F476239

General Info

Members Datasets Scaffolds Average Seq Length
702 403 679 330

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0120961|Ga0501033_0120961_14_1147
Length 377
Sequence VSVLVLDWTTIGCSDPIGTPPTRTVTVERRMVGDMGGNITSCMPETSPDHPRRAAITGVATYVPERVVTNADLARTLDTSDDWIVTRTGIRERRIGAPGETTSTMGAEAVRRLLAAKGLAPGDVDALIVATVTPDMLFPATACLIQDRLGMQNVWGFDLSAACSGFLYALTTGAQFVASGVHRRVIVVGADLKSSIIDPTDRTTAVLFGDGAGAVVLEPAEPGFGILDFFHRVDGSGRGELLMPAGGSLKPPSAETVAARQHFLKQNGRTVFKFAVSQMAESVQRLVERNGLKPADIAVVIPHQANQRILDATAEHLGLPHDRMASVIARYGNTTAATLPLALDDVLCTGRLKRGDLVVFVAVGAGFTMGATLVRWS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2808606448 Streptomyces sp. 193411 Isolate Unclassified
8 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
9 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
12 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
13 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
14 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
15 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
16 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
17 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
18 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
19 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
20 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
21 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
22 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
23 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
208 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
375 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
385 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
386 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
387 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
390 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
391 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
397 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
398 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
399 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
403 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0.43
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0
Rhizoplane 3.7
Rhizosphere 86.32
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1653087 2162886007 Bacteria 2458
2 JGI24736J21556_1007625 3300001904 Bacteria 1816
3 JGI25154J39366_1000587 3300002738 Bacteria 17590
4 JGI25158J39367_1006219 3300002739 Bacteria 1723
5 JGI25406J46586_10013591 3300003203 Bacteria 3489
6 JGI25153J46596_10000224 3300003215 Bacteria 48671
7 rootH2_10004419 3300003320 Bacteria 46013
8 rootH2_10241813 3300003320 Bacteria 3600
9 rootL2_10160258 3300003322 Bacteria 6104
10 rootL2_10281962 3300003322 Bacteria 1774
11 rootL2_10289050 3300003322 Bacteria 3472
12 rootH1_10024117 3300003323 Bacteria 11592
13 rootH1_10040132 3300003323 Bacteria 9743
14 Ga0055542_1002717 3300003762 Bacteria 5413
15 Ga0055531_10000132 3300003794 Bacteria 85251
16 Ga0058859_11782272 3300004798 Bacteria 2819
17 Ga0065165_1028129 3300005262 Bacteria 1820
18 Ga0065714_10003722 3300005288 Bacteria 22816
19 Ga0065714_10006151 3300005288 Bacteria 6883
20 Ga0065714_10069901 3300005288 Bacteria 4043
21 Ga0065714_10107029 3300005288 Bacteria 1539
22 Ga0065704_10000425 3300005289 Bacteria 76756
23 Ga0065704_10074258 3300005289 Bacteria 6413
24 Ga0065704_10096285 3300005289 Bacteria 2449
25 Ga0070658_10020104 3300005327 Bacteria 5348
26 Ga0070658_10076261 3300005327 Bacteria 2750
27 Ga0070676_10002188 3300005328 Bacteria 9965
28 Ga0070683_100039163 3300005329 Bacteria 4350
29 Ga0070683_100354695 3300005329 Unclassified 1397
30 Ga0070683_100449933 3300005329 Bacteria 1229
31 Ga0070670_100000292 3300005331 Bacteria 43960
32 Ga0070670_100197294 3300005331 Bacteria 1749
33 Ga0068869_100340433 3300005334 Bacteria 1220
34 Ga0070680_100020355 3300005336 Bacteria 5267
35 Ga0070680_100221815 3300005336 Bacteria 1596
36 Ga0070680_100371885 3300005336 Bacteria 1216
37 Ga0070689_100096183 3300005340 Bacteria 2340
38 Ga0070687_100147145 3300005343 Bacteria 1378
39 Ga0070668_100095027 3300005347 Unclassified 2354
40 Ga0070673_100011603 3300005364 Bacteria 6019
41 Ga0070688_100175590 3300005365 Bacteria 1482
42 Ga0070659_100095172 3300005366 Bacteria 2392
43 Ga0070659_100111135 3300005366 Bacteria 2212
44 Ga0070659_100147183 3300005366 Bacteria 1919
45 Ga0070667_100000415 3300005367 Bacteria 45632
46 Ga0070703_10005421 3300005406 Bacteria 3565
47 Ga0070709_10005139 3300005434 Bacteria 7080
48 Ga0070709_10026716 3300005434 Bacteria 3424
49 Ga0070714_100046381 3300005435 Bacteria 3687
50 Ga0070713_100096679 3300005436 Bacteria 2550
51 Ga0070710_10000342 3300005437 Bacteria 22161
52 Ga0070701_10220886 3300005438 Bacteria 1130
53 Ga0070711_100005710 3300005439 Bacteria 7460
54 Ga0070711_100025090 3300005439 Bacteria 3896
55 Ga0070705_100013439 3300005440 Bacteria 4189
56 Ga0070705_100156190 3300005440 Bacteria 1519
57 Ga0070700_100084526 3300005441 Bacteria 2057
58 Ga0070694_100001094 3300005444 Bacteria 15532
59 Ga0070708_100004098 3300005445 Bacteria 11443
60 Ga0070708_100039982 3300005445 Bacteria 4106
61 Ga0070708_100127425 3300005445 Bacteria 2354
62 Ga0070708_100189257 3300005445 Bacteria 1925
63 Ga0070708_100263674 3300005445 Bacteria 1620
64 Ga0070678_100001564 3300005456 Bacteria 12252
65 Ga0070662_100000043 3300005457 Bacteria 70660
66 Ga0070662_100272345 3300005457 Bacteria 1367
67 Ga0070681_10004632 3300005458 Bacteria 13127
68 Ga0070681_10347638 3300005458 Bacteria 1393
69 Ga0068867_100000970 3300005459 Bacteria 19578
70 Ga0070706_100005569 3300005467 Bacteria 11989
71 Ga0070706_100068254 3300005467 Bacteria 3288
72 Ga0070707_100007438 3300005468 Bacteria 10170
73 Ga0070707_100010931 3300005468 Bacteria 8453
74 Ga0070707_100351689 3300005468 Bacteria 1431
75 Ga0070707_100452337 3300005468 Bacteria 1245
76 Ga0070698_100015876 3300005471 Bacteria 7951
77 Ga0070698_100056214 3300005471 Bacteria 3989
78 Ga0070698_100063498 3300005471 Bacteria 3724
79 Ga0070698_100172939 3300005471 Bacteria 2100
80 Ga0070698_100210880 3300005471 Bacteria 1877
81 Ga0070699_100009581 3300005518 Bacteria 8392
82 Ga0070699_100051477 3300005518 Bacteria 3565
83 Ga0070699_100299399 3300005518 Bacteria 1443
84 Ga0070679_100000575 3300005530 Bacteria 31162
85 Ga0070679_100001256 3300005530 Bacteria 22367
86 Ga0070679_100120140 3300005530 Bacteria 2613
87 Ga0070684_100072257 3300005535 Bacteria 3037
88 Ga0070697_100001294 3300005536 Bacteria 18842
89 Ga0070697_100003459 3300005536 Bacteria 12139
90 Ga0070697_100004739 3300005536 Bacteria 10421
91 Ga0070697_100013284 3300005536 Bacteria 6460
92 Ga0070697_100236227 3300005536 Unclassified 1560
93 Ga0068853_100086942 3300005539 Bacteria 2742
94 Ga0070672_100233351 3300005543 Bacteria 1546
95 Ga0070686_100014764 3300005544 Bacteria 4507
96 Ga0070695_100006098 3300005545 Bacteria 7123
97 Ga0070695_100064043 3300005545 Bacteria 2391
98 Ga0070696_100000740 3300005546 Bacteria 20843
99 Ga0070696_100050526 3300005546 Bacteria 2890
100 Ga0070696_100098818 3300005546 Bacteria 2088
101 Ga0070693_100001006 3300005547 Bacteria 12576
102 Ga0070693_100018101 3300005547 Bacteria 3675
103 Ga0070665_100000017 3300005548 Bacteria 448013
104 Ga0070665_100043298 3300005548 Bacteria 4524
105 Ga0070704_100006564 3300005549 Bacteria 6861
106 Ga0070704_100178865 3300005549 Bacteria 1695
107 Ga0068855_100067792 3300005563 Bacteria 4155
108 Ga0068855_100092300 3300005563 Bacteria 3492
109 Ga0068855_100352685 3300005563 Bacteria 1620
110 Ga0070664_100173869 3300005564 Bacteria 1911
111 Ga0068857_100032705 3300005577 Bacteria 4598
112 Ga0068856_100093074 3300005614 Unclassified 3000
113 Ga0068852_100004240 3300005616 Bacteria 10126
114 Ga0068852_100121571 3300005616 Bacteria 2392
115 Ga0068859_100064410 3300005617 Bacteria 3698
116 Ga0068859_100101848 3300005617 Bacteria 2929
117 Ga0068859_100155823 3300005617 Bacteria 2361
118 Ga0068864_100000300 3300005618 Bacteria 43960
119 Ga0068864_100045885 3300005618 Bacteria 3749
120 Ga0068864_100166504 3300005618 Bacteria 2007
121 Ga0068861_100014168 3300005719 Bacteria 5592
122 Ga0068863_100000073 3300005841 Bacteria 110576
123 Ga0068863_100087106 3300005841 Bacteria 2959
124 Ga0068858_100354133 3300005842 Bacteria 1406
125 Ga0068858_100571358 3300005842 Bacteria 1095
126 Ga0068860_100002227 3300005843 Bacteria 20410
127 Ga0068860_100034591 3300005843 Bacteria 4848
128 Ga0068862_100000431 3300005844 Bacteria 45517
129 Ga0081455_10089200 3300005937 Bacteria 2503
130 Ga0081539_10000597 3300005985 Bacteria 73805
131 Ga0081539_10028543 3300005985 Unclassified 3506
132 Ga0070717_10143433 3300006028 Bacteria 2061
133 Ga0075363_100048553 3300006048 Bacteria 2257
134 Ga0070716_100001859 3300006173 Bacteria 9569
135 Ga0070716_100004211 3300006173 Bacteria 6846
136 Ga0070716_100040475 3300006173 Unclassified 2593
137 Ga0070716_100052372 3300006173 Bacteria 2323
138 Ga0070712_100029338 3300006175 Bacteria 3687
139 Ga0097621_100000099 3300006237 Bacteria 48404
140 Ga0068871_100000290 3300006358 Bacteria 35074
141 Ga0075428_100148069 3300006844 Bacteria 2551
142 Ga0075430_100198118 3300006846 Bacteria 1668
143 Ga0075431_100018982 3300006847 Bacteria 7005
144 Ga0075433_10127260 3300006852 Bacteria 2262
145 Ga0075433_10156906 3300006852 Bacteria 2025
146 Ga0075434_100113670 3300006871 Bacteria 2719
147 Ga0075434_100151391 3300006871 Bacteria 2340
148 Ga0075436_100095937 3300006914 Bacteria 2063
149 Ga0097620_100064412 3300006931 Bacteria 3698
150 Ga0097620_100101847 3300006931 Bacteria 2929
151 Ga0097620_100155833 3300006931 Bacteria 2361
152 Ga0099794_10001609 3300007265 Bacteria 7963
153 Ga0099794_10002978 3300007265 Bacteria 6388
154 Ga0099794_10016218 3300007265 Bacteria 3300
155 Ga0099794_10110523 3300007265 Bacteria 1377
156 Ga0105251_10000296 3300009011 Bacteria 49888
157 Ga0105240_10004537 3300009093 Bacteria 21094
158 Ga0105240_10083212 3300009093 Bacteria 3928
