3300003320 | Unclassified | 2989 |
| 20 | rootH2_10038098 | 3300003320 | Bacteria | 24708 |
| 21 | rootH2_10038656 | 3300003320 | Bacteria | 13640 |
| 22 | rootH2_10068434 | 3300003320 | Bacteria | 6842 |
| 23 | rootH2_10069792 | 3300003320 | Bacteria | 13148 |
| 24 | rootH2_10098188 | 3300003320 | Bacteria | 4500 |
| 25 | rootH2_10230905 | 3300003320 | Bacteria | 2614 |
| 26 | rootH2_10235789 | 3300003320 | Unclassified | 1446 |
| 27 | rootL2_10012281 | 3300003322 | Bacteria | 6296 |
| 28 | rootL2_10013360 | 3300003322 | Bacteria | 8766 |
| 29 | rootL2_10231865 | 3300003322 | Bacteria | 2694 |
| 30 | rootL2_10365832 | 3300003322 | Bacteria | 1741 |
| 31 | rootH1_10014610 | 3300003316 | Bacteria | 16128 |
| 32 | rootH1_10014610 | 3300003323 | Bacteria | 26841 |
| 33 | rootH1_10017864 | 3300003323 | Bacteria | 25342 |
| 34 | rootH1_10026151 | 3300003316 | Bacteria | 3633 |
| 35 | rootH1_10026151 | 3300003323 | Bacteria | 4558 |
| 36 | rootH1_10026159 | 3300003323 | Bacteria | 3583 |
| 37 | rootH1_10085318 | 3300003323 | Bacteria | 10647 |
| 38 | rootH1_10133797 | 3300003323 | Bacteria | 3801 |
| 39 | rootH1_10161700 | 3300003323 | Bacteria | 6433 |
| 40 | rootH1_10239212 | 3300003323 | Bacteria | 1501 |
| 41 | JGI25160J50197_1005312 | 3300003354 | Bacteria | 5385 |
| 42 | JGI25160J50197_1006262 | 3300003354 | Unclassified | 4837 |
| 43 | JGI25160J50197_1007304 | 3300003354 | Bacteria | 4344 |
| 44 | JGI25160J50197_1011486 | 3300003354 | Bacteria | 3138 |
| 45 | Ga0055526_1005747 | 3300003771 | Bacteria | 7000 |
| 46 | Ga0055526_1017233 | 3300003771 | Bacteria | 2773 |
| 47 | Ga0055528_1000278 | 3300003790 | Bacteria | 43601 |
| 48 | Ga0055530_10000463 | 3300003791 | Bacteria | 35675 |
| 49 | Ga0065165_1000010 | 3300005262 | Bacteria | 323737 |
| 50 | Ga0065165_1001597 | 3300005262 | Bacteria | 23271 |
| 51 | Ga0065165_1022373 | 3300005262 | Unclassified | 2169 |
| 52 | Ga0065714_10007900 | 3300005288 | Bacteria | 3572 |
| 53 | Ga0065714_10081652 | 3300005288 | Bacteria | 2359 |
| 54 | Ga0065704_10093229 | 3300005289 | Bacteria | 2609 |
| 55 | Ga0070658_10000098 | 3300005327 | Bacteria | 76892 |
| 56 | Ga0070658_10069922 | 3300005327 | Unclassified | 2873 |
| 57 | Ga0070658_10295303 | 3300005327 | Unclassified | 1381 |
| 58 | Ga0070676_10000441 | 3300005328 | Bacteria | 19764 |
| 59 | Ga0070676_10009771 | 3300005328 | Bacteria | 5190 |
| 60 | Ga0070683_100004444 | 3300005329 | Bacteria | 11560 |
| 61 | Ga0070683_100025263 | 3300005329 | Bacteria | 5332 |
| 62 | Ga0070683_100138931 | 3300005329 | Unclassified | 2301 |
| 63 | Ga0070690_100006555 | 3300005330 | Bacteria | 6608 |
| 64 | Ga0070690_100264357 | 3300005330 | Bacteria | 1221 |
| 65 | Ga0070690_100274715 | 3300005330 | Bacteria | 1200 |
| 66 | Ga0070690_100550128 | 3300005330 | Bacteria | 870 |
| 67 | Ga0070670_100147491 | 3300005331 | Bacteria | 2036 |
| 68 | Ga0068869_100062532 | 3300005334 | Bacteria | 2733 |
| 69 | Ga0068869_100243334 | 3300005334 | Bacteria | 1434 |
| 70 | Ga0068869_100575578 | 3300005334 | Bacteria | 949 |
| 71 | Ga0070666_10035560 | 3300005335 | Bacteria | 3304 |
| 72 | Ga0070666_10165498 | 3300005335 | Bacteria | 1547 |
| 73 | Ga0070680_100104108 | 3300005336 | Bacteria | 2358 |
| 74 | Ga0070680_100372301 | 3300005336 | Unclassified | 1215 |
| 75 | Ga0070680_100593592 | 3300005336 | Unclassified | 950 |
| 76 | Ga0070682_100039385 | 3300005337 | Bacteria | 2904 |
| 77 | Ga0068868_100034603 | 3300005338 | Bacteria | 3902 |
| 78 | Ga0068868_100038198 | 3300005338 | Bacteria | 3726 |
| 79 | Ga0068868_100108928 | 3300005338 | Bacteria | 2249 |
| 80 | Ga0068868_100121983 | 3300005338 | Bacteria | 2127 |
| 81 | Ga0068868_100127624 | 3300005338 | Bacteria | 2079 |
| 82 | Ga0068868_100601723 | 3300005338 | Bacteria | 974 |
| 83 | Ga0070660_100058610 | 3300005339 | Bacteria | 2985 |
| 84 | Ga0070660_100093765 | 3300005339 | Unclassified | 2371 |
| 85 | Ga0070660_100376541 | 3300005339 | Unclassified | 1172 |
| 86 | Ga0070689_100009628 | 3300005340 | Bacteria | 6858 |
| 87 | Ga0070689_100297521 | 3300005340 | Bacteria | 1343 |
| 88 | Ga0070691_10004791 | 3300005341 | Bacteria | 6160 |
| 89 | Ga0070661_100001488 | 3300005344 | Bacteria | 16275 |
| 90 | Ga0070661_100060262 | 3300005344 | Bacteria | 2785 |
| 91 | Ga0070661_100117797 | 3300005344 | Bacteria | 1987 |
| 92 | Ga0070692_10078569 | 3300005345 | Bacteria | 1772 |
| 93 | Ga0070669_100292644 | 3300005353 | Bacteria | 1308 |
| 94 | Ga0070671_100069643 | 3300005355 | Bacteria | 2934 |
| 95 | Ga0070671_100135774 | 3300005355 | Bacteria | 2074 |
| 96 | Ga0070673_100038481 | 3300005364 | Bacteria | 3653 |
| 97 | Ga0070673_100082109 | 3300005364 | Bacteria | 2615 |
| 98 | Ga0070673_100188002 | 3300005364 | Bacteria | 1772 |
| 99 | Ga0070673_100360213 | 3300005364 | Bacteria | 1293 |
| 100 | Ga0070673_100467131 | 3300005364 | Bacteria | 1137 |
| 101 | Ga0070688_100001493 | 3300005365 | Bacteria | 11653 |
| 102 | Ga0070659_100170311 | 3300005366 | Bacteria | 1783 |
| 103 | Ga0070659_100265226 | 3300005366 | Bacteria | 1426 |
| 104 | Ga0070667_100042279 | 3300005367 | Bacteria | 3824 |
| 105 | Ga0070667_100054756 | 3300005367 | Bacteria | 3369 |
| 106 | Ga0070667_100144483 | 3300005367 | Unclassified | 2085 |
| 107 | Ga0070714_100002411 | 3300005435 | Bacteria | 13776 |
| 108 | Ga0070710_10045738 | 3300005437 | Bacteria | 2435 |
| 109 | Ga0070663_100011737 | 3300005455 | Bacteria | 5513 |
| 110 | Ga0070663_100275739 | 3300005455 | Bacteria | 1338 |
| 111 | Ga0070678_100002815 | 3300005456 | Bacteria | 9610 |
| 112 | Ga0070678_100023069 | 3300005456 | Bacteria | 4139 |
| 113 | Ga0070662_100000516 | 3300005457 | Bacteria | 23246 |
| 114 | Ga0070662_100029140 | 3300005457 | Bacteria | 3851 |
| 115 | Ga0070662_100031643 | 3300005457 | Bacteria | 3714 |
| 116 | Ga0070662_100056978 | 3300005457 | Bacteria | 2838 |
| 117 | Ga0070662_100130937 | 3300005457 | Bacteria | 1934 |
| 118 | Ga0070662_100538437 | 3300005457 | Unclassified | 977 |
| 119 | Ga0070681_10007666 | 3300005458 | Bacteria | 10558 |
| 120 | Ga0070681_10108845 | 3300005458 | Bacteria | 2711 |
| 121 | Ga0070681_10523323 | 3300005458 | Bacteria | 1099 |
| 122 | Ga0068867_100005793 | 3300005459 | Bacteria | 8767 |
| 123 | Ga0068867_100457430 | 3300005459 | Bacteria | 1089 |
| 124 | Ga0070685_10078292 | 3300005466 | Bacteria | 1976 |
| 125 | Ga0070679_100000158 | 3300005530 | Bacteria | 54895 |
| 126 | Ga0070679_100016715 | 3300005530 | Bacteria | 7088 |
| 127 | Ga0070679_100165594 | 3300005530 | Bacteria | 2184 |
| 128 | Ga0070679_100179401 | 3300005530 | Bacteria | 2090 |
| 129 | Ga0070679_100631257 | 3300005530 | Bacteria | 1014 |
| 130 | Ga0070684_100024079 | 3300005535 | Bacteria | 5103 |
| 131 | Ga0070684_100086844 | 3300005535 | Bacteria | 2777 |
| 132 | Ga0068853_100001327 | 3300005539 | Bacteria | 17802 |
| 133 | Ga0068853_100009815 | 3300005539 | Bacteria | 7725 |
| 134 | Ga0068853_100029263 | 3300005539 | Bacteria | 4642 |
| 135 | Ga0068853_100087071 | 3300005539 | Bacteria | 2740 |
| 136 | Ga0068853_100166399 | 3300005539 | Bacteria | 1993 |
| 137 | Ga0068853_100269415 | 3300005539 | Bacteria | 1568 |
| 138 | Ga0068853_100555246 | 3300005539 | Unclassified | 1088 |
| 139 | Ga0070672_100104888 | 3300005543 | Bacteria | 2297 |
| 140 | Ga0070672_100581345 | 3300005543 | Bacteria | 974 |
| 141 | Ga0070686_100008632 | 3300005544 | Bacteria | 5710 |
| 142 | Ga0070665_100000034 | 3300005548 | Bacteria | 324289 |
| 143 | Ga0070665_100811163 | 3300005548 | Bacteria | 949 |
| 144 | Ga0068855_100000041 | 3300005563 | Bacteria | 151653 |
| 145 | Ga0068855_100000280 | 3300005563 | Bacteria | 62945 |
| 146 | Ga0068855_100003853 | 3300005563 | Bacteria | 18336 |
| 147 | Ga0068855_100007291 | 3300005563 | Bacteria | 13394 |
| 148 | Ga0068855_100028100 | 3300005563 | Bacteria | 6728 |
| 149 | Ga0068855_100158002 | 3300005563 | Bacteria | 2575 |
| 150 | Ga0068855_100239119 | 3300005563 | Bacteria | 2030 |
| 151 | Ga0068855_100264230 | 3300005563 | Bacteria | 1916 |
| 152 | Ga0068855_100277069 | 3300005563 | Bacteria | 1864 |
| 153 | Ga0070664_100000360 | 3300005564 | Bacteria | 33570 |
| 154 | Ga0070664_100035965 | 3300005564 | Bacteria | 4159 |
| 155 | Ga0070664_100146476 | 3300005564 | Bacteria | 2083 |
| 156 | Ga0070664_100157765 | 3300005564 | Bacteria | 2006 |