159 Ga0105240_10115941 3300009093 Bacteria 3233
160 Ga0105240_10143457 3300009093 Unclassified 2853
161 Ga0105240_10150951 3300009093 Bacteria 2767
162 Ga0105245_10002109 3300009098 Bacteria 17996
163 Ga0105247_10012063 3300009101 Bacteria 5191
164 Ga0114129_10515386 3300009147 Bacteria 1560
165 Ga0105241_10005263 3300009174 Bacteria 9556
166 Ga0105241_10015656 3300009174 Bacteria 5558
167 Ga0105241_10110294 3300009174 Bacteria 2201
168 Ga0105241_10125282 3300009174 Bacteria 2074
169 Ga0105241_10710227 3300009174 Bacteria 918
170 Ga0105242_10029962 3300009176 Bacteria 4343
171 Ga0105248_10000029 3300009177 Bacteria 223366
172 Ga0105248_10005459 3300009177 Bacteria 13973
173 Ga0105248_10028360 3300009177 Bacteria 6237
174 Ga0105248_10152135 3300009177 Bacteria 2611
175 Ga0105237_10000805 3300009545 Bacteria 42788
176 Ga0105237_10001937 3300009545 Bacteria 26385
177 Ga0105237_10065636 3300009545 Bacteria 3625
178 Ga0105238_10020964 3300009551 Bacteria 6658
179 Ga0105238_10047639 3300009551 Bacteria 4321
180 Ga0105249_10300880 3300009553 Unclassified 1609
181 Ga0099796_10014533 3300010159 Bacteria 2277
182 Ga0099796_10019493 3300010159 Bacteria 2057
183 Ga0105239_10000095 3300010375 Bacteria 124330
184 Ga0105239_10092634 3300010375 Bacteria 3336
185 Ga0105239_10240584 3300010375 Bacteria 2031
186 Ga0105239_10571685 3300010375 Bacteria 1288
187 Ga0105246_10083985 3300011119 Bacteria 2277
188 Ga0157373_10000034 3300013100 Bacteria 124053
189 Ga0157373_10002835 3300013100 Bacteria 13111
190 Ga0157373_10006316 3300013100 Bacteria 8850
191 Ga0157373_10028380 3300013100 Bacteria 4036
192 Ga0157373_10294336 3300013100 Bacteria 1151
193 Ga0157371_10001448 3300013102 Bacteria 24636
194 Ga0157371_10003042 3300013102 Bacteria 15561
195 Ga0157371_10003741 3300013102 Bacteria 13618
196 Ga0157371_10015852 3300013102 Bacteria 5638
197 Ga0157371_10050713 3300013102 Bacteria 2949
198 Ga0157371_10054552 3300013102 Bacteria 2838
199 Ga0157370_10000083 3300013104 Bacteria 104313
200 Ga0157370_10003843 3300013104 Bacteria 17514
201 Ga0157370_10025903 3300013104 Bacteria 5799
202 Ga0157370_10044375 3300013104 Bacteria 4273
203 Ga0157370_10128696 3300013104 Bacteria 2362
204 Ga0157369_10092689 3300013105 Unclassified 3225
205 Ga0157369_10093339 3300013105 Bacteria 3213
206 Ga0157369_10102491 3300013105 Bacteria 3050
207 Ga0157369_10142776 3300013105 Bacteria 2532
208 Ga0157369_10388570 3300013105 Unclassified 1448
209 Ga0157374_10001159 3300013296 Bacteria 22456
210 Ga0157374_10001894 3300013296 Bacteria 17545
211 Ga0157374_10009460 3300013296 Bacteria 8367
212 Ga0157378_10000560 3300013297 Bacteria 35416
213 Ga0157378_10001056 3300013297 Bacteria 25231
214 Ga0163162_10000051 3300013306 Bacteria 117695
215 Ga0163162_10017425 3300013306 Bacteria 7027
216 Ga0163162_10214228 3300013306 Bacteria 2056
217 Ga0157372_10002554 3300013307 Bacteria 19731
218 Ga0157372_10003988 3300013307 Bacteria 15845
219 Ga0157372_10004195 3300013307 Bacteria 15425
220 Ga0157372_10033289 3300013307 Bacteria 5659
221 Ga0157372_10210633 3300013307 Bacteria 2252
222 Ga0157375_10195387 3300013308 Bacteria 2178
223 Ga0157375_10297419 3300013308 Bacteria 1777
224 Ga0157380_10046279 3300014326 Bacteria 3416
225 Ga0182008_10000022 3300014497 Bacteria 207052
226 Ga0182008_10000104 3300014497 Bacteria 65446
227 Ga0157377_10101298 3300014745 Bacteria 1716
228 Ga0157379_10070427 3300014968 Bacteria 3129
229 Ga0157379_10082915 3300014968 Bacteria 2873
230 Ga0157379_10383703 3300014968 Bacteria 1289
231 Ga0157376_10016366 3300014969 Bacteria 5628
232 Ga0182006_1000279 3300015261 Bacteria 45379
233 Ga0182006_1010075 3300015261 Bacteria 4212
234 Ga0182007_10011886 3300015262 Bacteria 3369
235 Ga0182005_1000209 3300015265 Bacteria 38801
236 Ga0163161_10000828 3300017792 Bacteria 24173
237 Ga0213876_10000909 3300021384 Bacteria 19677
238 Ga0213875_10004925 3300021388 Bacteria 7251
239 Ga0209436_104141 3300025208 Bacteria 3645
240 Ga0209436_108603 3300025208 Bacteria 2017
241 Ga0209258_100075 3300025242 Bacteria 270751
242 Ga0209646_1000005 3300025246 Bacteria 717627
243 Ga0209026_1000198 3300025250 Bacteria 83656
244 Ga0209026_1000199 3300025250 Bacteria 83231
245 Ga0209148_1000085 3300025254 Bacteria 265193
246 Ga0209129_1007780 3300025258 Bacteria 3107
247 Ga0209758_1000742 3300025297 Bacteria 47450
248 Ga0207426_1000057 3300025302 Bacteria 369548
249 Ga0207426_1000888 3300025302 Bacteria 30602
250 Ga0209257_1000004 3300025304 Bacteria 1678347
251 Ga0207713_1002770 3300025735 Bacteria 12405
252 Ga0207653_10005977 3300025885 Bacteria 3797
253 Ga0207692_10000633 3300025898 Bacteria 12350
254 Ga0207710_10006368 3300025900 Bacteria 5044
255 Ga0207647_10000036 3300025904 Bacteria 98204
256 Ga0207647_10008554 3300025904 Bacteria 7328
257 Ga0207699_10006337 3300025906 Bacteria 5721
258 Ga0207699_10019145 3300025906 Bacteria 3643
259 Ga0207699_10020705 3300025906 Bacteria 3531
260 Ga0207699_10244510 3300025906 Bacteria 1234
261 Ga0207645_10000312 3300025907 Bacteria 40968
262 Ga0207705_10016332 3300025909 Bacteria 5323
263 Ga0207705_10044980 3300025909 Unclassified 3173
264 Ga0207684_10011618 3300025910 Bacteria 7693
265 Ga0207684_10031677 3300025910 Bacteria 4498
266 Ga0207684_10073185 3300025910 Bacteria 2910
267 Ga0207654_10009434 3300025911 Bacteria 4957
268 Ga0207654_10011141 3300025911 Bacteria 4577
269 Ga0207707_10176083 3300025912 Bacteria 1869
270 Ga0207695_10001548 3300025913 Bacteria 37825
271 Ga0207695_10013446 3300025913 Bacteria 9762
272 Ga0207695_10046307 3300025913 Bacteria 4611
273 Ga0207695_10098003 3300025913 Unclassified 2931
274 Ga0207671_10002974 3300025914 Bacteria 17406
275 Ga0207671_10005112 3300025914 Bacteria 12229
276 Ga0207671_10007229 3300025914 Bacteria 9667
277 Ga0207693_10137464 3300025915 Bacteria 1921
278 Ga0207693_10267033 3300025915 Bacteria 1341
279 Ga0207663_10012107 3300025916 Bacteria 4653
280 Ga0207663_10030522 3300025916 Bacteria 3180
281 Ga0207660_10051504 3300025917 Bacteria 2927
282 Ga0207660_10146516 3300025917 Bacteria 1810
283 Ga0207657_10092205 3300025919 Unclassified 2525
284 Ga0207657_10192169 3300025919 Bacteria 1646
285 Ga0207652_10000051 3300025921 Bacteria 120327
286 Ga0207652_10000791 3300025921 Bacteria 30182
287 Ga0207652_10011674 3300025921 Bacteria 7088
288 Ga0207646_10000481 3300025922 Bacteria 53432
289 Ga0207646_10000572 3300025922 Bacteria 48197
290 Ga0207646_10373084 3300025922 Bacteria 1289
291 Ga0207681_10424609 3300025923 Bacteria 1078
292 Ga0207694_10096180 3300025924 Bacteria 2342
293 Ga0207687_10349342 3300025927 Unclassified 1204
294 Ga0207700_10069255 3300025928 Bacteria 2707
295 Ga0207700_10099169 3300025928 Bacteria 2319
296 Ga0207664_10046416 3300025929 Bacteria 3409
297 Ga0207664_10380495 3300025929 Bacteria 1253
298 Ga0207690_10060358 3300025932 Bacteria 2573
299 Ga0207690_10113976 3300025932 Bacteria 1952
300 Ga0207706_10000125 3300025933 Bacteria 83075
301 Ga0207706_10236649 3300025933 Bacteria 1596
302 Ga0207686_10111386 3300025934 Bacteria 1847
303 Ga0207670_10072705 3300025936 Bacteria 2382
304 Ga0207704_10000335 3300025938 Bacteria 21770
305 Ga0207665_10000023 3300025939 Bacteria 104745
306 Ga0207665_10003362 3300025939 Bacteria 10709
307 Ga0207665_10032079 3300025939 Bacteria 3478
308 Ga0207665_10052077 3300025939 Bacteria 2757
309 Ga0207665_10062870 3300025939 Unclassified 2520
310 Ga0207665_10408651 3300025939 Bacteria 1035
311 Ga0207691_10151605 3300025940 Bacteria 2038
312 Ga0207711_10000004 3300025941 Bacteria 870636
313 Ga0207711_10048440 3300025941 Bacteria 3636
314 Ga0207689_10213628 3300025942 Bacteria 1594
315 Ga0207661_10027845 3300025944 Bacteria 4322
316 Ga0207667_10002789 3300025949 Bacteria 21642
317 Ga0207667_10021474 3300025949 Bacteria 7153
318 Ga0207667_10070847 3300025949 Bacteria 3628
319 Ga0207651_10002492 3300025960 Bacteria 8783
320 Ga0207712_10187994 3300025961 Bacteria 1628
321 Ga0207658_10001129 3300025986 Bacteria 21497
322 Ga0207703_10387617 3300026035 Bacteria 1294
323 Ga0207639_10067588 3300026041 Bacteria 2781
324 Ga0207678_10156920 3300026067 Bacteria 1943
325 Ga0207708_10032968 3300026075 Bacteria 3933
326 Ga0207702_10005819 3300026078 Bacteria 10723
327 Ga0207702_10065757 3300026078 Unclassified 3106
328 Ga0207641_10000018 3300026088 Bacteria 298209
329 Ga0207641_10500897 3300026088 Bacteria 1179
330 Ga0207648_10000961 3300026089 Bacteria 32589
331 Ga0207648_10184925 3300026089 Bacteria 1845
332 Ga0207648_10258703 3300026089 Bacteria 1553
333 Ga0207676_10000276 3300026095 Bacteria 44706
334 Ga0207676_10033700 3300026095 Bacteria 3872
335 Ga0207676_10562444 3300026095 Bacteria 1091
336 Ga0207674_10084633 3300026116 Bacteria 3169
337 Ga0207675_100011052 3300026118 Bacteria 8456
338 Ga0207683_10010707 3300026121 Bacteria 7818
339 Ga0207683_10239986 3300026121 Bacteria 1653
340 Ga0207698_10003948 3300026142 Bacteria 8985
341 Ga0209588_1002151 3300027671 Bacteria 5318
342 Ga0209588_1002685 3300027671 Bacteria 4854
343 Ga0209588_1003067 3300027671 Bacteria 4605
344 Ga0209588_1016128 3300027671 Bacteria 2303
345 Ga0265354_1000026 3300028016 Bacteria 23406
346 Ga0268266_10000037 3300028379 Bacteria 342368
347 Ga0268266_10012805 3300028379 Bacteria 7245
348 Ga0268266_10213270 3300028379 Bacteria 1771
349 Ga0268265_10000097 3300028380 Bacteria 110755
350 Ga0268264_10444098 3300028381 Bacteria 1255
351 Ga0265318_10004764 3300028577 Bacteria 6503
352 Ga0265770_1001077 3300030878 Bacteria 3774
353 Ga0265765_1000099 3300030879 Bacteria 4890
354 Ga0265332_10044009 3300031238 Bacteria 1926
355 Ga0265320_10049766 3300031240 Bacteria 2039
356 Ga0265325_10031694 3300031241 Bacteria 2826
357 Ga0265325_10050234 3300031241 Bacteria 2149
358 Ga0265329_10000084 3300031242 Bacteria 43535
359 Ga0265339_10044764 3300031249 Bacteria 2439
360 Ga0265331_10000047 3300031250 Bacteria 183230
361 Ga0265331_10061485 3300031250 Bacteria 1773
362 Ga0265327_10006221 3300031251 Bacteria 9623
363 Ga0265316_10215532 3300031344 Bacteria 1418
364 Ga0307408_100013148 3300031548 Bacteria 5493
365 Ga0307408_100045499 3300031548 Bacteria 3135
366 Ga0307408_100099563 3300031548 Bacteria 2212
367 Ga0307408_100329279 3300031548 Bacteria 1289
368 Ga0265313_10007149 3300031595 Bacteria 7688
369 Ga0265313_10012298 3300031595 Bacteria 5238
370 Ga0265313_10021254 3300031595 Bacteria 3554
371 Ga0316579_10002311 3300031691 Bacteria 7198
372 Ga0265314_10038296 3300031711 Bacteria 3466
373 Ga0265342_10000158 3300031712 Bacteria 76866
374 Ga0265342_10095010 3300031712 Bacteria 1705
375 Ga0316576_10040864 3300031727 Bacteria 3335
376 Ga0316576_10100099 3300031727 Bacteria 2166
377 Ga0316578_10000651 3300031728 Bacteria 12292
378 Ga0307405_10012885 3300031731 Bacteria 4444
379 Ga0316577_10002446 3300031733 Bacteria 9198
380 Ga0316577_10010268 3300031733 Bacteria 5050
381 Ga0307413_10018598 3300031824 Bacteria 3651
382 Ga0307413_10108715 3300031824 Bacteria 1851
383 Ga0307410_10006614 3300031852 Bacteria 6269
384 Ga0307410_10018286 3300031852 Bacteria 4232
385 Ga0307410_10041176 3300031852 Bacteria 3045
386 Ga0307410_10107511 3300031852 Bacteria 2012
387 Ga0307406_10011431 3300031901 Bacteria 5039
388 Ga0307406_10030864 3300031901 Bacteria 3258
389 Ga0307407_10009430 3300031903 Bacteria 4548
390 Ga0307407_10018970 3300031903 Bacteria 3492
391 Ga0307412_10000001 3300031911 Bacteria 822691
392 Ga0307412_10026545 3300031911 Bacteria 3601
393 Ga0307412_10249432 3300031911 Bacteria 1378
394 Ga0307409_100003739 3300031995 Bacteria 8359
395 Ga0307409_100008700 3300031995 Bacteria 6182
396 Ga0307409_100015405 3300031995 Bacteria 5018
397 Ga0307409_100102773 3300031995 Bacteria 2375
398 Ga0307409_100533225 3300031995 Bacteria 1149
399 Ga0307416_100001429 3300032002 Bacteria 12970
400 Ga0307416_100004343 3300032002 Bacteria 8526
401 Ga0307416_100038689 3300032002 Bacteria 3682
402 Ga0307416_100170194 3300032002 Bacteria 2026
403 Ga0307416_100376135 3300032002 Bacteria 1448
404 Ga0307414_10000268 3300032004 Bacteria 32688
405 Ga0307414_10000987 3300032004 Bacteria 14520
406 Ga0307414_10017542 3300032004 Bacteria 4382
407 Ga0307414_10043983 3300032004 Bacteria 3046
408 Ga0307414_10051328 3300032004 Bacteria 2863
409 Ga0307414_10067852 3300032004 Bacteria 2557
410 Ga0307414_10071082 3300032004 Bacteria 2509
411 Ga0307414_10096749 3300032004 Bacteria 2210
412 Ga0307414_10127997 3300032004 Bacteria 1966
413 Ga0307414_10222659 3300032004 Bacteria 1550
414 Ga0307414_10297239 3300032004 Bacteria 1364
415 Ga0307414_10312218 3300032004 Bacteria 1335
416 Ga0307411_10009234 3300032005 Bacteria 5170
417 Ga0307411_10013833 3300032005 Bacteria 4470
418 Ga0307411_10033958 3300032005 Bacteria 3169
419 Ga0307411_10037936 3300032005 Bacteria 3035
420 Ga0307411_10045018 3300032005 Bacteria 2836
421 Ga0307411_10161600 3300032005 Bacteria 1678
422 Ga0307415_100001701 3300032126 Bacteria 10692
423 Ga0307415_100006638 3300032126 Bacteria 6260
424 Ga0307415_100026115 3300032126 Bacteria 3678
425 Ga0307415_100161571 3300032126 Bacteria 1737
426 Ga0316580_10013952 3300032139 Bacteria 2450
427 Ga0307510_10001091 3300033180 Bacteria 28923
428 Ga0316212_1001669 3300033547 Unclassified 3061
429 Ga0316212_1002260 3300033547 Bacteria 2736
430 Ga0373930_0021121 3300034816 Bacteria 1275
431 Ga0373926_0071783 3300035083 Bacteria 1273
432 Ga0373940_0004493 3300035088 Bacteria 2950
433 Ga0373932_0025561 3300035112 Bacteria 1600
434 Ga0373955_0091868 3300035172 Unclassified 1731
435 Ga0373931_0023779 3300035691 Bacteria 3096
436 Ga0373931_0024584 3300035691 Bacteria 3053
437 Ga0373933_0041714 3300035724 Bacteria 2710
438 Ga0373937_0355910 3300036401 Bacteria 1387
439 Ga0316582_0009201 3300036647 Bacteria 5349
440 Ga0316582_0024164 3300036647 Bacteria 3634
441 Ga0316584_0002980 3300036712 Bacteria 10891
442 Ga0373925_0224152 3300037068 Bacteria 1501
443 Ga0373925_0268855 3300037068 Bacteria 1371
444 Ga0395899_0006954 3300037312 Bacteria 8764
445 Ga0395899_0007594 3300037312 Bacteria 8364
446 Ga0395899_0012626 3300037312 Bacteria 6474
447 Ga0395899_0062700 3300037312 Unclassified 2737
448 Ga0395900_0016874 3300037418 Bacteria 7452
449 Ga0395900_0047098 3300037418 Bacteria 4439
450 Ga0395900_0091042 3300037418 Unclassified 3134
451 Ga0395900_0442233 3300037418 Bacteria 1257
452 Ga0395898_0003612 3300037466 Bacteria 17220
453 Ga0395898_0053989 3300037466 Bacteria 3922
454 Ga0395898_0101731 3300037466 Bacteria 2759
455 Ga0395898_0153441 3300037466 Unclassified 2203
456 Ga0395905_0000001 3300037471 Bacteria 2037079
457 Ga0395905_0057101 3300037471 Unclassified 3651
458 Ga0395905_0301602 3300037471 Bacteria 1490
459 Ga0316581_0001034 3300037588 Bacteria 5971
460 Ga0436364_0297591 3300037853 Bacteria 3028
461 Ga0436364_1307424 3300037853 Bacteria 22417
462 Ga0395901_0000279 3300038443 Bacteria 63353
463 Ga0395901_0001337 3300038443 Bacteria 25839
464 Ga0395901_0001993 3300038443 Bacteria 21012
465 Ga0395901_0004556 3300038443 Bacteria 13986
466 Ga0395901_0039033 3300038443 Bacteria 4912
467 Ga0395901_0371422 3300038443 Bacteria 1473
468 Ga0436365_0070120 3300039437 Bacteria 4026
469 Ga0436365_0643609 3300039437 Bacteria 115180
470 Ga0436362_0603024 3300039453 Bacteria 1685
471 Ga0439431_0000125 3300041997 Bacteria 13494
472 Ga0439449_0051961 3300042007 Bacteria 1516
473 Ga0466972_0001361 3300044658 Bacteria 11856
474 Ga0466972_0227300 3300044658 Bacteria 873
475 Ga0453683_0000036 3300044673 Bacteria 232009
476 Ga0466965_0002217 3300044683 Bacteria 8185
477 Ga0466965_0005733 3300044683 Bacteria 5604
478 Ga0466966_0097862 3300044684 Bacteria 1817
479 Ga0466963_0101285 3300044694 Bacteria 1972
480 Ga0453684_0002808 3300044712 Bacteria 41155
481 Ga0453684_0058811 3300044712 Bacteria 4962
482 Ga0453684_0069727 3300044712 Bacteria 4457
483 Ga0466968_0002707 3300044735 Bacteria 6539
484 Ga0466957_0043195 3300044842 Bacteria 2729
485 Ga0466957_0195151 3300044842 Bacteria 1328
486 Ga0466959_0019904 3300045049 Bacteria 4940
487 Ga0451576_0000069 3300045051 Bacteria 259862
488 Ga0451576_0531037 3300045051 Bacteria 1236
489 Ga0466967_0013966 3300045976 Bacteria 6233
490 Ga0495627_006558 3300046453 Bacteria 4551
491 Ga0495592_0006086 3300046454 Bacteria 8967
492 Ga0495592_0159593 3300046454 Bacteria 1553
493 Ga0495603_0006449 3300046455 Bacteria 7025
494 Ga0495629_0034883 3300046459 Bacteria 3556
495 Ga0495651_0000075 3300046462 Bacteria 73020
496 Ga0495651_0012963 3300046462 Bacteria 6443
497 Ga0495653_0005508 3300046463 Bacteria 10313
498 Ga0495650_0000038 3300046471 Bacteria 377530
499 Ga0495650_0002096 3300046471 Bacteria 17160
500 Ga0495580_0038724 3300046472 Bacteria 3413
501 Ga0495580_0100457 3300046472 Unclassified 2012
502 Ga0495580_0113002 3300046472 Bacteria 1886
503 Ga0495639_0011600 3300046475 Bacteria 3802
504 Ga0495594_0000609 3300046499 Bacteria 18428
505 Ga0495594_0080085 3300046499 Bacteria 1823
506 Ga0495596_0011908 3300046500 Bacteria 3734
507 Ga0495583_0003402 3300046506 Bacteria 12167
508 Ga0495606_0003562 3300046507 Bacteria 16425
509 Ga0495606_0090662 3300046507 Bacteria 1881
510 Ga0495618_0183576 3300046514 Bacteria 1329
511 Ga0495618_0254772 3300046514 Bacteria 1100
512 Ga0495620_0001135 3300046515 Bacteria 16252
513 Ga0495628_0005563 3300046516 Bacteria 11033
514 Ga0495630_0061676 3300046517 Bacteria 2816
515 Ga0495630_0207019 3300046517 Bacteria 1497
516 Ga0495631_0006473 3300046518 Bacteria 6042
517 Ga0495631_0008024 3300046518 Bacteria 5335
518 Ga0495666_0038873 3300046526 Bacteria 2313
519 Ga0495666_0061257 3300046526 Bacteria 1798
520 Ga0495665_0078694 3300046531 Bacteria 1734
521 Ga0495640_0022054 3300046533 Bacteria 4663
522 Ga0495586_0005192 3300046535 Bacteria 6971
523 Ga0495587_0029043 3300046536 Bacteria 3359
524 Ga0495622_0001198 3300046557 Bacteria 13394
525 Ga0495633_0000022 3300046558 Bacteria 226582
526 Ga0495667_0000317 3300046559 Bacteria 30459
527 Ga0495667_0148198 3300046559 Bacteria 1511
528 Ga0495667_0269144 3300046559 Bacteria 1083
529 Ga0495656_0113829 3300046615 Bacteria 1269
530 Ga0495668_0003772 3300046616 Bacteria 11107
531 Ga0495634_0031899 3300046642 Bacteria 3627
532 Ga0495611_0003403 3300046648 Bacteria 7023
533 Ga0495625_0000814 3300046660 Bacteria 43131
534 Ga0495625_0002581 3300046660 Bacteria 19455
535 Ga0495635_0010647 3300046663 Bacteria 6439
536 Ga0495635_0099059 3300046663 Bacteria 1992
537 Ga0495661_0065068 3300046665 Bacteria 2149
538 Ga0495657_0002991 3300046675 Bacteria 13994
539 Ga0495657_0026450 3300046675 Bacteria 4108
540 Ga0495599_0011134 3300046678 Bacteria 5520
541 Ga0495647_0002103 3300046681 Bacteria 6224
542 Ga0495658_0007656 3300046683 Bacteria 5355
543 Ga0495613_0024783 3300046689 Bacteria 4470
544 Ga0495613_0058417 3300046689 Bacteria 2830
545 Ga0495624_0013917 3300046690 Bacteria 5476
546 Ga0495624_0018159 3300046690 Bacteria 4706
547 Ga0495649_0200506 3300046694 Bacteria 1036
548 Ga0495589_0002429 3300046794 Bacteria 10476
549 Ga0495581_0018224 3300047315 Bacteria 4078
550 Ga0495604_0008185 3300047317 Bacteria 8272
551 Ga0495674_0058998 3300047319 Bacteria 3353
552 Ga0495674_0060030 3300047319 Bacteria 3319
553 Ga0495674_0067190 3300047319 Unclassified 3107
554 Ga0495674_0195888 3300047319 Bacteria 1678
555 Ga0495674_0275831 3300047319 Bacteria 1379
556 Ga0495672_0000875 3300047320 Bacteria 31630
557 Ga0495676_0015768 3300047321 Bacteria 6716
558 Ga0495676_0051064 3300047321 Bacteria 3311
559 Ga0495680_0000274 3300047322 Bacteria 57527
560 Ga0495680_0016743 3300047322 Bacteria 6286
561 Ga0495680_0056700 3300047322 Unclassified 3032
562 Ga0495683_0002147 3300047323 Bacteria 12127
563 Ga0495675_0075432 3300047444 Unclassified 2125
564 Ga0495685_000407 3300047447 Bacteria 13643
565 Ga0495684_0012037 3300047471 Bacteria 6672
566 Ga0495686_0000737 3300047472 Bacteria 43637
567 Ga0495686_0009364 3300047472 Bacteria 7062