| 157 | Ga0068857_100000323 | 3300005577 | Bacteria | 32881 |
| 158 | Ga0068857_100055855 | 3300005577 | Bacteria | 3503 |
| 159 | Ga0068857_100111418 | 3300005577 | Bacteria | 2460 |
| 160 | Ga0068857_100168199 | 3300005577 | Bacteria | 1992 |
| 161 | Ga0068857_100171470 | 3300005577 | Unclassified | 1973 |
| 162 | Ga0068854_100120790 | 3300005578 | Bacteria | 1989 |
| 163 | Ga0068856_100001619 | 3300005614 | Bacteria | 23567 |
| 164 | Ga0068856_100005649 | 3300005614 | Bacteria | 12311 |
| 165 | Ga0068856_100009859 | 3300005614 | Bacteria | 9274 |
| 166 | Ga0068856_100112357 | 3300005614 | Bacteria | 2722 |
| 167 | Ga0068856_100241083 | 3300005614 | Unclassified | 1823 |
| 168 | Ga0068856_100455708 | 3300005614 | Bacteria | 1300 |
| 169 | Ga0068856_100693712 | 3300005614 | Bacteria | 1038 |
| 170 | Ga0068856_100838604 | 3300005614 | Bacteria | 938 |
| 171 | Ga0068852_100000178 | 3300005616 | Bacteria | 43191 |
| 172 | Ga0068852_100065160 | 3300005616 | Bacteria | 3178 |
| 173 | Ga0068852_100110417 | 3300005616 | Bacteria | 2499 |
| 174 | Ga0068852_100267205 | 3300005616 | Bacteria | 1645 |
| 175 | Ga0068859_100000990 | 3300005617 | Bacteria | 29074 |
| 176 | Ga0068859_100409689 | 3300005617 | Bacteria | 1451 |
| 177 | Ga0068864_100075881 | 3300005618 | Bacteria | 2936 |
| 178 | Ga0068864_100097241 | 3300005618 | Unclassified | 2606 |
| 179 | Ga0068864_100118374 | 3300005618 | Bacteria | 2365 |
| 180 | Ga0068864_100299326 | 3300005618 | Bacteria | 1506 |
| 181 | Ga0068866_10087418 | 3300005718 | Bacteria | 1689 |
| 182 | Ga0068866_10201967 | 3300005718 | Bacteria | 1188 |
| 183 | Ga0068866_10393802 | 3300005718 | Bacteria | 892 |
| 184 | Ga0068866_10469915 | 3300005718 | Bacteria | 826 |
| 185 | Ga0068851_10158274 | 3300005834 | Bacteria | 1242 |
| 186 | Ga0068851_10185463 | 3300005834 | Bacteria | 1154 |
| 187 | Ga0068863_100083820 | 3300005841 | Bacteria | 3021 |
| 188 | Ga0068858_100024468 | 3300005842 | Bacteria | 5625 |
| 189 | Ga0068858_100387126 | 3300005842 | Unclassified | 1342 |
| 190 | Ga0068858_100901848 | 3300005842 | Unclassified | 864 |
| 191 | Ga0068860_100614556 | 3300005843 | Unclassified | 1093 |
| 192 | Ga0068862_100398803 | 3300005844 | Bacteria | 1286 |
| 193 | Ga0081540_1032160 | 3300005983 | Unclassified | 2869 |
| 194 | Ga0081539_10000345 | 3300005985 | Bacteria | 102083 |
| 195 | Ga0075366_10006400 | 3300006195 | Bacteria | 6453 |
| 196 | Ga0075366_10026527 | 3300006195 | Bacteria | 3394 |
| 197 | Ga0097621_100000161 | 3300006237 | Bacteria | 42026 |
| 198 | Ga0097621_100021202 | 3300006237 | Bacteria | 5020 |
| 199 | Ga0097621_100065083 | 3300006237 | Bacteria | 2999 |
| 200 | Ga0097621_100184875 | 3300006237 | Bacteria | 1802 |
| 201 | Ga0097621_100349591 | 3300006237 | Bacteria | 1314 |
| 202 | Ga0068871_100000492 | 3300006358 | Bacteria | 27041 |
| 203 | Ga0068871_100030143 | 3300006358 | Unclassified | 4269 |
| 204 | Ga0068871_100390696 | 3300006358 | Bacteria | 1237 |
| 205 | Ga0068865_100000603 | 3300006881 | Bacteria | 20153 |
| 206 | Ga0068865_100085965 | 3300006881 | Unclassified | 2270 |
| 207 | Ga0097620_100000990 | 3300006931 | Bacteria | 29074 |
| 208 | Ga0097620_100409692 | 3300006931 | Bacteria | 1451 |
| 209 | Ga0105240_10000208 | 3300009093 | Bacteria | 118950 |
| 210 | Ga0105240_10000225 | 3300009093 | Bacteria | 112806 |
| 211 | Ga0105240_10001556 | 3300009093 | Bacteria | 38962 |
| 212 | Ga0105240_10057226 | 3300009093 | Bacteria | 4873 |
| 213 | Ga0105240_10063706 | 3300009093 | Bacteria | 4584 |
| 214 | Ga0105240_10087944 | 3300009093 | Bacteria | 3803 |
| 215 | Ga0105240_10244189 | 3300009093 | Bacteria | 2080 |
| 216 | Ga0105240_10252245 | 3300009093 | Bacteria | 2040 |
| 217 | Ga0105240_10849279 | 3300009093 | Bacteria | 986 |
| 218 | Ga0105240_11069841 | 3300009093 | Bacteria | 860 |
| 219 | Ga0111539_10222276 | 3300009094 | Bacteria | 2199 |
| 220 | Ga0105247_10051678 | 3300009101 | Bacteria | 2532 |
| 221 | Ga0105243_10174911 | 3300009148 | Bacteria | 1862 |
| 222 | Ga0105241_10000124 | 3300009174 | Bacteria | 55171 |
| 223 | Ga0105241_10001477 | 3300009174 | Bacteria | 18004 |
| 224 | Ga0105241_10004921 | 3300009174 | Bacteria | 9847 |
| 225 | Ga0105241_10031194 | 3300009174 | Bacteria | 3990 |
| 226 | Ga0105241_10115897 | 3300009174 | Unclassified | 2151 |
| 227 | Ga0105241_10358916 | 3300009174 | Bacteria | 1268 |
| 228 | Ga0105241_10894285 | 3300009174 | Bacteria | 824 |
| 229 | Ga0105242_10122417 | 3300009176 | Bacteria | 2235 |
| 230 | Ga0105242_10422102 | 3300009176 | Bacteria | 1250 |
| 231 | Ga0105242_10751200 | 3300009176 | Bacteria | 960 |
| 232 | Ga0105248_10829536 | 3300009177 | Bacteria | 1043 |
| 233 | Ga0105237_10000156 | 3300009545 | Bacteria | 96442 |
| 234 | Ga0105237_10000965 | 3300009545 | Bacteria | 38704 |
| 235 | Ga0105237_10001225 | 3300009545 | Bacteria | 34194 |
| 236 | Ga0105237_10001843 | 3300009545 | Bacteria | 27254 |
| 237 | Ga0105237_10003951 | 3300009545 | Bacteria | 17362 |
| 238 | Ga0105237_10006764 | 3300009545 | Bacteria | 12653 |
| 239 | Ga0105237_10022659 | 3300009545 | Bacteria | 6442 |
| 240 | Ga0105237_10061488 | 3300009545 | Unclassified | 3755 |
| 241 | Ga0105237_10104920 | 3300009545 | Bacteria | 2818 |
| 242 | Ga0105237_10251940 | 3300009545 | Bacteria | 1768 |
| 243 | Ga0105237_10502902 | 3300009545 | Bacteria | 1218 |
| 244 | Ga0105238_10001372 | 3300009551 | Bacteria | 24425 |
| 245 | Ga0105238_10034624 | 3300009551 | Bacteria | 5137 |
| 246 | Ga0105238_10046184 | 3300009551 | Bacteria | 4396 |
| 247 | Ga0105238_10046868 | 3300009551 | Bacteria | 4359 |
| 248 | Ga0105249_10298148 | 3300009553 | Bacteria | 1616 |
| 249 | Ga0105249_10654173 | 3300009553 | Bacteria | 1109 |
| 250 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 251 | Ga0105239_10001666 | 3300010375 | Bacteria | 29274 |
| 252 | Ga0105239_10002037 | 3300010375 | Bacteria | 26210 |
| 253 | Ga0105239_10002706 | 3300010375 | Bacteria | 22289 |
| 254 | Ga0105239_10018096 | 3300010375 | Bacteria | 7793 |
| 255 | Ga0105239_10031569 | 3300010375 | Bacteria | 5824 |
| 256 | Ga0105239_10039642 | 3300010375 | Bacteria | 5160 |
| 257 | Ga0105239_10046878 | 3300010375 | Bacteria | 4735 |
| 258 | Ga0105239_10091836 | 3300010375 | Bacteria | 3351 |
| 259 | Ga0105239_10092775 | 3300010375 | Bacteria | 3333 |
| 260 | Ga0105239_10185586 | 3300010375 | Bacteria | 2327 |
| 261 | Ga0105239_10600732 | 3300010375 | Bacteria | 1255 |
| 262 | Ga0105246_10097660 | 3300011119 | Unclassified | 2132 |
| 263 | Ga0157373_10002886 | 3300013100 | Bacteria | 13001 |
| 264 | Ga0157373_10019438 | 3300013100 | Bacteria | 4943 |
| 265 | Ga0157373_10099255 | 3300013100 | Unclassified | 2049 |
| 266 | Ga0157373_10110904 | 3300013100 | Bacteria | 1929 |
| 267 | Ga0157373_10185682 | 3300013100 | Unclassified | 1465 |
| 268 | Ga0157371_10001089 | 3300013102 | Bacteria | 29420 |
| 269 | Ga0157371_10002710 | 3300013102 | Bacteria | 16717 |
| 270 | Ga0157371_10002722 | 3300013102 | Bacteria | 16650 |
| 271 | Ga0157371_10003195 | 3300013102 | Bacteria | 15045 |
| 272 | Ga0157371_10012073 | 3300013102 | Bacteria | 6620 |
| 273 | Ga0157371_10022670 | 3300013102 | Bacteria | 4595 |
| 274 | Ga0157371_10026504 | 3300013102 | Bacteria | 4213 |
| 275 | Ga0157371_10185849 | 3300013102 | Bacteria | 1487 |
| 276 | Ga0157371_10197219 | 3300013102 | Bacteria | 1442 |
| 277 | Ga0157371_10266274 | 3300013102 | Unclassified | 1236 |
| 278 | Ga0157370_10000549 | 3300013104 | Bacteria | 46792 |
| 279 | Ga0157370_10009541 | 3300013104 | Bacteria | 10350 |
| 280 | Ga0157370_10043539 | 3300013104 | Bacteria | 4319 |
| 281 | Ga0157370_10106911 | 3300013104 | Bacteria | 2618 |
| 282 | Ga0157370_10219758 | 3300013104 | Bacteria | 1760 |
| 283 | Ga0157370_10431160 | 3300013104 | Bacteria | 1212 |
| 284 | Ga0157369_10000664 | 3300013105 | Bacteria | 44521 |
| 285 | Ga0157369_10020600 | 3300013105 | Bacteria | 7373 |
| 286 | Ga0157369_10047707 | 3300013105 | Bacteria | 4649 |
| 287 | Ga0157369_10136329 | 3300013105 | Bacteria | 2599 |
| 288 | Ga0157369_10347799 | 3300013105 | Unclassified | 1540 |
| 289 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 290 | Ga0157374_10000217 | 3300013296 | Bacteria | 52933 |
| 291 | Ga0157374_10003858 | 3300013296 | Bacteria | 12592 |
| 292 | Ga0157374_10019255 | 3300013296 | Bacteria | 6038 |