568 Ga0495686_0060005 3300047472 Bacteria 2365
569 Ga0495593_0041388 3300047673 Bacteria 2477
570 Ga0495602_0195313 3300048088 Unclassified 1548
571 Ga0495614_0012363 3300048089 Bacteria 3746
572 Ga0495614_0016960 3300048089 Bacteria 3166
573 Ga0495614_0038560 3300048089 Bacteria 2050
574 Ga0495626_0007110 3300048091 Bacteria 6269
575 Ga0496100_0128744 3300048903 Bacteria 1780
576 Ga0496102_0013502 3300048905 Bacteria 7075
577 Ga0496102_0181570 3300048905 Bacteria 1983
578 Ga0496103_0014765 3300048906 Bacteria 4642
579 Ga0496104_0008797 3300048907 Bacteria 8976
580 Ga0496104_0085328 3300048907 Bacteria 3014
581 Ga0496104_0433116 3300048907 Bacteria 1227
582 Ga0496105_0137184 3300048908 Bacteria 2015
583 Ga0496106_0063877 3300048909 Bacteria 2799
584 Ga0496107_0182530 3300048910 Bacteria 1558
585 Ga0496108_0004141 3300048911 Bacteria 11659
586 Ga0496108_0058414 3300048911 Bacteria 3242
587 Ga0496109_0003590 3300048912 Bacteria 12953
588 Ga0496109_0012623 3300048912 Bacteria 7296
589 Ga0496110_0065983 3300048913 Bacteria 3200
590 Ga0496110_0186228 3300048913 Bacteria 1885
591 Ga0496111_0013416 3300048914 Bacteria 5576
592 Ga0496111_0058754 3300048914 Bacteria 2785
593 Ga0496112_0002880 3300048915 Bacteria 13997
594 Ga0496112_0319835 3300048915 Bacteria 1496
595 Ga0496113_0000741 3300048916 Bacteria 16766
596 Ga0496113_0132429 3300048916 Bacteria 1957
597 Ga0496114_0052108 3300048917 Bacteria 3409
598 Ga0496114_0162071 3300048917 Bacteria 1945
599 Ga0496115_0005244 3300048918 Bacteria 9417
600 Ga0496115_0155922 3300048918 Bacteria 1887
601 Ga0496117_0004000 3300048920 Bacteria 16644
602 Ga0496118_0002784 3300048921 Bacteria 22888
603 Ga0496121_0000010 3300048924 Bacteria 793488
604 Ga0496122_0002421 3300048925 Bacteria 26557
605 Ga0496123_0008155 3300048926 Bacteria 9665
606 Ga0496126_0000020 3300048929 Bacteria 490805
607 Ga0501031_0133037 3300049568 Bacteria 1625
608 Ga0501032_0138448 3300049569 Bacteria 1604
609 Ga0501033_0039590 3300049570 Bacteria 3521
610 Ga0501033_0120961 3300049570 Bacteria 1900
611 Ga0501033_0292938 3300049570 Bacteria 1147
612 Ga0501034_0003719 3300049571 Bacteria 17227
613 Ga0501034_0052256 3300049571 Bacteria 4117
614 Ga0501034_0227502 3300049571 Bacteria 1815
615 Ga0501036_0070283 3300049572 Bacteria 2960
616 Ga0501036_0115103 3300049572 Bacteria 2272
617 Ga0501037_0192482 3300049573 Bacteria 1444
618 Ga0501038_0372256 3300049574 Bacteria 1109
619 Ga0501040_0019566 3300049576 Bacteria 4505
620 Ga0501040_0026269 3300049576 Bacteria 3916
621 Ga0501040_0106504 3300049576 Bacteria 1959
622 Ga0501041_0016606 3300049577 Bacteria 4379
623 Ga0501042_0073414 3300049578 Bacteria 2447
624 Ga0501046_0176883 3300049580 Bacteria 1598
625 Ga0501047_0174021 3300049581 Bacteria 2021
626 Ga0501048_0020442 3300049582 Bacteria 4852
627 Ga0501067_0011567 3300049583 Bacteria 4889
628 Ga0501067_0041825 3300049583 Bacteria 2545
629 Ga0501068_0009496 3300049584 Bacteria 5447
630 Ga0501070_0053878 3300049586 Bacteria 3336
631 Ga0501072_0191820 3300049588 Bacteria 1629
632 Ga0501076_0003750 3300049592 Bacteria 10685
633 Ga0501076_0058581 3300049592 Bacteria 3062
634 Ga0501076_0139491 3300049592 Bacteria 1969
635 Ga0501077_0014567 3300049593 Bacteria 4943
636 Ga0501209_013208 3300049656 Bacteria 1781
637 Ga0501079_0016325 3300049741 Bacteria 5674
638 Ga0501079_0053803 3300049741 Bacteria 3105
639 Ga0501080_0038029 3300049742 Bacteria 4495
640 Ga0501080_0110650 3300049742 Bacteria 2546
641 Ga0501081_0011673 3300049743 Bacteria 5752
642 Ga0501083_0044704 3300049744 Bacteria 2998
643 Ga0501241_000418 3300049758 Bacteria 9344
644 Ga0501241_002808 3300049758 Bacteria 3347
645 Ga0501273_000510 3300049770 Bacteria 3149
646 Ga0501035_0170050 3300049822 Bacteria 1883
647 Ga0501044_0113523 3300049823 Bacteria 2716
648 Ga0501044_0223098 3300049823 Bacteria 1835
649 nmdc:mga05p37_391440_c1 3300050507 Bacteria 1625
650 nmdc:mga0qj67_16368_c1 3300050509 Bacteria 5622
651 nmdc:mga0qj67_323984_c1 3300050509 Bacteria 1247
652 nmdc:mga06r32_15049_c1 3300050510 Bacteria 7024
653 nmdc:mga0n895_82764_c1 3300050512 Bacteria 3199
654 nmdc:mga0a205_143549_c1 3300050515 Bacteria 2287
655 Ga0495601_0057087 3300053077 Bacteria 2473
656 Ga0500635_0002802 3300053080 Bacteria 4326
657 Ga0500643_037877 3300053087 Bacteria 1433
658 Ga0500644_0000240 3300053088 Bacteria 31306
659 Ga0500646_0005886 3300053090 Bacteria 3112
660 Ga0500651_0000108 3300053093 Bacteria 50821
661 Ga0500651_0001193 3300053093 Bacteria 12892
662 Ga0500569_000902 3300053109 Bacteria 5316
663 Ga0500642_0034757 3300053130 Bacteria 2136
664 Ga0500652_015058 3300053131 Bacteria 2781
665 Ga0500568_0038280 3300053139 Bacteria 1941
666 Ga0500616_0004435 3300053153 Bacteria 10007
667 Ga0500622_0000616 3300053156 Bacteria 32195
668 Ga0500636_0123366 3300053177 Bacteria 1451
669 Ga0501084_0023329 3300054114 Bacteria 5164
670 Ga0501084_0041515 3300054114 Bacteria 3849
671 Ga0500661_005595 3300055283 Bacteria 2343
672 Ga0590071_005972 3300059421 Bacteria 2914
673 Ga0590071_009001 3300059421 Bacteria 2348
674 Ga0590074_006296 3300059423 Bacteria 1970
675 Ga0590074_012025 3300059423 Bacteria 1454
676 Ga0590077_007285 3300059426 Bacteria 2264
677 Ga0501082_0050125 3300060353 Bacteria 3601
678 Ga0501082_0343186 3300060353 Bacteria 1301
679 Ga0530510_0040539 3300061734 Bacteria 3361

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10408651 Ga0207665_104086511 256
2 3300044658 Ga0466972_0227300 Ga0466972_0227300_27_854 268
3 3300046514 Ga0495618_0183576 Ga0495618_0183576_379_1218 269
4 3300046690 Ga0495624_0018159 Ga0495624_0018159_433_1272 269
5 3300047321 Ga0495676_0015768 Ga0495676_0015768_2418_3257 269
6 3300048089 Ga0495614_0038560 Ga0495614_0038560_667_1506 269
7 3300003323 rootH1_10024117 rootH1_100241174 270
8 3300009174 Ga0105241_10710227 Ga0105241_107102271 272
9 3300047315 Ga0495581_0018224 Ga0495581_0018224_2131_3066 272
10 3300044842 Ga0466957_0043195 Ga0466957_0043195_1871_2713 277
11 3300050509 nmdc:mga0qj67_323984_c1 nmdc:mga0qj67_323984_c1_382_1224 277
12 3300049584 Ga0501068_0009496 Ga0501068_0009496_3378_4292 292
13 3300049742 Ga0501080_0110650 Ga0501080_0110650_342_1256 292
14 3300044694 Ga0466963_0101285 Ga0466963_0101285_242_1234 293
15 3300045976 Ga0466967_0013966 Ga0466967_0013966_4210_5202 293
16 3300044683 Ga0466965_0005733 Ga0466965_0005733_1570_2568 294
17 3300046689 Ga0495613_0058417 Ga0495613_0058417_357_1364 296
18 3300025923 Ga0207681_10424609 Ga0207681_104246091 299
19 3300050507 nmdc:mga05p37_391440_c1 nmdc:mga05p37_391440_c1_293_1204 300
20 3300050512 nmdc:mga0n895_82764_c1 nmdc:mga0n895_82764_c1_2134_3045 300
21 3300050515 nmdc:mga0a205_143549_c1 nmdc:mga0a205_143549_c1_694_1605 300
22 3300025916 Ga0207663_10030522 Ga0207663_100305224 301
23 3300046472 Ga0495580_0100457 Ga0495580_0100457_41_952 301
24 3300046665 Ga0495661_0065068 Ga0495661_0065068_853_1767 301
25 3300049578 Ga0501042_0073414 Ga0501042_0073414_1354_2397 301
26 3300053093 Ga0500651_0000108 Ga0500651_0000108_33071_33985 301
27 3300044712 Ga0453684_0069727 Ga0453684_0069727_3488_4402 302
28 3300053130 Ga0500642_0034757 Ga0500642_0034757_23_931 302
29 3300005437 Ga0070710_10000342 Ga0070710_1000034210 303
30 3300006048 Ga0075363_100048553 Ga0075363_1000485533 303
31 3300025898 Ga0207692_10000633 Ga0207692_1000063310 303
32 3300046690 Ga0495624_0013917 Ga0495624_0013917_3451_4443 303
33 3300060353 Ga0501082_0343186 Ga0501082_0343186_138_1067 303
34 3300036401 Ga0373937_0355910 Ga0373937_0355910_10_933 304
35 3300005434 Ga0070709_10026716 Ga0070709_100267162 309
36 3300009098 Ga0105245_10002109 Ga0105245_1000210910 309
37 3300009177 Ga0105248_10028360 Ga0105248_100283604 309
38 3300013296 Ga0157374_10001894 Ga0157374_100018943 309
39 3300013297 Ga0157378_10001056 Ga0157378_100010563 309
40 3300014968 Ga0157379_10383703 Ga0157379_103837031 309
41 3300035724 Ga0373933_0041714 Ga0373933_0041714_740_1678 309
42 3300039453 Ga0436362_0603024 Ga0436362_0603024_293_1231 309
43 3300044658 Ga0466972_0001361 Ga0466972_0001361_8998_9996 309
44 3300044683 Ga0466965_0002217 Ga0466965_0002217_6080_7078 309
45 3300044735 Ga0466968_0002707 Ga0466968_0002707_196_1194 309
46 3300046471 Ga0495650_0000038 Ga0495650_0000038_103285_104223 309
47 3300046559 Ga0495667_0269144 Ga0495667_0269144_60_1067 309
48 3300046615 Ga0495656_0113829 Ga0495656_0113829_295_1242 309
49 3300046678 Ga0495599_0011134 Ga0495599_0011134_16_954 309
50 3300046694 Ga0495649_0200506 Ga0495649_0200506_68_1006 309
51 3300047322 Ga0495680_0056700 Ga0495680_0056700_509_1447 309
52 3300048929 Ga0496126_0000020 Ga0496126_0000020_184796_185734 309
53 3300053077 Ga0495601_0057087 Ga0495601_0057087_79_1086 309
54 3300053087 Ga0500643_037877 Ga0500643_037877_283_1221 309
55 3300046471 Ga0495650_0002096 Ga0495650_0002096_8757_9698 310
56 3300046660 Ga0495625_0000814 Ga0495625_0000814_34089_35030 310
57 3300047320 Ga0495672_0000875 Ga0495672_0000875_29208_30149 310
58 3300047472 Ga0495686_0009364 Ga0495686_0009364_2265_3206 310
59 3300049573 Ga0501037_0192482 Ga0501037_0192482_429_1370 310
60 3300049574 Ga0501038_0372256 Ga0501038_0372256_64_1005 310
61 3300049586 Ga0501070_0053878 Ga0501070_0053878_2069_3010 310
62 3300049822 Ga0501035_0170050 Ga0501035_0170050_516_1457 310
63 3300049823 Ga0501044_0113523 Ga0501044_0113523_355_1296 310
64 3300053109 Ga0500569_000902 Ga0500569_000902_4361_5305 311
65 3300049571 Ga0501034_0003719 Ga0501034_0003719_4833_5786 312
66 3300049571 Ga0501034_0227502 Ga0501034_0227502_99_1052 312
67 iso_pu_bacteria 2945977869 2945979195 312
68 3300010159 Ga0099796_10019493 Ga0099796_100194932 313
69 3300005435 Ga0070714_100046381 Ga0070714_1000463814 314
70 3300026067 Ga0207678_10156920 Ga0207678_101569201 314
71 3300031548 Ga0307408_100099563 Ga0307408_1000995632 314
72 3300031731 Ga0307405_10012885 Ga0307405_100128855 314
73 3300031824 Ga0307413_10018598 Ga0307413_100185983 314
74 3300031852 Ga0307410_10041176 Ga0307410_100411763 314