| 293 | Ga0157374_10023675 | 3300013296 | Bacteria | 5496 |
| 294 | Ga0157374_10050381 | 3300013296 | Bacteria | 3870 |
| 295 | Ga0157374_10105592 | 3300013296 | Bacteria | 2705 |
| 296 | Ga0157374_10142227 | 3300013296 | Bacteria | 2329 |
| 297 | Ga0157374_10336148 | 3300013296 | Bacteria | 1499 |
| 298 | Ga0157374_10397152 | 3300013296 | Bacteria | 1375 |
| 299 | Ga0157374_10566941 | 3300013296 | Bacteria | 1144 |
| 300 | Ga0157378_10015307 | 3300013297 | Bacteria | 6718 |
| 301 | Ga0157378_10040378 | 3300013297 | Bacteria | 4137 |
| 302 | Ga0157378_10082238 | 3300013297 | Bacteria | 2912 |
| 303 | Ga0157378_10082666 | 3300013297 | Bacteria | 2904 |
| 304 | Ga0157378_10157779 | 3300013297 | Bacteria | 2119 |
| 305 | Ga0157378_10479820 | 3300013297 | Bacteria | 1239 |
| 306 | Ga0163162_10001362 | 3300013306 | Bacteria | 22742 |
| 307 | Ga0163162_10012077 | 3300013306 | Bacteria | 8425 |
| 308 | Ga0163162_10021128 | 3300013306 | Bacteria | 6403 |
| 309 | Ga0163162_10076971 | 3300013306 | Bacteria | 3399 |
| 310 | Ga0163162_10275417 | 3300013306 | Bacteria | 1815 |
| 311 | Ga0163162_10707483 | 3300013306 | Bacteria | 1129 |
| 312 | Ga0163162_10830727 | 3300013306 | Bacteria | 1040 |
| 313 | Ga0163162_11169440 | 3300013306 | Bacteria | 873 |
| 314 | Ga0157372_10000109 | 3300013307 | Bacteria | 86749 |
| 315 | Ga0157372_10011013 | 3300013307 | Bacteria | 9625 |
| 316 | Ga0157372_10027710 | 3300013307 | Bacteria | 6174 |
| 317 | Ga0157372_10100828 | 3300013307 | Unclassified | 3295 |
| 318 | Ga0157372_10382941 | 3300013307 | Bacteria | 1639 |
| 319 | Ga0157372_10420858 | 3300013307 | Bacteria | 1557 |
| 320 | Ga0157372_10662913 | 3300013307 | Bacteria | 1215 |
| 321 | Ga0157372_11012072 | 3300013307 | Unclassified | 962 |
| 322 | Ga0157375_10007871 | 3300013308 | Bacteria | 9328 |
| 323 | Ga0157375_10038044 | 3300013308 | Bacteria | 4616 |
| 324 | Ga0157375_10118524 | 3300013308 | Bacteria | 2753 |
| 325 | Ga0157375_10135791 | 3300013308 | Bacteria | 2583 |
| 326 | Ga0157375_10143151 | 3300013308 | Bacteria | 2519 |
| 327 | Ga0157375_10164652 | 3300013308 | Bacteria | 2362 |
| 328 | Ga0157375_10314017 | 3300013308 | Bacteria | 1731 |
| 329 | Ga0157375_10325450 | 3300013308 | Unclassified | 1702 |
| 330 | Ga0163163_10002119 | 3300014325 | Bacteria | 16744 |
| 331 | Ga0157380_10000340 | 3300014326 | Bacteria | 27942 |
| 332 | Ga0157380_10003327 | 3300014326 | Bacteria | 11034 |
| 333 | Ga0157380_10083463 | 3300014326 | Bacteria | 2618 |
| 334 | Ga0157380_10244938 | 3300014326 | Unclassified | 1619 |
| 335 | Ga0157380_10322202 | 3300014326 | Unclassified | 1433 |
| 336 | Ga0157377_10015824 | 3300014745 | Bacteria | 3867 |
| 337 | Ga0157377_10048862 | 3300014745 | Bacteria | 2376 |
| 338 | Ga0157379_10114500 | 3300014968 | Bacteria | 2424 |
| 339 | Ga0157379_10462702 | 3300014968 | Bacteria | 1172 |
| 340 | Ga0157376_10017753 | 3300014969 | Bacteria | 5437 |
| 341 | Ga0157376_10035449 | 3300014969 | Bacteria | 4036 |
| 342 | Ga0157376_10098695 | 3300014969 | Bacteria | 2546 |
| 343 | Ga0163161_10041762 | 3300017792 | Bacteria | 3296 |
| 344 | Ga0163161_10106229 | 3300017792 | Bacteria | 2095 |
| 345 | Ga0213872_10025432 | 3300021361 | Unclassified | 2721 |
| 346 | Ga0209436_100329 | 3300025208 | Bacteria | 21518 |
| 347 | Ga0207427_100138 | 3300025231 | Bacteria | 86499 |
| 348 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 349 | Ga0209437_100169 | 3300025233 | Bacteria | 142584 |
| 350 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 351 | Ga0209026_1000192 | 3300025250 | Bacteria | 88221 |
| 352 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 353 | Ga0209673_1000261 | 3300025273 | Bacteria | 99491 |
| 354 | Ga0209673_1019407 | 3300025273 | Bacteria | 2441 |
| 355 | Ga0209130_1002763 | 3300025284 | Bacteria | 8266 |
| 356 | Ga0209564_1004118 | 3300025295 | Bacteria | 9137 |
| 357 | Ga0209564_1011224 | 3300025295 | Unclassified | 4036 |
| 358 | Ga0209564_1017609 | 3300025295 | Bacteria | 2773 |
| 359 | Ga0209758_1003208 | 3300025297 | Bacteria | 15239 |
| 360 | Ga0209758_1004508 | 3300025297 | Bacteria | 11549 |
| 361 | Ga0209050_1000577 | 3300025298 | Bacteria | 59430 |
| 362 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 363 | Ga0207426_1000189 | 3300025302 | Bacteria | 153457 |
| 364 | Ga0207426_1000594 | 3300025302 | Bacteria | 47795 |
| 365 | Ga0207426_1000994 | 3300025302 | Bacteria | 27767 |
| 366 | Ga0207426_1003568 | 3300025302 | Bacteria | 8285 |
| 367 | Ga0209257_1003143 | 3300025304 | Bacteria | 14727 |
| 368 | Ga0207656_10162053 | 3300025321 | Bacteria | 1065 |
| 369 | Ga0207656_10165225 | 3300025321 | Bacteria | 1055 |
| 370 | Ga0207642_10087275 | 3300025899 | Bacteria | 1532 |
| 371 | Ga0207710_10031821 | 3300025900 | Bacteria | 2309 |
| 372 | Ga0207647_10000067 | 3300025904 | Bacteria | 81496 |
| 373 | Ga0207647_10067332 | 3300025904 | Bacteria | 2171 |
| 374 | Ga0207647_10079391 | 3300025904 | Bacteria | 1970 |
| 375 | Ga0207647_10092039 | 3300025904 | Unclassified | 1808 |
| 376 | Ga0207645_10001397 | 3300025907 | Bacteria | 19778 |
| 377 | Ga0207645_10004781 | 3300025907 | Bacteria | 9958 |
| 378 | Ga0207643_10108718 | 3300025908 | Bacteria | 1632 |
| 379 | Ga0207643_10356856 | 3300025908 | Bacteria | 918 |
| 380 | Ga0207705_10000118 | 3300025909 | Bacteria | 88199 |
| 381 | Ga0207705_10199212 | 3300025909 | Bacteria | 1517 |
| 382 | Ga0207705_10273737 | 3300025909 | Unclassified | 1291 |
| 383 | Ga0207654_10000161 | 3300025911 | Bacteria | 43036 |
| 384 | Ga0207654_10006158 | 3300025911 | Bacteria | 6030 |
| 385 | Ga0207654_10121446 | 3300025911 | Bacteria | 1641 |
| 386 | Ga0207654_10122862 | 3300025911 | Bacteria | 1633 |
| 387 | Ga0207707_10053658 | 3300025912 | Bacteria | 3509 |
| 388 | Ga0207695_10000257 | 3300025913 | Bacteria | 134853 |
| 389 | Ga0207695_10001231 | 3300025913 | Bacteria | 43824 |
| 390 | Ga0207695_10007678 | 3300025913 | Bacteria | 13660 |
| 391 | Ga0207695_10033261 | 3300025913 | Bacteria | 5627 |
| 392 | Ga0207695_10043989 | 3300025913 | Bacteria | 4754 |
| 393 | Ga0207695_10052011 | 3300025913 | Bacteria | 4295 |
| 394 | Ga0207695_10159063 | 3300025913 | Bacteria | 2192 |
| 395 | Ga0207695_10171926 | 3300025913 | Bacteria | 2092 |
| 396 | Ga0207671_10000615 | 3300025914 | Bacteria | 46998 |
| 397 | Ga0207671_10000880 | 3300025914 | Bacteria | 38016 |
| 398 | Ga0207671_10001763 | 3300025914 | Bacteria | 24330 |
| 399 | Ga0207671_10002463 | 3300025914 | Bacteria | 19778 |
| 400 | Ga0207671_10004297 | 3300025914 | Bacteria | 13698 |
| 401 | Ga0207671_10024434 | 3300025914 | Bacteria | 4545 |
| 402 | Ga0207671_10037085 | 3300025914 | Bacteria | 3615 |
| 403 | Ga0207671_10059743 | 3300025914 | Bacteria | 2828 |
| 404 | Ga0207671_10324501 | 3300025914 | Bacteria | 1218 |
| 405 | Ga0207660_10024790 | 3300025917 | Bacteria | 4063 |
| 406 | Ga0207657_10058279 | 3300025919 | Bacteria | 3324 |
| 407 | Ga0207657_10118832 | 3300025919 | Bacteria | 2176 |
| 408 | Ga0207649_10004427 | 3300025920 | Bacteria | 7626 |
| 409 | Ga0207649_10041644 | 3300025920 | Bacteria | 2796 |
| 410 | Ga0207649_10069659 | 3300025920 | Bacteria | 2241 |
| 411 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 412 | Ga0207652_10000115 | 3300025921 | Bacteria | 87927 |
| 413 | Ga0207652_10006098 | 3300025921 | Bacteria | 9751 |
| 414 | Ga0207681_10230401 | 3300025923 | Bacteria | 1438 |
| 415 | Ga0207694_10203630 | 3300025924 | Bacteria | 1611 |
| 416 | Ga0207650_10036172 | 3300025925 | Bacteria | 3590 |
| 417 | Ga0207659_10038203 | 3300025926 | Bacteria | 3337 |
| 418 | Ga0207644_10035825 | 3300025931 | Unclassified | 3480 |
| 419 | Ga0207690_10007938 | 3300025932 | Bacteria | 6301 |
| 420 | Ga0207690_10134702 | 3300025932 | Unclassified | 1812 |
| 421 | Ga0207706_10000123 | 3300025933 | Bacteria | 83810 |
| 422 | Ga0207706_10006646 | 3300025933 | Bacteria | 10694 |
| 423 | Ga0207706_10056593 | 3300025933 | Bacteria | 3457 |
| 424 | Ga0207706_10194312 | 3300025933 | Unclassified | 1780 |
| 425 | Ga0207706_10520555 | 3300025933 | Bacteria | 1026 |
| 426 | Ga0207706_10535295 | 3300025933 | Unclassified | 1009 |
| 427 | Ga0207686_10286895 | 3300025934 | Bacteria | 1217 |
| 428 | Ga0207709_10295440 | 3300025935 | Bacteria | 1202 |
| 429 | Ga0207670_10070517 | 3300025936 | Bacteria | 2414 |