75 3300031901 Ga0307406_10011431 Ga0307406_100114313 314
76 3300031903 Ga0307407_10009430 Ga0307407_100094304 314
77 3300031995 Ga0307409_100003739 Ga0307409_1000037395 314
78 3300032002 Ga0307416_100038689 Ga0307416_1000386892 314
79 3300032004 Ga0307414_10071082 Ga0307414_100710822 314
80 3300032005 Ga0307411_10045018 Ga0307411_100450184 314
81 3300032126 Ga0307415_100026115 Ga0307415_1000261152 314
82 3300038443 Ga0395901_0004556 Ga0395901_0004556_595_1554 315
83 3300005289 Ga0065704_10074258 Ga0065704_100742585 317
84 3300005331 Ga0070670_100000292 Ga0070670_10000029210 317
85 3300005367 Ga0070667_100000415 Ga0070667_10000041536 317
86 3300005617 Ga0068859_100155823 Ga0068859_1001558233 317
87 3300005618 Ga0068864_100000300 Ga0068864_10000030010 317
88 3300005841 Ga0068863_100000073 Ga0068863_10000007380 317
89 3300005844 Ga0068862_100000431 Ga0068862_10000043112 317
90 3300006931 Ga0097620_100155833 Ga0097620_1001558333 317
91 3300009011 Ga0105251_10000296 Ga0105251_1000029617 317
92 3300009101 Ga0105247_10012063 Ga0105247_100120633 317
93 3300009177 Ga0105248_10000029 Ga0105248_10000029212 317
94 3300014968 Ga0157379_10082915 Ga0157379_100829155 317
95 3300021384 Ga0213876_10000909 Ga0213876_1000090914 317
96 3300021388 Ga0213875_10004925 Ga0213875_100049258 317
97 3300025735 Ga0207713_1002770 Ga0207713_10027708 317
98 3300025900 Ga0207710_10006368 Ga0207710_100063682 317
99 3300025941 Ga0207711_10000004 Ga0207711_10000004294 317
100 3300025986 Ga0207658_10001129 Ga0207658_1000112910 317
101 3300026088 Ga0207641_10000018 Ga0207641_1000001836 317
102 3300026095 Ga0207676_10000276 Ga0207676_1000027611 317
103 3300028380 Ga0268265_10000097 Ga0268265_1000009778 317
104 3300037853 Ga0436364_1307424 Ga0436364_1307424_17003_17965 317
105 3300039437 Ga0436365_0643609 Ga0436365_0643609_12899_13876 317
106 3300048906 Ga0496103_0014765 Ga0496103_0014765_3239_4210 317
107 3300048920 Ga0496117_0004000 Ga0496117_0004000_11105_12076 317
108 3300048921 Ga0496118_0002784 Ga0496118_0002784_12540_13511 317
109 3300005340 Ga0070689_100096183 Ga0070689_1000961832 318
110 3300025936 Ga0207670_10072705 Ga0207670_100727052 318
111 3300026089 Ga0207648_10258703 Ga0207648_102587032 319
112 3300003203 JGI25406J46586_10013591 JGI25406J46586_100135912 321
113 3300004798 Ga0058859_11782272 Ga0058859_117822722 321
114 3300005343 Ga0070687_100147145 Ga0070687_1001471452 321
115 3300005365 Ga0070688_100175590 Ga0070688_1001755901 321
116 3300005441 Ga0070700_100084526 Ga0070700_1000845262 321
117 3300005468 Ga0070707_100351689 Ga0070707_1003516892 321
118 3300005471 Ga0070698_100172939 Ga0070698_1001729392 321
119 3300005544 Ga0070686_100014764 Ga0070686_1000147644 321
120 3300005617 Ga0068859_100064410 Ga0068859_1000644102 321
121 3300005719 Ga0068861_100014168 Ga0068861_1000141684 321
122 3300005842 Ga0068858_100354133 Ga0068858_1003541332 321
123 3300005843 Ga0068860_100034591 Ga0068860_1000345912 321
124 3300005985 Ga0081539_10000597 Ga0081539_1000059750 321
125 3300006852 Ga0075433_10127260 Ga0075433_101272602 321
126 3300006871 Ga0075434_100113670 Ga0075434_1001136702 321
127 3300006931 Ga0097620_100064412 Ga0097620_1000644123 321
128 3300009147 Ga0114129_10515386 Ga0114129_105153862 321
129 3300009553 Ga0105249_10300880 Ga0105249_103008802 321
130 3300011119 Ga0105246_10083985 Ga0105246_100839852 321
131 3300013306 Ga0163162_10214228 Ga0163162_102142281 321
132 3300013308 Ga0157375_10297419 Ga0157375_102974192 321
133 3300014326 Ga0157380_10046279 Ga0157380_100462793 321
134 3300025922 Ga0207646_10373084 Ga0207646_103730841 321
135 3300025961 Ga0207712_10187994 Ga0207712_101879942 321
136 3300026035 Ga0207703_10387617 Ga0207703_103876172 321
137 3300026075 Ga0207708_10032968 Ga0207708_100329683 321
138 3300026095 Ga0207676_10562444 Ga0207676_105624441 321
139 3300026118 Ga0207675_100011052 Ga0207675_1000110524 321
140 3300028381 Ga0268264_10444098 Ga0268264_104440982 321
141 iso_pu_bacteria 2616644814 2616701179 321
142 3300031595 Ga0265313_10021254 Ga0265313_100212542 322
143 3300031712 Ga0265342_10095010 Ga0265342_100950102 322
144 3300044673 Ga0453683_0000036 Ga0453683_0000036_22750_23727 322
145 3300044712 Ga0453684_0002808 Ga0453684_0002808_11853_12830 322
146 3300045051 Ga0451576_0000069 Ga0451576_0000069_51292_52269 322
147 3300045051 Ga0451576_0531037 Ga0451576_0531037_33_1010 322
148 3300006844 Ga0075428_100148069 Ga0075428_1001480692 324
149 3300006871 Ga0075434_100151391 Ga0075434_1001513912 324
150 3300031911 Ga0307412_10249432 Ga0307412_102494322 324
151 3300044712 Ga0453684_0058811 Ga0453684_0058811_937_1929 324
152 3300048909 Ga0496106_0063877 Ga0496106_0063877_1623_2618 324
153 3300048915 Ga0496112_0319835 Ga0496112_0319835_381_1376 324
154 iso_pu_bacteria 2808606448 2809228887 324
155 iso_pu_bacteria 2831905167 2831906975 324
156 3300031691 Ga0316579_10002311 Ga0316579_100023116 325
157 3300031727 Ga0316576_10100099 Ga0316576_101000992 325
158 3300031728 Ga0316578_10000651 Ga0316578_1000065115 325
159 3300031733 Ga0316577_10002446 Ga0316577_100024465 325
160 3300032139 Ga0316580_10013952 Ga0316580_100139522 325
161 3300036647 Ga0316582_0009201 Ga0316582_0009201_3229_4227 325
162 3300036712 Ga0316584_0002980 Ga0316584_0002980_3215_4213 325
163 3300037588 Ga0316581_0001034 Ga0316581_0001034_2793_3791 325
164 3300046454 Ga0495592_0006086 Ga0495592_0006086_4772_5809 325
165 3300046455 Ga0495603_0006449 Ga0495603_0006449_4511_5548 325
166 3300046462 Ga0495651_0012963 Ga0495651_0012963_2259_3296 325
167 3300046499 Ga0495594_0000609 Ga0495594_0000609_7000_8037 325
168 3300046506 Ga0495583_0003402 Ga0495583_0003402_8748_9785 325
169 3300046507 Ga0495606_0003562 Ga0495606_0003562_10405_11442 325
170 3300046515 Ga0495620_0001135 Ga0495620_0001135_7804_8841 325
171 3300046516 Ga0495628_0005563 Ga0495628_0005563_3657_4694 325
172 3300046518 Ga0495631_0008024 Ga0495631_0008024_928_1965 325
173 3300046526 Ga0495666_0038873 Ga0495666_0038873_375_1412 325
174 3300046557 Ga0495622_0001198 Ga0495622_0001198_5530_6567 325
175 3300046559 Ga0495667_0148198 Ga0495667_0148198_348_1385 325
176 3300046616 Ga0495668_0003772 Ga0495668_0003772_2904_3941 325
177 3300046648 Ga0495611_0003403 Ga0495611_0003403_13_1050 325
178 3300046660 Ga0495625_0002581 Ga0495625_0002581_203_1240 325
179 3300046663 Ga0495635_0010647 Ga0495635_0010647_2709_3746 325
180 3300046675 Ga0495657_0002991 Ga0495657_0002991_3203_4240 325
181 3300046689 Ga0495613_0024783 Ga0495613_0024783_3330_4367 325
182 3300046794 Ga0495589_0002429 Ga0495589_0002429_3395_4432 325
183 3300047317 Ga0495604_0008185 Ga0495604_0008185_4534_5571 325
184 3300047322 Ga0495680_0016743 Ga0495680_0016743_3064_4101 325
185 3300047323 Ga0495683_0002147 Ga0495683_0002147_8338_9375 325
186 3300047447 Ga0495685_000407 Ga0495685_000407_10086_11123 325
187 3300048089 Ga0495614_0012363 Ga0495614_0012363_2243_3280 325
188 3300048091 Ga0495626_0007110 Ga0495626_0007110_4326_5363 325
189 iso_pu_bacteria 2738541283 2738758307 325
190 iso_pu_bacteria 2738541284 2738763154 325
191 iso_pu_bacteria 2738543023 2739303835 325
192 iso_pu_bacteria 2775506987 2776616309 325
193 iso_pu_bacteria 2818991442 2819571998 325
194 iso_pu_bacteria 2818991460 2819677767 325
195 iso_pu_bacteria 2821136567 2821141758 325
196 iso_pu_bacteria 2852627209 2852629664 325
197 iso_pu_bacteria 2883068021 2883073197 325
198 iso_pu_bacteria 2884791551 2884797716 325
199 iso_pu_bacteria 2896109856 2896114726 325
200 iso_pu_bacteria 2904467357 2904469827 325
201 iso_pu_bacteria 2919186247 2919191061 325
202 iso_pu_bacteria 2929177148 2929183236 325
203 iso_pu_bacteria 2929239360 2929245362 325
204 iso_pu_bacteria 2929921140 2929927614 325
205 iso_pu_bacteria 2939664404 2939669341 325
206 iso_pu_bacteria 2946013367 2946014936 325
207 iso_pu_bacteria 8003151029 8003151461 325
208 3300003322 rootL2_10160258 rootL2_101602585 326
209 3300005937 Ga0081455_10089200 Ga0081455_100892002 326
210 3300006846 Ga0075430_100198118 Ga0075430_1001981182 326
211 3300006847 Ga0075431_100018982 Ga0075431_1000189824 326
212 3300031727 Ga0316576_10040864 Ga0316576_100408642 326
213 3300031733 Ga0316577_10010268 Ga0316577_100102683 326
214 3300032005 Ga0307411_10037936 Ga0307411_100379362 326
215 3300036647 Ga0316582_0024164 Ga0316582_0024164_1106_2110 326
216 3300038443 Ga0395901_0371422 Ga0395901_0371422_240_1229 326
217 3300050509 nmdc:mga0qj67_16368_c1 nmdc:mga0qj67_16368_c1_1296_2291 326
218 3300050510 nmdc:mga06r32_15049_c1 nmdc:mga06r32_15049_c1_1716_2711 326
219 3300005331 Ga0070670_100197294 Ga0070670_1001972942 327
220 3300005336 Ga0070680_100221815 Ga0070680_1002218152 327
221 3300005336 Ga0070680_100371885 Ga0070680_1003718851 327
222 3300005445 Ga0070708_100189257 Ga0070708_1001892572 327
223 3300005445 Ga0070708_100263674 Ga0070708_1002636741 327
224 3300005467 Ga0070706_100068254 Ga0070706_1000682541 327
225 3300005468 Ga0070707_100452337 Ga0070707_1004523372 327
226 3300005471 Ga0070698_100056214 Ga0070698_1000562144 327
227 3300005518 Ga0070699_100051477 Ga0070699_1000514773 327
228 3300005530 Ga0070679_100120140 Ga0070679_1001201404 327
229 3300005536 Ga0070697_100013284 Ga0070697_1000132848 327
230 3300005549 Ga0070704_100178865 Ga0070704_1001788651 327
231 3300005563 Ga0068855_100352685 Ga0068855_1003526852 327
232 3300005564 Ga0070664_100173869 Ga0070664_1001738692 327
233 3300005618 Ga0068864_100045885 Ga0068864_1000458852 327
234 3300005841 Ga0068863_100087106 Ga0068863_1000871063 327
235 3300006173 Ga0070716_100040475 Ga0070716_1000404754 327
236 3300006852 Ga0075433_10156906 Ga0075433_101569062 327
237 3300006914 Ga0075436_100095937 Ga0075436_1000959372 327
238 3300013102 Ga0157371_10003741 Ga0157371_100037415 327
239 3300013104 Ga0157370_10003843 Ga0157370_100038437 327
240 3300013307 Ga0157372_10003988 Ga0157372_100039888 327
241 3300025906 Ga0207699_10244510 Ga0207699_102445101 327
242 3300025910 Ga0207684_10031677 Ga0207684_100316774 327
243 3300025915 Ga0207693_10267033 Ga0207693_102670332 327
244 3300025939 Ga0207665_10062870 Ga0207665_100628701 327
245 3300025949 Ga0207667_10021474 Ga0207667_100214745 327
246 3300026078 Ga0207702_10005819 Ga0207702_100058192 327
247 3300026088 Ga0207641_10500897 Ga0207641_105008972 327
248 3300031251 Ga0265327_10006221 Ga0265327_100062218 327
249 3300031548 Ga0307408_100013148 Ga0307408_1000131486 327
250 3300031548 Ga0307408_100045499 Ga0307408_1000454992 327
251 3300031711 Ga0265314_10038296 Ga0265314_100382963 327
252 3300031824 Ga0307413_10108715 Ga0307413_101087152 327
253 3300031852 Ga0307410_10006614 Ga0307410_100066142 327
254 3300031852 Ga0307410_10018286 Ga0307410_100182863 327
255 3300031852 Ga0307410_10107511 Ga0307410_101075112 327
256 3300031901 Ga0307406_10030864 Ga0307406_100308642 327
257 3300031903 Ga0307407_10018970 Ga0307407_100189702 327
258 3300031911 Ga0307412_10026545 Ga0307412_100265453 327
259 3300031995 Ga0307409_100008700 Ga0307409_1000087006 327
260 3300031995 Ga0307409_100015405 Ga0307409_1000154052 327
261 3300031995 Ga0307409_100102773 Ga0307409_1001027732 327
262 3300031995 Ga0307409_100533225 Ga0307409_1005332251 327
263 3300032002 Ga0307416_100001429 Ga0307416_1000014296 327
264 3300032002 Ga0307416_100004343 Ga0307416_1000043433 327
265 3300032002 Ga0307416_100170194 Ga0307416_1001701942 327
266 3300032002 Ga0307416_100376135 Ga0307416_1003761352 327
267 3300032004 Ga0307414_10043983 Ga0307414_100439832 327
268 3300032004 Ga0307414_10051328 Ga0307414_100513283 327
269 3300032004 Ga0307414_10067852 Ga0307414_100678522 327
270 3300032004 Ga0307414_10096749 Ga0307414_100967491 327
271 3300032004 Ga0307414_10222659 Ga0307414_102226592 327
272 3300032004 Ga0307414_10312218 Ga0307414_103122181 327
273 3300032005 Ga0307411_10009234 Ga0307411_100092347 327
274 3300032005 Ga0307411_10013833 Ga0307411_100138335 327
275 3300032005 Ga0307411_10033958 Ga0307411_100339582 327
276 3300032126 Ga0307415_100001701 Ga0307415_1000017013 327
277 3300032126 Ga0307415_100006638 Ga0307415_1000066386 327
278 3300032126 Ga0307415_100161571 Ga0307415_1001615712 327
279 3300034816 Ga0373930_0021121 Ga0373930_0021121_223_1230 327
280 3300035088 Ga0373940_0004493 Ga0373940_0004493_1305_2312 327
281 3300035112 Ga0373932_0025561 Ga0373932_0025561_478_1485 327
282 3300035691 Ga0373931_0023779 Ga0373931_0023779_665_1672 327
283 3300035691 Ga0373931_0024584 Ga0373931_0024584_357_1364 327
284 3300037312 Ga0395899_0007594 Ga0395899_0007594_45_1115 327
285 3300037466 Ga0395898_0003612 Ga0395898_0003612_10125_11195 327
286 3300037471 Ga0395905_0301602 Ga0395905_0301602_125_1195 327
287 3300038443 Ga0395901_0000279 Ga0395901_0000279_1300_2304 327
288 3300038443 Ga0395901_0001993 Ga0395901_0001993_12915_13985 327
289 3300048905 Ga0496102_0181570 Ga0496102_0181570_852_1859 327
290 3300048907 Ga0496104_0008797 Ga0496104_0008797_5335_6342 327
291 3300048907 Ga0496104_0085328 Ga0496104_0085328_1019_2026 327
292 3300048908 Ga0496105_0137184 Ga0496105_0137184_839_1846 327
293 3300048911 Ga0496108_0004141 Ga0496108_0004141_247_1254 327
294 3300048911 Ga0496108_0058414 Ga0496108_0058414_71_1078 327
295 3300048912 Ga0496109_0003590 Ga0496109_0003590_2862_3869 327
296 3300048912 Ga0496109_0012623 Ga0496109_0012623_4171_5178 327
297 3300048913 Ga0496110_0065983 Ga0496110_0065983_71_1078 327
298 3300048913 Ga0496110_0186228 Ga0496110_0186228_257_1264 327
299 3300048914 Ga0496111_0013416 Ga0496111_0013416_663_1670 327
300 3300048914 Ga0496111_0058754 Ga0496111_0058754_191_1198 327
301 3300048915 Ga0496112_0002880 Ga0496112_0002880_10930_11937 327
302 3300048916 Ga0496113_0000741 Ga0496113_0000741_5352_6359 327
303 3300048916 Ga0496113_0132429 Ga0496113_0132429_338_1345 327
304 3300048917 Ga0496114_0052108 Ga0496114_0052108_383_1390 327
305 3300049568 Ga0501031_0133037 Ga0501031_0133037_291_1301 327
306 3300049569 Ga0501032_0138448 Ga0501032_0138448_233_1276 327
307 3300049570 Ga0501033_0120961 Ga0501033_0120961_14_1147 327
308 3300049570 Ga0501033_0292938 Ga0501033_0292938_22_1065 327
309 3300049572 Ga0501036_0070283 Ga0501036_0070283_611_1618 327
310 3300049572 Ga0501036_0115103 Ga0501036_0115103_899_1942 327
311 3300049576 Ga0501040_0019566 Ga0501040_0019566_3055_4062 327
312 3300049576 Ga0501040_0026269 Ga0501040_0026269_644_1687 327
313 3300049577 Ga0501041_0016606 Ga0501041_0016606_1715_2758 327
314 3300049580 Ga0501046_0176883 Ga0501046_0176883_344_1351 327
315 3300049582 Ga0501048_0020442 Ga0501048_0020442_2384_3427 327
316 3300049583 Ga0501067_0011567 Ga0501067_0011567_2119_3126 327
317 3300049583 Ga0501067_0041825 Ga0501067_0041825_14_1021 327
318 3300049588 Ga0501072_0191820 Ga0501072_0191820_269_1276 327
319 3300049592 Ga0501076_0003750 Ga0501076_0003750_1607_2650 327
320 3300049592 Ga0501076_0058581 Ga0501076_0058581_1070_2077 327
321 3300049593 Ga0501077_0014567 Ga0501077_0014567_2714_3757 327
322 3300049656 Ga0501209_013208 Ga0501209_013208_102_1109 327
323 3300049741 Ga0501079_0016325 Ga0501079_0016325_1470_2513 327
324 3300049741 Ga0501079_0053803 Ga0501079_0053803_329_1336 327
325 3300049742 Ga0501080_0038029 Ga0501080_0038029_1702_2745 327
326 3300049743 Ga0501081_0011673 Ga0501081_0011673_2175_3182 327
327 3300049744 Ga0501083_0044704 Ga0501083_0044704_1751_2794 327
328 3300049770 Ga0501273_000510 Ga0501273_000510_590_1597 327
329 3300054114 Ga0501084_0023329 Ga0501084_0023329_1902_2945 327
330 3300054114 Ga0501084_0041515 Ga0501084_0041515_1795_2802 327
331 3300059421 Ga0590071_005972 Ga0590071_005972_567_1574 327
332 3300059421 Ga0590071_009001 Ga0590071_009001_241_1245 327
333 3300059423 Ga0590074_006296 Ga0590074_006296_79_1086 327
334 3300059423 Ga0590074_012025 Ga0590074_012025_94_1098 327
335 3300059426 Ga0590077_007285 Ga0590077_007285_707_1714 327
336 3300060353 Ga0501082_0050125 Ga0501082_0050125_296_1303 327
337 3300061734 Ga0530510_0040539 Ga0530510_0040539_993_2000 327
338 3300005327 Ga0070658_10020104 Ga0070658_100201043 328
339 3300005347 Ga0070668_100095027 Ga0070668_1000950272 328
340 3300005406 Ga0070703_10005421 Ga0070703_100054213 328
341 3300005434 Ga0070709_10005139 Ga0070709_100051398 328
342 3300005436 Ga0070713_100096679 Ga0070713_1000966792 328
343 3300005438 Ga0070701_10220886 Ga0070701_102208861 328
344 3300005439 Ga0070711_100005710 Ga0070711_1000057103 328
345 3300005439 Ga0070711_100025090 Ga0070711_1000250905 328
346 3300005440 Ga0070705_100013439 Ga0070705_1000134393 328
347 3300005440 Ga0070705_100156190 Ga0070705_1001561901 328
348 3300005444 Ga0070694_100001094 Ga0070694_1000010942 328
349 3300005445 Ga0070708_100004098 Ga0070708_1000040983 328
350 3300005445 Ga0070708_100039982 Ga0070708_1000399823 328
351 3300005445 Ga0070708_100127425 Ga0070708_1001274251 328
352 3300005457 Ga0070662_100272345 Ga0070662_1002723452 328
353 3300005467 Ga0070706_100005569 Ga0070706_1000055695 328
354 3300005468 Ga0070707_100007438 Ga0070707_1000074381 328
355 3300005468 Ga0070707_100010931 Ga0070707_1000109318 328
356 3300005471 Ga0070698_100015876 Ga0070698_1000158764 328
357 3300005471 Ga0070698_100063498 Ga0070698_1000634982 328
358 3300005471 Ga0070698_100210880 Ga0070698_1002108801 328
359 3300005518 Ga0070699_100009581 Ga0070699_1000095813 328
360 3300005518 Ga0070699_100299399 Ga0070699_1002993992 328
361 3300005530 Ga0070679_100001256 Ga0070679_1000012566 328
362 3300005536 Ga0070697_100001294 Ga0070697_10000129414 328
363 3300005536 Ga0070697_100003459 Ga0070697_10000345911 328
364 3300005536 Ga0070697_100004739 Ga0070697_1000047396 328
365 3300005536 Ga0070697_100236227 Ga0070697_1002362272 328
366 3300005543 Ga0070672_100233351 Ga0070672_1002333511 328
367 3300005545 Ga0070695_100006098 Ga0070695_1000060983 328
368 3300005545 Ga0070695_100064043 Ga0070695_1000640432 328
369 3300005546 Ga0070696_100000740 Ga0070696_1000007407 328
370 3300005546 Ga0070696_100050526 Ga0070696_1000505263 328
371 3300005547 Ga0070693_100001006 Ga0070693_1000010065 328
372 3300005547 Ga0070693_100018101 Ga0070693_1000181014 328
373 3300005548 Ga0070665_100043298 Ga0070665_1000432983 328
374 3300005549 Ga0070704_100006564 Ga0070704_1000065643 328
375 3300005617 Ga0068859_100101848 Ga0068859_1001018482 328
376 3300005618 Ga0068864_100166504 Ga0068864_1001665042 328
377 3300005842 Ga0068858_100571358 Ga0068858_1005713581 328
378 3300005843 Ga0068860_100002227 Ga0068860_1000022275 328
379 3300005985 Ga0081539_10028543 Ga0081539_100285432 328
380 3300006028 Ga0070717_10143433 Ga0070717_101434332 328
381 3300006173 Ga0070716_100001859 Ga0070716_1000018599 328
382 3300006173 Ga0070716_100004211 Ga0070716_1000042118 328
383 3300006173 Ga0070716_100052372 Ga0070716_1000523722 328
384 3300006175 Ga0070712_100029338 Ga0070712_1000293383 328
385 3300006931 Ga0097620_100101847 Ga0097620_1001018472 328
386 3300007265 Ga0099794_10001609 Ga0099794_100016097 328
387 3300007265 Ga0099794_10002978 Ga0099794_100029783 328
388 3300007265 Ga0099794_10016218 Ga0099794_100162184 328
389 3300007265 Ga0099794_10110523 Ga0099794_101105232 328
390 3300009093 Ga0105240_10143457 Ga0105240_101434573 328
391 3300009177 Ga0105248_10005459 Ga0105248_100054595 328
392 3300009177 Ga0105248_10152135 Ga0105248_101521352 328
393 3300010159 Ga0099796_10014533 Ga0099796_100145331 328
394 3300013105 Ga0157369_10093339 Ga0157369_100933392 328
395 3300013105 Ga0157369_10388570 Ga0157369_103885701 328
396 3300013297 Ga0157378_10000560 Ga0157378_1000056017 328
397 3300013306 Ga0163162_10017425 Ga0163162_100174255 328
398 3300013307 Ga0157372_10210633 Ga0157372_102106331 328
399 3300014968 Ga0157379_10070427 Ga0157379_100704272 328
400 3300025885 Ga0207653_10005977 Ga0207653_100059773 328
401 3300025904 Ga0207647_10008554 Ga0207647_100085542 328
402 3300025906 Ga0207699_10006337 Ga0207699_100063375 328
403 3300025906 Ga0207699_10019145 Ga0207699_100191452 328