| 430 | Ga0207670_10103275 | 3300025936 | Bacteria | 2039 |
| 431 | Ga0207669_10098045 | 3300025937 | Bacteria | 1929 |
| 432 | Ga0207704_10000135 | 3300025938 | Bacteria | 40033 |
| 433 | Ga0207691_10070927 | 3300025940 | Unclassified | 3146 |
| 434 | Ga0207691_10167053 | 3300025940 | Bacteria | 1928 |
| 435 | Ga0207689_10021414 | 3300025942 | Bacteria | 5436 |
| 436 | Ga0207689_10053335 | 3300025942 | Bacteria | 3331 |
| 437 | Ga0207689_10074429 | 3300025942 | Bacteria | 2791 |
| 438 | Ga0207689_10116923 | 3300025942 | Bacteria | 2192 |
| 439 | Ga0207689_10597701 | 3300025942 | Bacteria | 928 |
| 440 | Ga0207661_10008066 | 3300025944 | Bacteria | 7509 |
| 441 | Ga0207661_10084554 | 3300025944 | Bacteria | 2628 |
| 442 | Ga0207661_10337668 | 3300025944 | Bacteria | 1357 |
| 443 | Ga0207679_10000575 | 3300025945 | Bacteria | 24610 |
| 444 | Ga0207679_10013011 | 3300025945 | Bacteria | 5444 |
| 445 | Ga0207679_10183860 | 3300025945 | Bacteria | 1731 |
| 446 | Ga0207667_10000349 | 3300025949 | Bacteria | 62960 |
| 447 | Ga0207667_10000404 | 3300025949 | Bacteria | 58450 |
| 448 | Ga0207667_10006204 | 3300025949 | Bacteria | 14512 |
| 449 | Ga0207667_10013229 | 3300025949 | Bacteria | 9461 |
| 450 | Ga0207667_10027581 | 3300025949 | Bacteria | 6179 |
| 451 | Ga0207667_10053057 | 3300025949 | Bacteria | 4267 |
| 452 | Ga0207667_10124489 | 3300025949 | Bacteria | 2655 |
| 453 | Ga0207667_10226376 | 3300025949 | Bacteria | 1916 |
| 454 | Ga0207667_10834348 | 3300025949 | Bacteria | 917 |
| 455 | Ga0207651_10095867 | 3300025960 | Bacteria | 2186 |
| 456 | Ga0207651_10124499 | 3300025960 | Bacteria | 1961 |
| 457 | Ga0207651_10193249 | 3300025960 | Bacteria | 1625 |
| 458 | Ga0207651_10334072 | 3300025960 | Bacteria | 1271 |
| 459 | Ga0207712_10096204 | 3300025961 | Bacteria | 2191 |
| 460 | Ga0207712_10500167 | 3300025961 | Bacteria | 1039 |
| 461 | Ga0207640_10090395 | 3300025981 | Bacteria | 2119 |
| 462 | Ga0207658_10181486 | 3300025986 | Bacteria | 1742 |
| 463 | Ga0207677_10008441 | 3300026023 | Bacteria | 5754 |
| 464 | Ga0207677_10094055 | 3300026023 | Bacteria | 2187 |
| 465 | Ga0207677_10224640 | 3300026023 | Bacteria | 1508 |
| 466 | Ga0207677_10225110 | 3300026023 | Bacteria | 1507 |
| 467 | Ga0207703_10339168 | 3300026035 | Unclassified | 1381 |
| 468 | Ga0207703_10636108 | 3300026035 | Bacteria | 1011 |
| 469 | Ga0207639_10003578 | 3300026041 | Bacteria | 10437 |
| 470 | Ga0207639_10006893 | 3300026041 | Bacteria | 7740 |
| 471 | Ga0207639_10037785 | 3300026041 | Bacteria | 3589 |
| 472 | Ga0207639_10092720 | 3300026041 | Bacteria | 2421 |
| 473 | Ga0207639_10319359 | 3300026041 | Bacteria | 1378 |
| 474 | Ga0207678_10062738 | 3300026067 | Bacteria | 3194 |
| 475 | Ga0207678_10080570 | 3300026067 | Bacteria | 2787 |
| 476 | Ga0207702_10000455 | 3300026078 | Bacteria | 46164 |
| 477 | Ga0207702_10087210 | 3300026078 | Bacteria | 2724 |
| 478 | Ga0207702_10187712 | 3300026078 | Unclassified | 1907 |
| 479 | Ga0207641_10166345 | 3300026088 | Bacteria | 2009 |
| 480 | Ga0207641_10309253 | 3300026088 | Unclassified | 1495 |
| 481 | Ga0207641_10478543 | 3300026088 | Bacteria | 1207 |
| 482 | Ga0207648_10010277 | 3300026089 | Bacteria | 8886 |
| 483 | Ga0207648_10033674 | 3300026089 | Bacteria | 4519 |
| 484 | Ga0207648_10041084 | 3300026089 | Bacteria | 4062 |
| 485 | Ga0207648_10127722 | 3300026089 | Bacteria | 2236 |
| 486 | Ga0207676_10052792 | 3300026095 | Bacteria | 3179 |
| 487 | Ga0207676_10101027 | 3300026095 | Bacteria | 2391 |
| 488 | Ga0207676_10130545 | 3300026095 | Unclassified | 2135 |
| 489 | Ga0207674_10001817 | 3300026116 | Bacteria | 27232 |
| 490 | Ga0207674_10117654 | 3300026116 | Bacteria | 2628 |
| 491 | Ga0207674_10142304 | 3300026116 | Bacteria | 2358 |
| 492 | Ga0207674_10171149 | 3300026116 | Bacteria | 2125 |
| 493 | Ga0207674_10196845 | 3300026116 | Bacteria | 1965 |
| 494 | Ga0207675_100422631 | 3300026118 | Bacteria | 1316 |
| 495 | Ga0207683_10007145 | 3300026121 | Bacteria | 9573 |
| 496 | Ga0207683_10015716 | 3300026121 | Bacteria | 6441 |
| 497 | Ga0207698_10004956 | 3300026142 | Bacteria | 8159 |
| 498 | Ga0207698_10049030 | 3300026142 | Bacteria | 3211 |
| 499 | Ga0207698_10067689 | 3300026142 | Bacteria | 2817 |
| 500 | Ga0207698_10213245 | 3300026142 | Bacteria | 1739 |
| 501 | Ga0207698_10653977 | 3300026142 | Bacteria | 1041 |
| 502 | Ga0268266_10000111 | 3300028379 | Bacteria | 169743 |
| 503 | Ga0268266_10308683 | 3300028379 | Unclassified | 1478 |
| 504 | Ga0268266_10358231 | 3300028379 | Bacteria | 1372 |
| 505 | Ga0268265_10381218 | 3300028380 | Bacteria | 1297 |
| 506 | Ga0268264_10423639 | 3300028381 | Bacteria | 1284 |
| 507 | Ga0307517_10006725 | 3300028786 | Bacteria | 16924 |
| 508 | Ga0307517_10025589 | 3300028786 | Bacteria | 7207 |
| 509 | Ga0307515_10000226 | 3300028794 | Bacteria | 139533 |
| 510 | Ga0307515_10000507 | 3300028794 | Bacteria | 93166 |
| 511 | Ga0307515_10235051 | 3300028794 | Bacteria | 1616 |
| 512 | Ga0265338_10038979 | 3300028800 | Bacteria | 4492 |
| 513 | Ga0265338_10296447 | 3300028800 | Bacteria | 1177 |
| 514 | Ga0265327_10067090 | 3300031251 | Bacteria | 1809 |
| 515 | Ga0316576_10131317 | 3300031727 | Bacteria | 1884 |
| 516 | Ga0307516_10000527 | 3300031730 | Bacteria | 51209 |
| 517 | Ga0307516_10032323 | 3300031730 | Bacteria | 5271 |
| 518 | Ga0307412_10539170 | 3300031911 | Unclassified | 978 |
| 519 | Ga0307507_10000152 | 3300033179 | Bacteria | 122095 |
| 520 | Ga0307510_10000825 | 3300033180 | Bacteria | 32314 |
| 521 | Ga0307510_10004624 | 3300033180 | Bacteria | 16230 |
| 522 | Ga0373941_0030475 | 3300035115 | Bacteria | 1599 |
| 523 | Ga0373953_0246192 | 3300035117 | Bacteria | 777 |
| 524 | Ga0316574_0201273 | 3300035398 | Bacteria | 1279 |
| 525 | Ga0373935_0116735 | 3300035692 | Bacteria | 1778 |
| 526 | Ga0373947_0216852 | 3300035725 | Bacteria | 1257 |
| 527 | Ga0373947_0409901 | 3300035725 | Unclassified | 915 |
| 528 | Ga0395899_0000087 | 3300037312 | Bacteria | 157502 |
| 529 | Ga0395899_0001566 | 3300037312 | Bacteria | 19246 |
| 530 | Ga0395899_0006248 | 3300037312 | Bacteria | 9226 |
| 531 | Ga0395899_0025319 | 3300037312 | Bacteria | 4478 |
| 532 | Ga0395899_0045691 | 3300037312 | Bacteria | 3263 |
| 533 | Ga0395899_0061798 | 3300037312 | Bacteria | 2758 |
| 534 | Ga0395899_0187538 | 3300037312 | Bacteria | 1448 |
| 535 | Ga0395899_0217670 | 3300037312 | Unclassified | 1324 |
| 536 | Ga0395900_0000095 | 3300037418 | Bacteria | 164383 |
| 537 | Ga0395900_0003233 | 3300037418 | Bacteria | 17638 |
| 538 | Ga0395900_0004567 | 3300037418 | Bacteria | 14622 |
| 539 | Ga0395900_0014891 | 3300037418 | Bacteria | 7924 |
| 540 | Ga0395900_0042519 | 3300037418 | Bacteria | 4682 |
| 541 | Ga0395900_0060061 | 3300037418 | Bacteria | 3913 |
| 542 | Ga0395900_0154767 | 3300037418 | Bacteria | 2341 |
| 543 | Ga0395900_0157819 | 3300037418 | Bacteria | 2316 |
| 544 | Ga0395898_0000595 | 3300037466 | Bacteria | 67162 |
| 545 | Ga0395898_0029694 | 3300037466 | Bacteria | 5472 |
| 546 | Ga0395898_0037849 | 3300037466 | Bacteria | 4782 |
| 547 | Ga0395898_0098498 | 3300037466 | Bacteria | 2807 |
| 548 | Ga0395898_0138049 | 3300037466 | Bacteria | 2334 |
| 549 | Ga0395898_0314002 | 3300037466 | Bacteria | 1495 |
| 550 | Ga0395905_0000124 | 3300037471 | Bacteria | 126707 |
| 551 | Ga0395905_0000266 | 3300037471 | Bacteria | 78131 |
| 552 | Ga0395905_0007445 | 3300037471 | Bacteria | 10889 |
| 553 | Ga0395905_0143950 | 3300037471 | Bacteria | 2243 |
| 554 | Ga0395905_0201326 | 3300037471 | Bacteria | 1867 |
| 555 | Ga0395901_0001672 | 3300038443 | Bacteria | 22890 |
| 556 | Ga0395901_0003424 | 3300038443 | Bacteria | 15991 |
| 557 | Ga0395901_0011539 | 3300038443 | Bacteria | 8953 |
| 558 | Ga0395901_0064301 | 3300038443 | Bacteria | 3818 |
| 559 | Ga0395901_0095290 | 3300038443 | Bacteria | 3119 |
| 560 | Ga0395901_0210464 | 3300038443 | Unclassified | 2035 |
| 561 | Ga0436361_0568589 | 3300039447 | Bacteria | 4916 |
| 562 | Ga0451841_1127396 | 3300041498 | Bacteria | 1025 |
| 563 | Ga0439431_0081370 | 3300041997 | Bacteria | 873 |
| 564 | Ga0451577_0000123 | 3300042876 | Bacteria | 169380 |
| 565 | Ga0451577_0000389 | 3300042876 | Bacteria | 81293 |
| 566 | Ga0451577_0030330 | 3300042876 | Unclassified | 4887 |
| 567 | Ga0451577_0113229 | 3300042876 | Bacteria | 2428 |