404 3300025906 Ga0207699_10020705 Ga0207699_100207053 328
405 3300025910 Ga0207684_10011618 Ga0207684_100116183 328
406 3300025910 Ga0207684_10073185 Ga0207684_100731853 328
407 3300025913 Ga0207695_10001548 Ga0207695_1000154830 328
408 3300025913 Ga0207695_10098003 Ga0207695_100980032 328
409 3300025915 Ga0207693_10137464 Ga0207693_101374642 328
410 3300025916 Ga0207663_10012107 Ga0207663_100121072 328
411 3300025921 Ga0207652_10011674 Ga0207652_100116748 328
412 3300025922 Ga0207646_10000481 Ga0207646_100004812 328
413 3300025922 Ga0207646_10000572 Ga0207646_1000057220 328
414 3300025927 Ga0207687_10349342 Ga0207687_103493421 328
415 3300025928 Ga0207700_10069255 Ga0207700_100692555 328
416 3300025928 Ga0207700_10099169 Ga0207700_100991692 328
417 3300025929 Ga0207664_10046416 Ga0207664_100464162 328
418 3300025929 Ga0207664_10380495 Ga0207664_103804951 328
419 3300025933 Ga0207706_10236649 Ga0207706_102366492 328
420 3300025939 Ga0207665_10000023 Ga0207665_1000002361 328
421 3300025939 Ga0207665_10003362 Ga0207665_1000336212 328
422 3300025939 Ga0207665_10032079 Ga0207665_100320793 328
423 3300025939 Ga0207665_10052077 Ga0207665_100520772 328
424 3300025941 Ga0207711_10048440 Ga0207711_100484402 328
425 3300027671 Ga0209588_1002151 Ga0209588_10021512 328
426 3300027671 Ga0209588_1002685 Ga0209588_10026852 328
427 3300027671 Ga0209588_1003067 Ga0209588_10030672 328
428 3300027671 Ga0209588_1016128 Ga0209588_10161283 328
429 3300028016 Ga0265354_1000026 Ga0265354_100002619 328
430 3300028379 Ga0268266_10012805 Ga0268266_100128051 328
431 3300028379 Ga0268266_10213270 Ga0268266_102132701 328
432 3300028577 Ga0265318_10004764 Ga0265318_100047643 328
433 3300030878 Ga0265770_1001077 Ga0265770_10010773 328
434 3300030879 Ga0265765_1000099 Ga0265765_10000995 328
435 3300031238 Ga0265332_10044009 Ga0265332_100440091 328
436 3300031240 Ga0265320_10049766 Ga0265320_100497662 328
437 3300031241 Ga0265325_10031694 Ga0265325_100316943 328
438 3300031241 Ga0265325_10050234 Ga0265325_100502342 328
439 3300031242 Ga0265329_10000084 Ga0265329_1000008435 328
440 3300031249 Ga0265339_10044764 Ga0265339_100447642 328
441 3300031250 Ga0265331_10000047 Ga0265331_1000004781 328
442 3300031250 Ga0265331_10061485 Ga0265331_100614852 328
443 3300031344 Ga0265316_10215532 Ga0265316_102155321 328
444 3300031595 Ga0265313_10007149 Ga0265313_100071496 328
445 3300031595 Ga0265313_10012298 Ga0265313_100122985 328
446 3300031712 Ga0265342_10000158 Ga0265342_1000015860 328
447 3300033547 Ga0316212_1001669 Ga0316212_10016694 328
448 3300033547 Ga0316212_1002260 Ga0316212_10022604 328
449 3300035083 Ga0373926_0071783 Ga0373926_0071783_68_1063 328
450 3300035172 Ga0373955_0091868 Ga0373955_0091868_407_1402 328
451 3300037068 Ga0373925_0224152 Ga0373925_0224152_414_1409 328
452 3300037068 Ga0373925_0268855 Ga0373925_0268855_198_1193 328
453 3300037853 Ga0436364_0297591 Ga0436364_0297591_186_1241 328
454 3300039437 Ga0436365_0070120 Ga0436365_0070120_2694_3689 328
455 3300046454 Ga0495592_0159593 Ga0495592_0159593_418_1416 328
456 3300046459 Ga0495629_0034883 Ga0495629_0034883_1394_2389 328
457 3300046462 Ga0495651_0000075 Ga0495651_0000075_53355_54353 328
458 3300046463 Ga0495653_0005508 Ga0495653_0005508_4511_5551 328
459 3300046472 Ga0495580_0038724 Ga0495580_0038724_1740_2735 328
460 3300046472 Ga0495580_0113002 Ga0495580_0113002_683_1678 328
461 3300046475 Ga0495639_0011600 Ga0495639_0011600_231_1226 328
462 3300046499 Ga0495594_0080085 Ga0495594_0080085_414_1409 328
463 3300046507 Ga0495606_0090662 Ga0495606_0090662_534_1550 328
464 3300046514 Ga0495618_0254772 Ga0495618_0254772_54_1049 328
465 3300046517 Ga0495630_0061676 Ga0495630_0061676_1485_2483 328
466 3300046517 Ga0495630_0207019 Ga0495630_0207019_212_1207 328
467 3300046526 Ga0495666_0061257 Ga0495666_0061257_521_1516 328
468 3300046531 Ga0495665_0078694 Ga0495665_0078694_220_1215 328
469 3300046533 Ga0495640_0022054 Ga0495640_0022054_2369_3364 328
470 3300046535 Ga0495586_0005192 Ga0495586_0005192_1996_2991 328
471 3300046536 Ga0495587_0029043 Ga0495587_0029043_407_1402 328
472 3300046559 Ga0495667_0000317 Ga0495667_0000317_11647_12645 328
473 3300046642 Ga0495634_0031899 Ga0495634_0031899_1020_2015 328
474 3300046663 Ga0495635_0099059 Ga0495635_0099059_233_1228 328
475 3300046675 Ga0495657_0026450 Ga0495657_0026450_2015_3103 328
476 3300046681 Ga0495647_0002103 Ga0495647_0002103_5120_6115 328
477 3300046683 Ga0495658_0007656 Ga0495658_0007656_3613_4608 328
478 3300047319 Ga0495674_0058998 Ga0495674_0058998_1297_2292 328
479 3300047319 Ga0495674_0060030 Ga0495674_0060030_414_1409 328
480 3300047319 Ga0495674_0067190 Ga0495674_0067190_1541_2539 328
481 3300047319 Ga0495674_0195888 Ga0495674_0195888_96_1094 328
482 3300047319 Ga0495674_0275831 Ga0495674_0275831_154_1149 328
483 3300047321 Ga0495676_0051064 Ga0495676_0051064_841_1836 328
484 3300047322 Ga0495680_0000274 Ga0495680_0000274_8372_9370 328
485 3300047444 Ga0495675_0075432 Ga0495675_0075432_580_1578 328
486 3300047471 Ga0495684_0012037 Ga0495684_0012037_5204_6199 328
487 3300047673 Ga0495593_0041388 Ga0495593_0041388_412_1407 328
488 3300048088 Ga0495602_0195313 Ga0495602_0195313_380_1378 328
489 3300048089 Ga0495614_0016960 Ga0495614_0016960_1885_2880 328
490 3300048903 Ga0496100_0128744 Ga0496100_0128744_711_1706 328
491 3300048905 Ga0496102_0013502 Ga0496102_0013502_1956_2951 328
492 3300048907 Ga0496104_0433116 Ga0496104_0433116_190_1185 328
493 3300048910 Ga0496107_0182530 Ga0496107_0182530_529_1524 328
494 3300048917 Ga0496114_0162071 Ga0496114_0162071_303_1298 328
495 3300048918 Ga0496115_0005244 Ga0496115_0005244_5037_6032 328
496 3300048918 Ga0496115_0155922 Ga0496115_0155922_262_1317 328
497 3300049592 Ga0501076_0139491 Ga0501076_0139491_596_1654 328
498 2162886007 SwRhRL2b_contig_1653087 SwRhRL2b_0543.00006560 329
499 3300001904 JGI24736J21556_1007625 JGI24736J21556_10076251 329
500 3300002738 JGI25154J39366_1000587 JGI25154J39366_10005873 329
501 3300002739 JGI25158J39367_1006219 JGI25158J39367_10062191 329
502 3300003215 JGI25153J46596_10000224 JGI25153J46596_1000022436 329
503 3300003320 rootH2_10004419 rootH2_100044194 329
504 3300003320 rootH2_10241813 rootH2_102418132 329
505 3300003322 rootL2_10281962 rootL2_102819621 329
506 3300003322 rootL2_10289050 rootL2_102890502 329
507 3300003323 rootH1_10040132 rootH1_100401323 329
508 3300003762 Ga0055542_1002717 Ga0055542_10027173 329
509 3300003794 Ga0055531_10000132 Ga0055531_100001323 329
510 3300005262 Ga0065165_1028129 Ga0065165_10281291 329
511 3300005288 Ga0065714_10003722 Ga0065714_100037222 329
512 3300005288 Ga0065714_10006151 Ga0065714_100061511 329
513 3300005288 Ga0065714_10069901 Ga0065714_100699013 329
514 3300005288 Ga0065714_10107029 Ga0065714_101070292 329
515 3300005289 Ga0065704_10000425 Ga0065704_1000042521 329
516 3300005289 Ga0065704_10096285 Ga0065704_100962851 329
517 3300005327 Ga0070658_10076261 Ga0070658_100762612 329
518 3300005328 Ga0070676_10002188 Ga0070676_100021886 329
519 3300005329 Ga0070683_100039163 Ga0070683_1000391632 329
520 3300005329 Ga0070683_100354695 Ga0070683_1003546951 329
521 3300005329 Ga0070683_100449933 Ga0070683_1004499331 329
522 3300005334 Ga0068869_100340433 Ga0068869_1003404331 329
523 3300005336 Ga0070680_100020355 Ga0070680_1000203551 329
524 3300005364 Ga0070673_100011603 Ga0070673_1000116034 329
525 3300005366 Ga0070659_100095172 Ga0070659_1000951724 329
526 3300005366 Ga0070659_100111135 Ga0070659_1001111352 329
527 3300005366 Ga0070659_100147183 Ga0070659_1001471832 329
528 3300005456 Ga0070678_100001564 Ga0070678_1000015642 329
529 3300005457 Ga0070662_100000043 Ga0070662_10000004343 329
530 3300005458 Ga0070681_10004632 Ga0070681_100046327 329
531 3300005458 Ga0070681_10347638 Ga0070681_103476382 329
532 3300005459 Ga0068867_100000970 Ga0068867_10000097017 329
533 3300005530 Ga0070679_100000575 Ga0070679_1000005753 329
534 3300005535 Ga0070684_100072257 Ga0070684_1000722573 329
535 3300005539 Ga0068853_100086942 Ga0068853_1000869422 329
536 3300005546 Ga0070696_100098818 Ga0070696_1000988183 329
537 3300005548 Ga0070665_100000017 Ga0070665_100000017197 329
538 3300005563 Ga0068855_100067792 Ga0068855_1000677924 329
539 3300005563 Ga0068855_100092300 Ga0068855_1000923004 329
540 3300005577 Ga0068857_100032705 Ga0068857_1000327053 329
541 3300005614 Ga0068856_100093074 Ga0068856_1000930744 329
542 3300005616 Ga0068852_100004240 Ga0068852_1000042407 329
543 3300005616 Ga0068852_100121571 Ga0068852_1001215711 329
544 3300006237 Ga0097621_100000099 Ga0097621_10000009910 329
545 3300006358 Ga0068871_100000290 Ga0068871_10000029014 329
546 3300009093 Ga0105240_10004537 Ga0105240_100045372 329
547 3300009093 Ga0105240_10083212 Ga0105240_100832123 329
548 3300009093 Ga0105240_10115941 Ga0105240_101159411 329
549 3300009093 Ga0105240_10150951 Ga0105240_101509511 329
550 3300009174 Ga0105241_10005263 Ga0105241_100052638 329
551 3300009174 Ga0105241_10015656 Ga0105241_100156563 329
552 3300009174 Ga0105241_10110294 Ga0105241_101102941 329
553 3300009174 Ga0105241_10125282 Ga0105241_101252822 329
554 3300009176 Ga0105242_10029962 Ga0105242_100299621 329
555 3300009545 Ga0105237_10000805 Ga0105237_1000080529 329
556 3300009545 Ga0105237_10001937 Ga0105237_1000193724 329
557 3300009545 Ga0105237_10065636 Ga0105237_100656364 329
558 3300009551 Ga0105238_10020964 Ga0105238_100209646 329
559 3300009551 Ga0105238_10047639 Ga0105238_100476393 329
560 3300010375 Ga0105239_10000095 Ga0105239_1000009595 329
561 3300010375 Ga0105239_10092634 Ga0105239_100926343 329
562 3300010375 Ga0105239_10240584 Ga0105239_102405842 329
563 3300010375 Ga0105239_10571685 Ga0105239_105716852 329
564 3300013100 Ga0157373_10000034 Ga0157373_1000003436 329
565 3300013100 Ga0157373_10002835 Ga0157373_100028358 329
566 3300013100 Ga0157373_10006316 Ga0157373_1000631610 329
567 3300013100 Ga0157373_10028380 Ga0157373_100283805 329