| 568 | Ga0451577_0130918 | 3300042876 | Bacteria | 2250 |
| 569 | Ga0451577_1030595 | 3300042876 | Unclassified | 738 |
| 570 | Ga0466969_0050319 | 3300044656 | Bacteria | 2054 |
| 571 | Ga0466972_0004332 | 3300044658 | Bacteria | 7091 |
| 572 | Ga0453683_0000366 | 3300044673 | Bacteria | 54040 |
| 573 | Ga0466965_0043327 | 3300044683 | Bacteria | 2222 |
| 574 | Ga0466965_0142938 | 3300044683 | Bacteria | 1247 |
| 575 | Ga0453684_0000127 | 3300044712 | Bacteria | 336026 |
| 576 | Ga0453684_0000225 | 3300044712 | Bacteria | 245902 |
| 577 | Ga0453684_0001168 | 3300044712 | Bacteria | 81539 |
| 578 | Ga0453684_0003570 | 3300044712 | Bacteria | 34746 |
| 579 | Ga0453684_0006876 | 3300044712 | Bacteria | 21353 |
| 580 | Ga0453684_0097084 | 3300044712 | Unclassified | 3617 |
| 581 | Ga0453684_0184261 | 3300044712 | Bacteria | 2448 |
| 582 | Ga0453684_0361372 | 3300044712 | Bacteria | 1634 |
| 583 | Ga0466968_0116688 | 3300044735 | Bacteria | 1205 |
| 584 | Ga0466959_0009399 | 3300045049 | Bacteria | 6952 |
| 585 | Ga0466959_0019801 | 3300045049 | Bacteria | 4952 |
| 586 | Ga0466959_0062474 | 3300045049 | Bacteria | 2706 |
| 587 | Ga0466959_0616482 | 3300045049 | Unclassified | 729 |
| 588 | Ga0451576_0000178 | 3300045051 | Bacteria | 160411 |
| 589 | Ga0451576_0000540 | 3300045051 | Bacteria | 81293 |
| 590 | Ga0451576_0003178 | 3300045051 | Bacteria | 22943 |
| 591 | Ga0451576_0008699 | 3300045051 | Bacteria | 11880 |
| 592 | Ga0451576_0016809 | 3300045051 | Bacteria | 8065 |
| 593 | Ga0451576_0206128 | 3300045051 | Bacteria | 2053 |
| 594 | Ga0451576_0489647 | 3300045051 | Unclassified | 1292 |
| 595 | Ga0466958_0109139 | 3300045836 | Bacteria | 1727 |
| 596 | Ga0466958_0155933 | 3300045836 | Bacteria | 1441 |
| 597 | Ga0495627_001600 | 3300046453 | Bacteria | 12682 |
| 598 | Ga0495592_0312479 | 3300046454 | Bacteria | 1018 |
| 599 | Ga0495629_0089358 | 3300046459 | Bacteria | 2149 |
| 600 | Ga0495638_0137602 | 3300046460 | Bacteria | 1428 |
| 601 | Ga0495651_0299791 | 3300046462 | Bacteria | 1078 |
| 602 | Ga0495653_0214252 | 3300046463 | Bacteria | 1299 |
| 603 | Ga0495650_0000127 | 3300046471 | Bacteria | 177276 |
| 604 | Ga0495650_0015286 | 3300046471 | Bacteria | 3943 |
| 605 | Ga0495605_0128197 | 3300046474 | Bacteria | 1146 |
| 606 | Ga0495585_0000062 | 3300046492 | Bacteria | 109539 |
| 607 | Ga0495585_0004635 | 3300046492 | Bacteria | 8875 |
| 608 | Ga0495606_0000035 | 3300046507 | Bacteria | 243820 |
| 609 | Ga0495606_0004847 | 3300046507 | Bacteria | 13205 |
| 610 | Ga0495606_0007119 | 3300046507 | Bacteria | 10111 |
| 611 | Ga0495606_0018609 | 3300046507 | Bacteria | 5199 |
| 612 | Ga0495606_0034730 | 3300046507 | Bacteria | 3457 |
| 613 | Ga0495606_0167172 | 3300046507 | Bacteria | 1279 |
| 614 | Ga0495610_0001444 | 3300046512 | Bacteria | 20996 |
| 615 | Ga0495610_0089599 | 3300046512 | Bacteria | 1397 |
| 616 | Ga0495616_0006772 | 3300046513 | Bacteria | 6907 |
| 617 | Ga0495616_0007163 | 3300046513 | Bacteria | 6687 |
| 618 | Ga0495628_0042041 | 3300046516 | Bacteria | 3647 |
| 619 | Ga0495630_0039748 | 3300046517 | Bacteria | 3517 |
| 620 | Ga0495631_0008936 | 3300046518 | Bacteria | 5025 |
| 621 | Ga0495631_0070079 | 3300046518 | Bacteria | 1516 |
| 622 | Ga0495632_0098420 | 3300046519 | Bacteria | 1380 |
| 623 | Ga0495637_0121974 | 3300046520 | Bacteria | 1002 |
| 624 | Ga0495644_0004047 | 3300046523 | Bacteria | 5770 |
| 625 | Ga0495648_0004897 | 3300046524 | Bacteria | 11264 |
| 626 | Ga0495648_0031388 | 3300046524 | Bacteria | 3498 |
| 627 | Ga0495648_0073111 | 3300046524 | Bacteria | 1981 |
| 628 | Ga0495654_0035481 | 3300046530 | Bacteria | 2511 |
| 629 | Ga0495609_0015047 | 3300046538 | Bacteria | 3625 |
| 630 | Ga0495622_0043577 | 3300046557 | Bacteria | 2086 |
| 631 | Ga0495633_0000267 | 3300046558 | Bacteria | 61184 |
| 632 | Ga0495633_0004596 | 3300046558 | Bacteria | 8702 |
| 633 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 634 | Ga0495625_0000048 | 3300046660 | Bacteria | 198976 |
| 635 | Ga0495625_0000456 | 3300046660 | Bacteria | 61289 |
| 636 | Ga0495625_0002379 | 3300046660 | Bacteria | 20472 |
| 637 | Ga0495625_0211987 | 3300046660 | Bacteria | 1273 |
| 638 | Ga0495661_0000636 | 3300046665 | Bacteria | 35605 |
| 639 | Ga0495661_0000714 | 3300046665 | Bacteria | 32835 |
| 640 | Ga0495658_0006168 | 3300046683 | Bacteria | 5883 |
| 641 | Ga0495649_0000377 | 3300046694 | Bacteria | 38650 |
| 642 | Ga0495649_0138263 | 3300046694 | Bacteria | 1283 |
| 643 | Ga0495683_0127984 | 3300047323 | Bacteria | 1200 |
| 644 | Ga0495687_000079 | 3300047443 | Bacteria | 147704 |
| 645 | Ga0495687_004133 | 3300047443 | Bacteria | 10003 |
| 646 | Ga0495686_0001369 | 3300047472 | Bacteria | 27183 |
| 647 | Ga0495686_0010878 | 3300047472 | Bacteria | 6443 |
| 648 | Ga0495686_0051371 | 3300047472 | Bacteria | 2587 |
| 649 | Ga0495614_0025556 | 3300048089 | Bacteria | 2547 |
| 650 | Ga0496108_0130120 | 3300048911 | Bacteria | 2164 |
| 651 | Ga0496110_0031861 | 3300048913 | Bacteria | 4551 |
| 652 | Ga0496110_0909814 | 3300048913 | Bacteria | 786 |
| 653 | Ga0496113_0273172 | 3300048916 | Bacteria | 1351 |
| 654 | Ga0495678_014528 | 3300049459 | Bacteria | 3657 |
| 655 | Ga0501298_001197 | 3300049521 | Bacteria | 3766 |
| 656 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 657 | Ga0501034_0044695 | 3300049571 | Bacteria | 4478 |
| 658 | Ga0501201_002647 | 3300049651 | Bacteria | 1638 |
| 659 | Ga0501202_000215 | 3300049652 | Bacteria | 7516 |
| 660 | Ga0501206_013958 | 3300049653 | Bacteria | 1101 |
| 661 | Ga0501207_003742 | 3300049654 | Bacteria | 2040 |
| 662 | Ga0501222_007902 | 3300049662 | Bacteria | 1416 |
| 663 | Ga0501223_003499 | 3300049663 | Bacteria | 3411 |
| 664 | Ga0501224_006555 | 3300049664 | Bacteria | 1689 |
| 665 | Ga0501235_022257 | 3300049669 | Bacteria | 1409 |
| 666 | Ga0501251_020426 | 3300049681 | Bacteria | 875 |
| 667 | Ga0501252_000654 | 3300049682 | Bacteria | 2788 |
| 668 | Ga0501259_004248 | 3300049688 | Bacteria | 2280 |
| 669 | Ga0501221_002269 | 3300049704 | Bacteria | 3194 |
| 670 | Ga0501225_0006325 | 3300049705 | Bacteria | 3461 |
| 671 | Ga0501234_010091 | 3300049707 | Bacteria | 1472 |
| 672 | Ga0501245_000686 | 3300049708 | Bacteria | 4189 |
| 673 | nmdc:mga0k408_2667_c1 | 3300050493 | Bacteria | 9463 |
| 674 | nmdc:mga08y16_248152_c1 | 3300050511 | Bacteria | 1839 |
| 675 | nmdc:mga0n895_26850_c1 | 3300050512 | Bacteria | 5461 |
| 676 | Ga0500635_0010385 | 3300053080 | Bacteria | 2613 |
| 677 | Ga0500583_0014877 | 3300053092 | Bacteria | 3062 |
| 678 | Ga0500562_000004 | 3300053108 | Bacteria | 270087 |
| 679 | Ga0500608_018636 | 3300053122 | Bacteria | 3170 |
| 680 | Ga0500608_049934 | 3300053122 | Bacteria | 2011 |
| 681 | Ga0500618_000038 | 3300053125 | Bacteria | 116036 |
| 682 | Ga0500642_0080095 | 3300053130 | Bacteria | 1499 |
| 683 | Ga0500652_117235 | 3300053131 | Bacteria | 1113 |
| 684 | Ga0500568_0004727 | 3300053139 | Bacteria | 7216 |
| 685 | Ga0500622_0001671 | 3300053156 | Bacteria | 17318 |
| 686 | Ga0500624_000274 | 3300053157 | Bacteria | 17785 |
| 687 | Ga0466962_0039766 | 3300061719 | Bacteria | 2251 |
| 688 | 2599480173 | 2599185184 | Bacteria | 6430550 |
| 689 | 2819676561 | 2818991460 | Bacteria | 7595395 |
| 690 | 2840678457 | 2840677318 | Bacteria | 2664183 |
| 691 | 2852624661 | 2852623160 | Bacteria | 4376875 |
| 692 | 2884796422 | 2884791551 | Bacteria | 8511252 |
| 693 | 2884936453 | 2884933994 | Bacteria | 4535041 |
| 694 | 2896086275 | 2896085136 | Bacteria | 6129793 |
| 695 | 2896113435 | 2896109856 | Bacteria | 7140722 |
| 696 | 2919438412 | 2919437846 | Bacteria | 6199444 |
| 697 | 2928083616 | 2928078545 | Bacteria | 6534839 |
| 698 | 2928151123 | 2928147474 | Bacteria | 6512076 |
| 699 | 2929178064 | 2929177148 | Bacteria | 7883697 |
| 700 | 2929922150 | 2929921140 | Bacteria | 8649150 |
| 701 | 2932084421 | 2932082852 | Bacteria | 6563563 |
| 702 | 2945980424 | 2945977869 | Bacteria | 7777518 |
| 703 | 2946013713 | 2946013367 | Bacteria | 7766675 |
| 704 | 2977233120 | 2977232053 | Bacteria | 5485925 |
| 705 | 8003155640 | 8003151029 | Bacteria | 8187759 |
| 706 | Ga0070670_100336759 | |||
| 707 | SwRhRL2b_contig_1189533 | |||
| 708 | JGI24740J21852_10002460 | |||
| 709 | JGI24740J21852_10020253 | |||
| 710 | JGI24739J22299_10013928 | |||
| 711 | JGI24739J22299_10018344 | |||
| 712 | JGI24737J22298_10000014 | |||
| 713 | JGI24735J21928_10000008 | |||
| 714 | JGI25162J39368_1000059 | |||
| 715 | JGI25162J39368_1000609 | |||
| 716 | JGI25154J39366_1000003 | |||
| 717 | JGI25157J39369_1004219 | |||
| 718 | JGI25406J46586_10000469 | |||
| 719 | JGI25153J46596_10012528 | |||
| 720 | JGI25153J46596_10068574 | |||
| 721 | rootH1_10066643 | |||
| 722 | rootH2_10001801 | |||
| 723 | rootH2_10006838 | |||
| 724 | rootH2_10017993 | |||
| 725 | rootH2_10038098 | |||
| 726 | rootH2_10038656 | |||
| 727 | rootH2_10068434 | |||
| 728 | rootH2_10069792 | |||
| 729 | rootH2_10098188 | |||
| 730 | rootH2_10230905 | |||
| 731 | rootH2_10235789 | |||
| 732 | rootL2_10012281 | |||
| 733 | rootL2_10013360 | |||
| 734 | rootL2_10231865 | |||
| 735 | rootL2_10365832 | |||
| 736 | rootH1_10014610 | |||
| 737 | rootH1_10017864 | |||
| 738 | rootH1_10026151 | |||
| 739 | rootH1_10026159 | |||
| 740 | rootH1_10085318 | |||
| 741 | rootH1_10133797 | |||
| 742 | rootH1_10161700 | |||
| 743 | rootH1_10239212 | |||
| 744 | JGI25160J50197_1005312 | |||
| 745 | JGI25160J50197_1006262 | |||
| 746 | JGI25160J50197_1007304 | |||
| 747 | JGI25160J50197_1011486 | |||
| 748 | Ga0055526_1005747 | |||
| 749 | Ga0055526_1017233 | |||
| 750 | Ga0055528_1000278 | |||
| 751 | Ga0055530_10000463 | |||
| 752 | Ga0065165_1000010 | |||
| 753 | Ga0065165_1001597 | |||
| 754 | Ga0065165_1022373 | |||
| 755 | Ga0065714_10007900 | |||
| 756 | Ga0065714_10081652 | |||
| 757 | Ga0065704_10093229 | |||
| 758 | Ga0070658_10000098 | |||
| 759 | Ga0070658_10069922 | |||
| 760 | Ga0070658_10295303 | |||
| 761 | Ga0070676_10000441 | |||
| 762 | Ga0070676_10009771 | |||
| 763 | Ga0070683_100004444 | |||
| 764 | Ga0070683_100025263 | |||
| 765 | Ga0070683_100138931 | |||
| 766 | Ga0070690_100006555 | |||
| 767 | Ga0070690_100264357 | |||
| 768 | Ga0070690_100274715 | |||
| 769 | Ga0070690_100550128 | |||
| 770 | Ga0070670_100147491 | |||
| 771 | Ga0068869_100062532 | |||
| 772 | Ga0068869_100243334 | |||
| 773 | Ga0068869_100575578 | |||
| 774 | Ga0070666_10035560 | |||
| 775 | Ga0070666_10165498 | |||
| 776 | Ga0070680_100104108 | |||
| 777 | Ga0070680_100372301 | |||
| 778 | Ga0070680_100593592 | |||
| 779 | Ga0070682_100039385 | |||
| 780 | Ga0068868_100034603 | |||
| 781 | Ga0068868_100038198 | |||
| 782 | Ga0068868_100108928 | |||
| 783 | Ga0068868_100121983 | |||
| 784 | Ga0068868_100127624 | |||
| 785 | Ga0068868_100601723 | |||
| 786 | Ga0070660_100058610 | |||
| 787 | Ga0070660_100093765 | |||
| 788 | Ga0070660_100376541 | |||
| 789 | Ga0070689_100009628 | |||
| 790 | Ga0070689_100297521 | |||
| 791 | Ga0070691_10004791 | |||
| 792 | Ga0070661_100001488 | |||
| 793 | Ga0070661_100060262 | |||
| 794 | Ga0070661_100117797 | |||
| 795 | Ga0070692_10078569 | |||
| 796 | Ga0070669_100292644 | |||
| 797 | Ga0070671_100069643 | |||
| 798 | Ga0070671_100135774 | |||
| 799 | Ga0070673_100038481 | |||
| 800 | Ga0070673_100082109 | |||
| 801 | Ga0070673_100188002 | |||
| 802 | Ga0070673_100360213 | |||
| 803 | Ga0070673_100467131 | |||
| 804 | Ga0070688_100001493 | |||
| 805 | Ga0070659_100170311 | |||
| 806 | Ga0070659_100265226 | |||
| 807 | Ga0070667_100042279 | |||
| 808 | Ga0070667_100054756 | |||
| 809 | Ga0070667_100144483 | |||
| 810 | Ga0070714_100002411 | |||
| 811 | Ga0070710_10045738 | |||
| 812 | Ga0070663_100011737 | |||
| 813 | Ga0070663_100275739 | |||
| 814 | Ga0070678_100002815 | |||
| 815 | Ga0070678_100023069 | |||
| 816 | Ga0070662_100000516 | |||
| 817 | Ga0070662_100029140 | |||
| 818 | Ga0070662_100031643 | |||
| 819 | Ga0070662_100056978 | |||
| 820 | Ga0070662_100130937 | |||
| 821 | Ga0070662_100538437 | |||
| 822 | Ga0070681_10007666 | |||
| 823 | Ga0070681_10108845 | |||
| 824 | Ga0070681_10523323 | |||
| 825 | Ga0068867_100005793 | |||
| 826 | Ga0068867_100457430 | |||
| 827 | Ga0070685_10078292 | |||
| 828 | Ga0070679_100000158 | |||
| 829 | Ga0070679_100016715 | |||
| 830 | Ga0070679_100165594 | |||
| 831 | Ga0070679_100179401 | |||
| 832 | Ga0070679_100631257 | |||
| 833 | Ga0070684_100024079 | |||
| 834 | Ga0070684_100086844 | |||
| 835 | Ga0068853_100001327 | |||
| 836 | Ga0068853_100009815 | |||
| 837 | Ga0068853_100029263 | |||
| 838 | Ga0068853_100087071 | |||
| 839 | Ga0068853_100166399 | |||
| 840 | Ga0068853_100269415 | |||
| 841 | Ga0068853_100555246 | |||
| 842 | Ga0070672_100104888 | |||
| 843 | Ga0070672_100581345 | |||
| 844 | Ga0070686_100008632 | |||
| 845 | Ga0070665_100000034 | |||
| 846 | Ga0070665_100811163 | |||
| 847 | Ga0068855_100000041 | |||
| 848 | Ga0068855_100000280 | |||
| 849 | Ga0068855_100003853 | |||
| 850 | Ga0068855_100007291 | |||
| 851 | Ga0068855_100028100 | |||
| 852 | Ga0068855_100158002 | |||
| 853 | Ga0068855_100239119 | |||
| 854 | Ga0068855_100264230 | |||
| 855 | Ga0068855_100277069 | |||
| 856 | Ga0070664_100000360 | |||
| 857 | Ga0070664_100035965 | |||
| 858 | Ga0070664_100146476 | |||
| 859 | Ga0070664_100157765 | |||
| 860 | Ga0068857_100000323 | |||
| 861 | Ga0068857_100055855 | |||
| 862 | Ga0068857_100111418 | |||
| 863 | Ga0068857_100168199 | |||
| 864 | Ga0068857_100171470 | |||
| 865 | Ga0068854_100120790 | |||
| 866 | Ga0068856_100001619 | |||
| 867 | Ga0068856_100005649 | |||
| 868 | Ga0068856_100009859 | |||
| 869 | Ga0068856_100112357 | |||
| 870 | Ga0068856_100241083 | |||
| 871 | Ga0068856_100455708 | |||
| 872 | Ga0068856_100693712 | |||
| 873 | Ga0068856_100838604 | |||
| 874 | Ga0068852_100000178 | |||
| 875 | Ga0068852_100065160 | |||
| 876 | Ga0068852_100110417 | |||
| 877 | Ga0068852_100267205 | |||
| 878 | Ga0068859_100000990 | |||
| 879 | Ga0068859_100409689 | |||
| 880 | Ga0068864_100075881 | |||
| 881 | Ga0068864_100097241 | |||
| 882 | Ga0068864_100118374 | |||
| 883 | Ga0068864_100299326 | |||
| 884 | Ga0068866_10087418 | |||
| 885 | Ga0068866_10201967 | |||
| 886 | Ga0068866_10393802 | |||
| 887 | Ga0068866_10469915 | |||
| 888 | Ga0068851_10158274 | |||
| 889 | Ga0068851_10185463 | |||
| 890 | Ga0068863_100083820 | |||
| 891 | Ga0068858_100024468 | |||
| 892 | Ga0068858_100387126 | |||
| 893 | Ga0068858_100901848 | |||
| 894 | Ga0068860_100614556 | |||
| 895 | Ga0068862_100398803 | |||
| 896 | Ga0081540_1032160 | |||
| 897 | Ga0081539_10000345 | |||
| 898 | Ga0075366_10006400 | |||
| 899 | Ga0075366_10026527 | |||
| 900 | Ga0097621_100000161 | |||
| 901 | Ga0097621_100021202 | |||
| 902 | Ga0097621_100065083 | |||
| 903 | Ga0097621_100184875 | |||
| 904 | Ga0097621_100349591 | |||
| 905 | Ga0068871_100000492 | |||
| 906 | Ga0068871_100030143 | |||
| 907 | Ga0068871_100390696 | |||
| 908 | Ga0068865_100000603 | |||
| 909 | Ga0068865_100085965 | |||
| 910 | Ga0097620_100000990 | |||
| 911 | Ga0097620_100409692 | |||
| 912 | Ga0105240_10000208 | |||
| 913 | Ga0105240_10000225 | |||
| 914 | Ga0105240_10001556 | |||
| 915 | Ga0105240_10057226 | |||
| 916 | Ga0105240_10063706 | |||
| 917 | Ga0105240_10087944 | |||
| 918 | Ga0105240_10244189 | |||
| 919 | Ga0105240_10252245 | |||
| 920 | Ga0105240_10849279 | |||
| 921 | Ga0105240_11069841 | |||
| 922 | Ga0111539_10222276 | |||
| 923 | Ga0105247_10051678 | |||
| 924 | Ga0105243_10174911 | |||
| 925 | Ga0105241_10000124 | |||
| 926 | Ga0105241_10001477 | |||
| 927 | Ga0105241_10004921 | |||
| 928 | Ga0105241_10031194 | |||
| 929 | Ga0105241_10115897 | |||
| 930 | Ga0105241_10358916 | |||
| 931 | Ga0105241_10894285 | |||
| 932 | Ga0105242_10122417 | |||
| 933 | Ga0105242_10422102 | |||
| 934 | Ga0105242_10751200 | |||
| 935 | Ga0105248_10829536 | |||
| 936 | Ga0105237_10000156 | |||
| 937 | Ga0105237_10000965 | |||
| 938 | Ga0105237_10001225 | |||
| 939 | Ga0105237_10001843 | |||
| 940 | Ga0105237_10003951 | |||
| 941 | Ga0105237_10006764 | |||
| 942 | Ga0105237_10022659 | |||
| 943 | Ga0105237_10061488 | |||
| 944 | Ga0105237_10104920 | |||
| 945 | Ga0105237_10251940 | |||
| 946 | Ga0105237_10502902 | |||
| 947 | Ga0105238_10001372 | |||
| 948 | Ga0105238_10034624 | |||
| 949 | Ga0105238_10046184 | |||
| 950 | Ga0105238_10046868 | |||
| 951 | Ga0105249_10298148 | |||
| 952 | Ga0105249_10654173 | |||
| 953 | Ga0105239_10000017 | |||
| 954 | Ga0105239_10001666 | |||
| 955 | Ga0105239_10002037 | |||
| 956 | Ga0105239_10002706 | |||