568 3300013100 Ga0157373_10294336 Ga0157373_102943361 329
569 3300013102 Ga0157371_10001448 Ga0157371_100014482 329
570 3300013102 Ga0157371_10003042 Ga0157371_100030422 329
571 3300013102 Ga0157371_10015852 Ga0157371_100158524 329
572 3300013102 Ga0157371_10050713 Ga0157371_100507132 329
573 3300013102 Ga0157371_10054552 Ga0157371_100545522 329
574 3300013104 Ga0157370_10000083 Ga0157370_1000008358 329
575 3300013104 Ga0157370_10025903 Ga0157370_100259036 329
576 3300013104 Ga0157370_10044375 Ga0157370_100443754 329
577 3300013104 Ga0157370_10128696 Ga0157370_101286963 329
578 3300013105 Ga0157369_10092689 Ga0157369_100926891 329
579 3300013105 Ga0157369_10102491 Ga0157369_101024913 329
580 3300013105 Ga0157369_10142776 Ga0157369_101427763 329
581 3300013296 Ga0157374_10001159 Ga0157374_1000115919 329
582 3300013296 Ga0157374_10009460 Ga0157374_100094607 329
583 3300013306 Ga0163162_10000051 Ga0163162_1000005191 329
584 3300013307 Ga0157372_10002554 Ga0157372_1000255415 329
585 3300013307 Ga0157372_10004195 Ga0157372_1000419512 329
586 3300013307 Ga0157372_10033289 Ga0157372_100332895 329
587 3300013308 Ga0157375_10195387 Ga0157375_101953871 329
588 3300014497 Ga0182008_10000022 Ga0182008_1000002228 329
589 3300014497 Ga0182008_10000104 Ga0182008_1000010439 329
590 3300014745 Ga0157377_10101298 Ga0157377_101012982 329
591 3300014969 Ga0157376_10016366 Ga0157376_100163664 329
592 3300015261 Ga0182006_1000279 Ga0182006_10002799 329
593 3300015261 Ga0182006_1010075 Ga0182006_10100755 329
594 3300015262 Ga0182007_10011886 Ga0182007_100118862 329
595 3300015265 Ga0182005_1000209 Ga0182005_100020935 329
596 3300017792 Ga0163161_10000828 Ga0163161_1000082817 329
597 3300025208 Ga0209436_104141 Ga0209436_1041414 329
598 3300025208 Ga0209436_108603 Ga0209436_1086032 329
599 3300025242 Ga0209258_100075 Ga0209258_100075149 329
600 3300025246 Ga0209646_1000005 Ga0209646_1000005568 329
601 3300025250 Ga0209026_1000198 Ga0209026_10001983 329
602 3300025250 Ga0209026_1000199 Ga0209026_100019918 329
603 3300025254 Ga0209148_1000085 Ga0209148_100008580 329
604 3300025258 Ga0209129_1007780 Ga0209129_10077802 329
605 3300025297 Ga0209758_1000742 Ga0209758_100074231 329
606 3300025302 Ga0207426_1000057 Ga0207426_1000057118 329
607 3300025302 Ga0207426_1000888 Ga0207426_100088825 329
608 3300025304 Ga0209257_1000004 Ga0209257_10000041153 329
609 3300025904 Ga0207647_10000036 Ga0207647_1000003623 329
610 3300025907 Ga0207645_10000312 Ga0207645_1000031227 329
611 3300025909 Ga0207705_10016332 Ga0207705_100163323 329
612 3300025909 Ga0207705_10044980 Ga0207705_100449801 329
613 3300025911 Ga0207654_10009434 Ga0207654_100094344 329
614 3300025911 Ga0207654_10011141 Ga0207654_100111412 329
615 3300025912 Ga0207707_10176083 Ga0207707_101760832 329
616 3300025913 Ga0207695_10013446 Ga0207695_100134469 329
617 3300025913 Ga0207695_10046307 Ga0207695_100463075 329
618 3300025914 Ga0207671_10002974 Ga0207671_100029749 329
619 3300025914 Ga0207671_10005112 Ga0207671_100051129 329
620 3300025914 Ga0207671_10007229 Ga0207671_100072292 329
621 3300025917 Ga0207660_10051504 Ga0207660_100515043 329
622 3300025917 Ga0207660_10146516 Ga0207660_101465162 329
623 3300025919 Ga0207657_10092205 Ga0207657_100922054 329
624 3300025919 Ga0207657_10192169 Ga0207657_101921692 329
625 3300025921 Ga0207652_10000051 Ga0207652_1000005184 329
626 3300025921 Ga0207652_10000791 Ga0207652_1000079117 329
627 3300025924 Ga0207694_10096180 Ga0207694_100961802 329
628 3300025932 Ga0207690_10060358 Ga0207690_100603582 329
629 3300025932 Ga0207690_10113976 Ga0207690_101139764 329
630 3300025933 Ga0207706_10000125 Ga0207706_100001254 329
631 3300025934 Ga0207686_10111386 Ga0207686_101113862 329
632 3300025938 Ga0207704_10000335 Ga0207704_100003357 329
633 3300025940 Ga0207691_10151605 Ga0207691_101516052 329
634 3300025942 Ga0207689_10213628 Ga0207689_102136281 329
635 3300025944 Ga0207661_10027845 Ga0207661_100278452 329
636 3300025949 Ga0207667_10002789 Ga0207667_100027899 329
637 3300025949 Ga0207667_10070847 Ga0207667_100708472 329
638 3300025960 Ga0207651_10002492 Ga0207651_100024926 329
639 3300026041 Ga0207639_10067588 Ga0207639_100675883 329
640 3300026078 Ga0207702_10065757 Ga0207702_100657574 329
641 3300026089 Ga0207648_10000961 Ga0207648_1000096127 329
642 3300026089 Ga0207648_10184925 Ga0207648_101849251 329
643 3300026095 Ga0207676_10033700 Ga0207676_100337002 329
644 3300026116 Ga0207674_10084633 Ga0207674_100846332 329
645 3300026121 Ga0207683_10010707 Ga0207683_100107076 329
646 3300026121 Ga0207683_10239986 Ga0207683_102399861 329
647 3300026142 Ga0207698_10003948 Ga0207698_100039483 329
648 3300028379 Ga0268266_10000037 Ga0268266_10000037120 329
649 3300031548 Ga0307408_100329279 Ga0307408_1003292791 329
650 3300031911 Ga0307412_10000001 Ga0307412_1000000157 329
651 3300032004 Ga0307414_10000268 Ga0307414_1000026814 329
652 3300032004 Ga0307414_10000987 Ga0307414_1000098711 329
653 3300032004 Ga0307414_10017542 Ga0307414_100175423 329
654 3300032004 Ga0307414_10127997 Ga0307414_101279973 329
655 3300032004 Ga0307414_10297239 Ga0307414_102972391 329
656 3300032005 Ga0307411_10161600 Ga0307411_101616002 329
657 3300033180 Ga0307510_10001091 Ga0307510_1000109116 329
658 3300037312 Ga0395899_0006954 Ga0395899_0006954_6377_7378 329
659 3300037312 Ga0395899_0012626 Ga0395899_0012626_4617_5618 329
660 3300037312 Ga0395899_0062700 Ga0395899_0062700_238_1296 329
661 3300037418 Ga0395900_0016874 Ga0395900_0016874_1835_2836 329
662 3300037418 Ga0395900_0047098 Ga0395900_0047098_1315_2316 329
663 3300037418 Ga0395900_0091042 Ga0395900_0091042_635_1693 329
664 3300037418 Ga0395900_0442233 Ga0395900_0442233_186_1187 329
665 3300037466 Ga0395898_0053989 Ga0395898_0053989_798_1799 329
666 3300037466 Ga0395898_0101731 Ga0395898_0101731_450_1451 329
667 3300037466 Ga0395898_0153441 Ga0395898_0153441_1007_2065 329
668 3300037471 Ga0395905_0000001 Ga0395905_0000001_961491_962492 329
669 3300037471 Ga0395905_0057101 Ga0395905_0057101_1814_2815 329
670 3300038443 Ga0395901_0001337 Ga0395901_0001337_218_1219 329
671 3300038443 Ga0395901_0039033 Ga0395901_0039033_64_1065 329
672 3300041997 Ga0439431_0000125 Ga0439431_0000125_9885_10895 329
673 3300042007 Ga0439449_0051961 Ga0439449_0051961_68_1066 329
674 3300044684 Ga0466966_0097862 Ga0466966_0097862_222_1220 329
675 3300044842 Ga0466957_0195151 Ga0466957_0195151_151_1161 329
676 3300045049 Ga0466959_0019904 Ga0466959_0019904_3257_4267 329
677 3300046453 Ga0495627_006558 Ga0495627_006558_2343_3341 329
678 3300046500 Ga0495596_0011908 Ga0495596_0011908_1330_2319 329
679 3300046518 Ga0495631_0006473 Ga0495631_0006473_1334_2323 329
680 3300046558 Ga0495633_0000022 Ga0495633_0000022_2477_3475 329
681 3300047472 Ga0495686_0000737 Ga0495686_0000737_21013_22002 329
682 3300047472 Ga0495686_0060005 Ga0495686_0060005_789_1778 329
683 3300048924 Ga0496121_0000010 Ga0496121_0000010_257440_258438 329
684 3300048925 Ga0496122_0002421 Ga0496122_0002421_545_1534 329
685 3300048926 Ga0496123_0008155 Ga0496123_0008155_6636_7625 329
686 3300049570 Ga0501033_0039590 Ga0501033_0039590_1907_2908 329
687 3300049571 Ga0501034_0052256 Ga0501034_0052256_1912_2913 329
688 3300049576 Ga0501040_0106504 Ga0501040_0106504_277_1272 329
689 3300049581 Ga0501047_0174021 Ga0501047_0174021_696_1694 329
690 3300049758 Ga0501241_000418 Ga0501241_000418_3648_4646 329
691 3300049758 Ga0501241_002808 Ga0501241_002808_2120_3109 329
692 3300049823 Ga0501044_0223098 Ga0501044_0223098_137_1135 329
693 3300053080 Ga0500635_0002802 Ga0500635_0002802_1432_2421 329
694 3300053088 Ga0500644_0000240 Ga0500644_0000240_10132_11130 329
695 3300053090 Ga0500646_0005886 Ga0500646_0005886_1900_2898 329
696 3300053093 Ga0500651_0001193 Ga0500651_0001193_9584_10573 329
697 3300053131 Ga0500652_015058 Ga0500652_015058_1249_2247 329
698 3300053139 Ga0500568_0038280 Ga0500568_0038280_688_1686 329
699 3300053153 Ga0500616_0004435 Ga0500616_0004435_1725_2723 329
700 3300053156 Ga0500622_0000616 Ga0500622_0000616_11783_12781 329
701 3300053177 Ga0500636_0123366 Ga0500636_0123366_297_1295 329
702 3300055283 Ga0500661_005595 Ga0500661_005595_1257_2255 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

287

376

0.99

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

157

235

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9713 6 327
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9669 5 327
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9668 5 327
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9651 6 327
1ebl-assembly1.cif.gz_B the 1.8 a crystal structure and active site architecture of beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) from escherichia coli 0.965 5 327
ID Description Score Start End Superfamily
3il4B01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9834 5 171 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9787 5 171 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9646 5 327 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9643 5 329 3.40.47.10
1mzjA01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9609 5 167 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A4Q3EMF0-F1-model_v4 3-oxoacyl-ACP synthase 1 245 329 GO:0016020
GO:0016746
GO:0044550
AF-A0A399T4J9-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.996 1 329 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550
AF-A0A176TEF8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9951 1 329 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550
AF-A0A5C8LMJ0-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9949 1 329 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550
AF-A0A239AFL5-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9948 1 329 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550

Feature Viewer

pLDDT pTM Quality
96.86 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map