| 957 | Ga0105239_10018096 | |||
| 958 | Ga0105239_10031569 | |||
| 959 | Ga0105239_10039642 | |||
| 960 | Ga0105239_10046878 | |||
| 961 | Ga0105239_10091836 | |||
| 962 | Ga0105239_10092775 | |||
| 963 | Ga0105239_10185586 | |||
| 964 | Ga0105239_10600732 | |||
| 965 | Ga0105246_10097660 | |||
| 966 | Ga0157373_10002886 | |||
| 967 | Ga0157373_10019438 | |||
| 968 | Ga0157373_10099255 | |||
| 969 | Ga0157373_10110904 | |||
| 970 | Ga0157373_10185682 | |||
| 971 | Ga0157371_10001089 | |||
| 972 | Ga0157371_10002710 | |||
| 973 | Ga0157371_10002722 | |||
| 974 | Ga0157371_10003195 | |||
| 975 | Ga0157371_10012073 | |||
| 976 | Ga0157371_10022670 | |||
| 977 | Ga0157371_10026504 | |||
| 978 | Ga0157371_10185849 | |||
| 979 | Ga0157371_10197219 | |||
| 980 | Ga0157371_10266274 | |||
| 981 | Ga0157370_10000549 | |||
| 982 | Ga0157370_10009541 | |||
| 983 | Ga0157370_10043539 | |||
| 984 | Ga0157370_10106911 | |||
| 985 | Ga0157370_10219758 | |||
| 986 | Ga0157370_10431160 | |||
| 987 | Ga0157369_10000664 | |||
| 988 | Ga0157369_10020600 | |||
| 989 | Ga0157369_10047707 | |||
| 990 | Ga0157369_10136329 | |||
| 991 | Ga0157369_10347799 | |||
| 992 | Ga0157374_10000001 | |||
| 993 | Ga0157374_10000217 | |||
| 994 | Ga0157374_10003858 | |||
| 995 | Ga0157374_10019255 | |||
| 996 | Ga0157374_10023675 | |||
| 997 | Ga0157374_10050381 | |||
| 998 | Ga0157374_10105592 | |||
| 999 | Ga0157374_10142227 | |||
| 1000 | Ga0157374_10336148 | |||
| 1001 | Ga0157374_10397152 | |||
| 1002 | Ga0157374_10566941 | |||
| 1003 | Ga0157378_10015307 | |||
| 1004 | Ga0157378_10040378 | |||
| 1005 | Ga0157378_10082238 | |||
| 1006 | Ga0157378_10082666 | |||
| 1007 | Ga0157378_10157779 | |||
| 1008 | Ga0157378_10479820 | |||
| 1009 | Ga0163162_10001362 | |||
| 1010 | Ga0163162_10012077 | |||
| 1011 | Ga0163162_10021128 | |||
| 1012 | Ga0163162_10076971 | |||
| 1013 | Ga0163162_10275417 | |||
| 1014 | Ga0163162_10707483 | |||
| 1015 | Ga0163162_10830727 | |||
| 1016 | Ga0163162_11169440 | |||
| 1017 | Ga0157372_10000109 | |||
| 1018 | Ga0157372_10011013 | |||
| 1019 | Ga0157372_10027710 | |||
| 1020 | Ga0157372_10100828 | |||
| 1021 | Ga0157372_10382941 | |||
| 1022 | Ga0157372_10420858 | |||
| 1023 | Ga0157372_10662913 | |||
| 1024 | Ga0157372_11012072 | |||
| 1025 | Ga0157375_10007871 | |||
| 1026 | Ga0157375_10038044 | |||
| 1027 | Ga0157375_10118524 | |||
| 1028 | Ga0157375_10135791 | |||
| 1029 | Ga0157375_10143151 | |||
| 1030 | Ga0157375_10164652 | |||
| 1031 | Ga0157375_10314017 | |||
| 1032 | Ga0157375_10325450 | |||
| 1033 | Ga0163163_10002119 | |||
| 1034 | Ga0157380_10000340 | |||
| 1035 | Ga0157380_10003327 | |||
| 1036 | Ga0157380_10083463 | |||
| 1037 | Ga0157380_10244938 | |||
| 1038 | Ga0157380_10322202 | |||
| 1039 | Ga0157377_10015824 | |||
| 1040 | Ga0157377_10048862 | |||
| 1041 | Ga0157379_10114500 | |||
| 1042 | Ga0157379_10462702 | |||
| 1043 | Ga0157376_10017753 | |||
| 1044 | Ga0157376_10035449 | |||
| 1045 | Ga0157376_10098695 | |||
| 1046 | Ga0163161_10041762 | |||
| 1047 | Ga0163161_10106229 | |||
| 1048 | Ga0213872_10025432 | |||
| 1049 | Ga0209436_100329 | |||
| 1050 | Ga0207427_100138 | |||
| 1051 | Ga0209437_100010 | |||
| 1052 | Ga0209437_100169 | |||
| 1053 | Ga0209646_1000004 | |||
| 1054 | Ga0209026_1000192 | |||
| 1055 | Ga0209233_1000017 | |||
| 1056 | Ga0209673_1000261 | |||
| 1057 | Ga0209673_1019407 | |||
| 1058 | Ga0209130_1002763 | |||
| 1059 | Ga0209564_1004118 | |||
| 1060 | Ga0209564_1011224 | |||
| 1061 | Ga0209564_1017609 | |||
| 1062 | Ga0209758_1003208 | |||
| 1063 | Ga0209758_1004508 | |||
| 1064 | Ga0209050_1000577 | |||
| 1065 | Ga0207426_1000033 | |||
| 1066 | Ga0207426_1000189 | |||
| 1067 | Ga0207426_1000594 | |||
| 1068 | Ga0207426_1000994 | |||
| 1069 | Ga0207426_1003568 | |||
| 1070 | Ga0209257_1003143 | |||
| 1071 | Ga0207656_10162053 | |||
| 1072 | Ga0207656_10165225 | |||
| 1073 | Ga0207642_10087275 | |||
| 1074 | Ga0207710_10031821 | |||
| 1075 | Ga0207647_10000067 | |||
| 1076 | Ga0207647_10067332 | |||
| 1077 | Ga0207647_10079391 | |||
| 1078 | Ga0207647_10092039 | |||
| 1079 | Ga0207645_10001397 | |||
| 1080 | Ga0207645_10004781 | |||
| 1081 | Ga0207643_10108718 | |||
| 1082 | Ga0207643_10356856 | |||
| 1083 | Ga0207705_10000118 | |||
| 1084 | Ga0207705_10199212 | |||
| 1085 | Ga0207705_10273737 | |||
| 1086 | Ga0207654_10000161 | |||
| 1087 | Ga0207654_10006158 | |||
| 1088 | Ga0207654_10121446 | |||
| 1089 | Ga0207654_10122862 | |||
| 1090 | Ga0207707_10053658 | |||
| 1091 | Ga0207695_10000257 | |||
| 1092 | Ga0207695_10001231 | |||
| 1093 | Ga0207695_10007678 | |||
| 1094 | Ga0207695_10033261 | |||
| 1095 | Ga0207695_10043989 | |||
| 1096 | Ga0207695_10052011 | |||
| 1097 | Ga0207695_10159063 | |||
| 1098 | Ga0207695_10171926 | |||
| 1099 | Ga0207671_10000615 | |||
| 1100 | Ga0207671_10000880 | |||
| 1101 | Ga0207671_10001763 | |||
| 1102 | Ga0207671_10002463 | |||
| 1103 | Ga0207671_10004297 | |||
| 1104 | Ga0207671_10024434 | |||
| 1105 | Ga0207671_10037085 | |||
| 1106 | Ga0207671_10059743 | |||
| 1107 | Ga0207671_10324501 | |||
| 1108 | Ga0207660_10024790 | |||
| 1109 | Ga0207657_10058279 | |||
| 1110 | Ga0207657_10118832 | |||
| 1111 | Ga0207649_10004427 | |||
| 1112 | Ga0207649_10041644 | |||
| 1113 | Ga0207649_10069659 | |||
| 1114 | Ga0207652_10000013 | |||
| 1115 | Ga0207652_10000115 | |||
| 1116 | Ga0207652_10006098 | |||
| 1117 | Ga0207681_10230401 | |||
| 1118 | Ga0207694_10203630 | |||
| 1119 | Ga0207650_10036172 | |||
| 1120 | Ga0207659_10038203 | |||
| 1121 | Ga0207644_10035825 | |||
| 1122 | Ga0207690_10007938 | |||
| 1123 | Ga0207690_10134702 | |||
| 1124 | Ga0207706_10000123 | |||
| 1125 | Ga0207706_10006646 | |||
| 1126 | Ga0207706_10056593 | |||
| 1127 | Ga0207706_10194312 | |||
| 1128 | Ga0207706_10520555 | |||
| 1129 | Ga0207706_10535295 | |||
| 1130 | Ga0207686_10286895 | |||
| 1131 | Ga0207709_10295440 | |||
| 1132 | Ga0207670_10070517 | |||
| 1133 | Ga0207670_10103275 | |||
| 1134 | Ga0207669_10098045 | |||
| 1135 | Ga0207704_10000135 | |||
| 1136 | Ga0207691_10070927 | |||
| 1137 | Ga0207691_10167053 | |||
| 1138 | Ga0207689_10021414 | |||
| 1139 | Ga0207689_10053335 | |||
| 1140 | Ga0207689_10074429 | |||
| 1141 | Ga0207689_10116923 | |||
| 1142 | Ga0207689_10597701 | |||
| 1143 | Ga0207661_10008066 | |||
| 1144 | Ga0207661_10084554 | |||
| 1145 | Ga0207661_10337668 | |||
| 1146 | Ga0207679_10000575 | |||
| 1147 | Ga0207679_10013011 | |||
| 1148 | Ga0207679_10183860 | |||
| 1149 | Ga0207667_10000349 | |||
| 1150 | Ga0207667_10000404 | |||
| 1151 | Ga0207667_10006204 | |||
| 1152 | Ga0207667_10013229 | |||
| 1153 | Ga0207667_10027581 | |||
| 1154 | Ga0207667_10053057 | |||
| 1155 | Ga0207667_10124489 | |||
| 1156 | Ga0207667_10226376 | |||
| 1157 | Ga0207667_10834348 | |||
| 1158 | Ga0207651_10095867 | |||
| 1159 | Ga0207651_10124499 | |||
| 1160 | Ga0207651_10193249 | |||
| 1161 | Ga0207651_10334072 | |||
| 1162 | Ga0207712_10096204 | |||
| 1163 | Ga0207712_10500167 | |||
| 1164 | Ga0207640_10090395 | |||
| 1165 | Ga0207658_10181486 | |||
| 1166 | Ga0207677_10008441 | |||
| 1167 | Ga0207677_10094055 | |||
| 1168 | Ga0207677_10224640 | |||
| 1169 | Ga0207677_10225110 | |||
| 1170 | Ga0207703_10339168 | |||
| 1171 | Ga0207703_10636108 | |||
| 1172 | Ga0207639_10003578 | |||
| 1173 | Ga0207639_10006893 | |||
| 1174 | Ga0207639_10037785 | |||
| 1175 | Ga0207639_10092720 | |||
| 1176 | Ga0207639_10319359 | |||
| 1177 | Ga0207678_10062738 | |||
| 1178 | Ga0207678_10080570 | |||
| 1179 | Ga0207702_10000455 | |||
| 1180 | Ga0207702_10087210 | |||
| 1181 | Ga0207702_10187712 | |||
| 1182 | Ga0207641_10166345 | |||
| 1183 | Ga0207641_10309253 | |||
| 1184 | Ga0207641_10478543 | |||
| 1185 | Ga0207648_10010277 | |||
| 1186 | Ga0207648_10033674 | |||
| 1187 | Ga0207648_10041084 | |||
| 1188 | Ga0207648_10127722 | |||
| 1189 | Ga0207676_10052792 | |||
| 1190 | Ga0207676_10101027 | |||
| 1191 | Ga0207676_10130545 | |||
| 1192 | Ga0207674_10001817 | |||
| 1193 | Ga0207674_10117654 | |||
| 1194 | Ga0207674_10142304 | |||
| 1195 | Ga0207674_10171149 | |||
| 1196 | Ga0207674_10196845 | |||
| 1197 | Ga0207675_100422631 | |||
| 1198 | Ga0207683_10007145 | |||
| 1199 | Ga0207683_10015716 | |||
| 1200 | Ga0207698_10004956 | |||
| 1201 | Ga0207698_10049030 | |||
| 1202 | Ga0207698_10067689 | |||
| 1203 | Ga0207698_10213245 | |||
| 1204 | Ga0207698_10653977 | |||
| 1205 | Ga0268266_10000111 | |||
| 1206 | Ga0268266_10308683 | |||
| 1207 | Ga0268266_10358231 | |||
| 1208 | Ga0268265_10381218 | |||
| 1209 | Ga0268264_10423639 | |||
| 1210 | Ga0307517_10006725 | |||
| 1211 | Ga0307517_10025589 | |||
| 1212 | Ga0307515_10000226 | |||
| 1213 | Ga0307515_10000507 | |||
| 1214 | Ga0307515_10235051 | |||
| 1215 | Ga0265338_10038979 | |||
| 1216 | Ga0265338_10296447 | |||
| 1217 | Ga0265327_10067090 | |||
| 1218 | Ga0316576_10131317 | |||
| 1219 | Ga0307516_10000527 | |||
| 1220 | Ga0307516_10032323 | |||
| 1221 | Ga0307412_10539170 | |||
| 1222 | Ga0307507_10000152 | |||
| 1223 | Ga0307510_10000825 | |||
| 1224 | Ga0307510_10004624 | |||
| 1225 | Ga0373941_0030475 | |||
| 1226 | Ga0373953_0246192 | |||
| 1227 | Ga0316574_0201273 | |||
| 1228 | Ga0373935_0116735 | |||
| 1229 | Ga0373947_0216852 | |||
| 1230 | Ga0373947_0409901 | |||
| 1231 | Ga0395899_0000087 | |||
| 1232 | Ga0395899_0001566 | |||
| 1233 | Ga0395899_0006248 | |||
| 1234 | Ga0395899_0025319 | |||
| 1235 | Ga0395899_0045691 | |||
| 1236 | Ga0395899_0061798 | |||
| 1237 | Ga0395899_0187538 | |||
| 1238 | Ga0395899_0217670 | |||
| 1239 | Ga0395900_0000095 | |||
| 1240 | Ga0395900_0003233 | |||
| 1241 | Ga0395900_0004567 | |||
| 1242 | Ga0395900_0014891 | |||
| 1243 | Ga0395900_0042519 | |||
| 1244 | Ga0395900_0060061 | |||
| 1245 | Ga0395900_0154767 | |||
| 1246 | Ga0395900_0157819 | |||
| 1247 | Ga0395898_0000595 | |||
| 1248 | Ga0395898_0029694 | |||
| 1249 | Ga0395898_0037849 | |||
| 1250 | Ga0395898_0098498 | |||
| 1251 | Ga0395898_0138049 | |||
| 1252 | Ga0395898_0314002 | |||
| 1253 | Ga0395905_0000124 | |||
| 1254 | Ga0395905_0000266 | |||
| 1255 | Ga0395905_0007445 | |||
| 1256 | Ga0395905_0143950 | |||
| 1257 | Ga0395905_0201326 | |||
| 1258 | Ga0395901_0001672 | |||
| 1259 | Ga0395901_0003424 | |||
| 1260 | Ga0395901_0011539 | |||
| 1261 | Ga0395901_0064301 | |||
| 1262 | Ga0395901_0095290 | |||
| 1263 | Ga0395901_0210464 | |||
| 1264 | Ga0436361_0568589 | |||
| 1265 | Ga0451841_1127396 | |||
| 1266 | Ga0439431_0081370 | |||
| 1267 | Ga0451577_0000123 | |||
| 1268 | Ga0451577_0000389 | |||
| 1269 | Ga0451577_0030330 | |||
| 1270 | Ga0451577_0113229 | |||
| 1271 | Ga0451577_0130918 | |||
| 1272 | Ga0451577_1030595 | |||
| 1273 | Ga0466969_0050319 | |||
| 1274 | Ga0466972_0004332 | |||
| 1275 | Ga0453683_0000366 | |||
| 1276 | Ga0466965_0043327 | |||
| 1277 | Ga0466965_0142938 | |||
| 1278 | Ga0453684_0000127 | |||
| 1279 | Ga0453684_0000225 | |||
| 1280 | Ga0453684_0001168 | |||
| 1281 | Ga0453684_0003570 | |||
| 1282 | Ga0453684_0006876 | |||
| 1283 | Ga0453684_0097084 | |||
| 1284 | Ga0453684_0184261 | |||
| 1285 | Ga0453684_0361372 | |||
| 1286 | Ga0466968_0116688 | |||
| 1287 | Ga0466959_0009399 | |||
| 1288 | Ga0466959_0019801 | |||
| 1289 | Ga0466959_0062474 | |||
| 1290 | Ga0466959_0616482 | |||
| 1291 | Ga0451576_0000178 | |||
| 1292 | Ga0451576_0000540 | |||
| 1293 | Ga0451576_0003178 | |||
| 1294 | Ga0451576_0008699 | |||
| 1295 | Ga0451576_0016809 | |||
| 1296 | Ga0451576_0206128 | |||
| 1297 | Ga0451576_0489647 | |||
| 1298 | Ga0466958_0109139 | |||
| 1299 | Ga0466958_0155933 | |||
| 1300 | Ga0495627_001600 | |||
| 1301 | Ga0495592_0312479 | |||
| 1302 | Ga0495629_0089358 | |||
| 1303 | Ga0495638_0137602 | |||
| 1304 | Ga0495651_0299791 | |||
| 1305 | Ga0495653_0214252 | |||
| 1306 | Ga0495650_0000127 | |||
| 1307 | Ga0495650_0015286 | |||
| 1308 | Ga0495605_0128197 | |||
| 1309 | Ga0495585_0000062 | |||
| 1310 | Ga0495585_0004635 | |||
| 1311 | Ga0495606_0000035 | |||
| 1312 | Ga0495606_0004847 | |||
| 1313 | Ga0495606_0007119 | |||
| 1314 | Ga0495606_0018609 | |||
| 1315 | Ga0495606_0034730 | |||
| 1316 | Ga0495606_0167172 | |||
| 1317 | Ga0495610_0001444 | |||
| 1318 | Ga0495610_0089599 | |||
| 1319 | Ga0495616_0006772 | |||
| 1320 | Ga0495616_0007163 | |||
| 1321 | Ga0495628_0042041 | |||
| 1322 | Ga0495630_0039748 | |||
| 1323 | Ga0495631_0008936 | |||
| 1324 | Ga0495631_0070079 | |||
| 1325 | Ga0495632_0098420 | |||
| 1326 | Ga0495637_0121974 | |||
| 1327 | Ga0495644_0004047 | |||
| 1328 | Ga0495648_0004897 | |||
| 1329 | Ga0495648_0031388 | |||
| 1330 | Ga0495648_0073111 | |||
| 1331 | Ga0495654_0035481 | |||
| 1332 | Ga0495609_0015047 | |||
| 1333 | Ga0495622_0043577 | |||
| 1334 | Ga0495633_0000267 | |||
| 1335 | Ga0495633_0004596 | |||
| 1336 | Ga0495668_0000010 | |||
| 1337 | Ga0495625_0000048 | |||
| 1338 | Ga0495625_0000456 | |||
| 1339 | Ga0495625_0002379 | |||
| 1340 | Ga0495625_0211987 | |||
| 1341 | Ga0495661_0000636 | |||
| 1342 | Ga0495661_0000714 | |||
| 1343 | Ga0495658_0006168 | |||
| 1344 | Ga0495649_0000377 | |||
| 1345 | Ga0495649_0138263 | |||
| 1346 | Ga0495683_0127984 | |||
| 1347 | Ga0495687_000079 | |||
| 1348 | Ga0495687_004133 | |||
| 1349 | Ga0495686_0001369 | |||
| 1350 | Ga0495686_0010878 | |||
| 1351 | Ga0495686_0051371 | |||
| 1352 | Ga0495614_0025556 | |||
| 1353 | Ga0496108_0130120 | |||
| 1354 | Ga0496110_0031861 | |||
| 1355 | Ga0496110_0909814 | |||
| 1356 | Ga0496113_0273172 | |||
| 1357 | Ga0495678_014528 | |||
| 1358 | Ga0501298_001197 | |||
| 1359 | Ga0501034_0000002 | |||
| 1360 | Ga0501034_0044695 | |||
| 1361 | Ga0501201_002647 | |||
| 1362 | Ga0501202_000215 | |||
| 1363 | Ga0501206_013958 | |||
| 1364 | Ga0501207_003742 | |||
| 1365 | Ga0501222_007902 | |||
| 1366 | Ga0501223_003499 | |||
| 1367 | Ga0501224_006555 | |||
| 1368 | Ga0501235_022257 | |||
| 1369 | Ga0501251_020426 | |||
| 1370 | Ga0501252_000654 | |||
| 1371 | Ga0501259_004248 | |||
| 1372 | Ga0501221_002269 | |||
| 1373 | Ga0501225_0006325 | |||
| 1374 | Ga0501234_010091 | |||
| 1375 | Ga0501245_000686 | |||
| 1376 | nmdc:mga0k408_2667_c1 | |||
| 1377 | nmdc:mga08y16_248152_c1 | |||
| 1378 | nmdc:mga0n895_26850_c1 | |||
| 1379 | Ga0500635_0010385 | |||
| 1380 | Ga0500583_0014877 | |||
| 1381 | Ga0500562_000004 | |||
| 1382 | Ga0500608_018636 | |||
| 1383 | Ga0500608_049934 | |||
| 1384 | Ga0500618_000038 | |||
| 1385 | Ga0500642_0080095 | |||
| 1386 | Ga0500652_117235 | |||
| 1387 | Ga0500568_0004727 | |||
| 1388 | Ga0500622_0001671 | |||
| 1389 | Ga0500624_000274 | |||
| 1390 | Ga0466962_0039766 | |||
| 1391 | 2599480173 | |||
| 1392 | 2819676561 | |||
| 1393 | 2840678457 | |||
| 1394 | 2852624661 | |||
| 1395 | 2884796422 | |||
| 1396 | 2884936453 | |||
| 1397 | 2896086275 | |||
| 1398 | 2896113435 | |||
| 1399 | 2919438412 | |||
| 1400 | 2928083616 | |||
| 1401 | 2928151123 | |||
| 1402 | 2929178064 | |||
| 1403 | 2929922150 | |||
| 1404 | 2932084421 | |||
| 1405 | 2945980424 | |||
| 1406 | 2946013713 | |||
| 1407 | 2977233120 | |||
| 1408 | 8003155640 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i9x-assembly1.cif.gz_A-2 | crystal structure of a mutt/nudix family protein from listeria innocua | 0.8778 | 20 | 156 |
| 5deq-assembly1.cif.gz_A | crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose | 0.8668 | 18 | 224 |
| 5bs6-assembly2.cif.gz_D | apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi | 0.8558 | 2 | 226 |
| 5bs6-assembly1.cif.gz_B | apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi | 0.8353 | 13 | 226 |
| 3gz8-assembly2.cif.gz_D | cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose | 0.8335 | 4 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gz5B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9359 | 163 | 224 | 1.10.10.10 |
| 3gz5A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9347 | 156 | 224 | 1.10.10.10 |
| af_O06597_8_150_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8936 | 22 | 154 | 3.90.79.10 |
| af_O06597_151_228_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8836 | 156 | 219 | 1.10.10.10 |
| 3gz8B01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8782 | 22 | 149 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9XJN2-F1-model_v4 | NUDIX hydrolase | 0.9642 | 18 | 230 |
GO:0016787
|
| AF-A0A1M5H717-F1-model_v4 | 8-oxo-dGTP diphosphatase | 0.9541 | 3 | 219 |
GO:0005737
|
| AF-A0A2E2TDG6-F1-model_v4 | NUDIX hydrolase | 0.953 | 13 | 231 |
GO:0005737
GO:0016787 |
| AF-A0A0R2VHM5-F1-model_v4 | Uncharacterized protein | 0.9439 | 20 | 226 |
GO:0005737
|
| AF-A0A1F6PNK4-F1-model_v4 | Nudix hydrolase domain-containing protein | 0.9413 | 20 | 227 |
|