F476207

General Info

Members Datasets Scaffolds Average Seq Length
702 260 702 236

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10086850|Ga0070715_100868502
Length 275
Sequence VRVSVIIPTHNEAKAIGRVLADLPSNLVTEVIVVDSNSNDGTPEIAAKMGARLLQEPRRGYGRACLTGLAAANAPDVVVFLDGDYSDRPSELPILIQPILDGRADITLGSRRRERRSAGALPWHQVLGNRLAASLIRLLYRLDITDLGPFRAGRADVLGALGLEEKTYGWAVEMILKGALAGYRVIEVPVSYYPRIGKSKISGTLKGTIGAGWFILSLIVRYYFRRRIGATPKPAAHQNYATLERDGGAIVRERPCTGNHGESTEARHGQDSPYA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.56
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000349 3300000546 Bacteria 8109
2 LJNas_1009783 3300000546 Unclassified 1024
3 Ga0065712_10010322 3300005290 Bacteria 2115
4 Ga0070658_10214408 3300005327 Bacteria 1627
5 Ga0070676_10004271 3300005328 Bacteria 7506
6 Ga0070683_100009472 3300005329 Bacteria 8331
7 Ga0070683_100194454 3300005329 Bacteria 1926
8 Ga0070683_100631946 3300005329 Bacteria 1025
9 Ga0070690_100109004 3300005330 Bacteria 1845
10 Ga0070670_100012988 3300005331 Bacteria 7131
11 Ga0070670_100202703 3300005331 Bacteria 1724
12 Ga0068869_100042663 3300005334 Bacteria 3253
13 Ga0068869_100131910 3300005334 Bacteria 1921
14 Ga0068869_100158088 3300005334 Bacteria 1763
15 Ga0070666_10007921 3300005335 Bacteria 6564
16 Ga0070666_10227042 3300005335 Bacteria 1318
17 Ga0070680_100040194 3300005336 Unclassified 3786
18 Ga0070680_100157142 3300005336 Bacteria 1910
19 Ga0070680_100199043 3300005336 Unclassified 1689
20 Ga0070680_100408162 3300005336 Bacteria 1158
21 Ga0068868_100094805 3300005338 Bacteria 2408
22 Ga0070660_100009894 3300005339 Bacteria 6726
23 Ga0070660_100141774 3300005339 Unclassified 1928
24 Ga0070661_100078921 3300005344 Bacteria 2428
25 Ga0070661_100612181 3300005344 Unclassified 881
26 Ga0070668_100265344 3300005347 Bacteria 1429
27 Ga0070669_100027856 3300005353 Bacteria 4067
28 Ga0070675_100252454 3300005354 Bacteria 1544
29 Ga0070671_100018649 3300005355 Bacteria 5638
30 Ga0070671_100026671 3300005355 Unclassified 4751
31 Ga0070671_100240237 3300005355 Bacteria 1537
32 Ga0070671_100499019 3300005355 Unclassified 1047
33 Ga0070673_100275847 3300005364 Bacteria 1473
34 Ga0070659_100022184 3300005366 Bacteria 4843
35 Ga0070659_100148454 3300005366 Bacteria 1911
36 Ga0070667_100008621 3300005367 Bacteria 8450
37 Ga0070709_10015593 3300005434 Unclassified 4327
38 Ga0070709_10047348 3300005434 Bacteria 2678
39 Ga0070709_10070357 3300005434 Bacteria 2255
40 Ga0070709_10099697 3300005434 Bacteria 1933
41 Ga0070709_10101062 3300005434 Bacteria 1921
42 Ga0070709_10224941 3300005434 Bacteria 1340
43 Ga0070709_10572290 3300005434 Bacteria 867
44 Ga0070714_100000231 3300005435 Bacteria 44130
45 Ga0070714_100002825 3300005435 Bacteria 12811
46 Ga0070714_100016881 3300005435 Bacteria 5905
47 Ga0070714_100040186 3300005435 Unclassified 3941
48 Ga0070714_100040692 3300005435 Unclassified 3918
49 Ga0070714_100077770 3300005435 Bacteria 2882
50 Ga0070714_100080724 3300005435 Bacteria 2830
51 Ga0070714_100123982 3300005435 Bacteria 2301
52 Ga0070714_100131459 3300005435 Bacteria 2237
53 Ga0070714_100179564 3300005435 Bacteria 1925
54 Ga0070714_100642992 3300005435 Bacteria 1021
55 Ga0070713_100037457 3300005436 Unclassified 3921
56 Ga0070713_100044039 3300005436 Bacteria 3652
57 Ga0070713_100050310 3300005436 Unclassified 3442
58 Ga0070713_100067106 3300005436 Bacteria 3019
59 Ga0070713_100079724 3300005436 Bacteria 2790
60 Ga0070713_100126421 3300005436 Bacteria 2249
61 Ga0070713_100183904 3300005436 Bacteria 1879
62 Ga0070713_100338960 3300005436 Bacteria 1393
63 Ga0070713_100834149 3300005436 Unclassified 885
64 Ga0070710_10000598 3300005437 Bacteria 17193
65 Ga0070710_10030372 3300005437 Bacteria 2907
66 Ga0070710_10086096 3300005437 Bacteria 1845
67 Ga0070711_100000159 3300005439 Bacteria 36590
68 Ga0070711_100004814 3300005439 Bacteria 8007
69 Ga0070711_100036059 3300005439 Bacteria 3312
70 Ga0070711_100219153 3300005439 Bacteria 1478
71 Ga0070705_100090729 3300005440 Bacteria 1903
72 Ga0070708_100015426 3300005445 Bacteria 6311
73 Ga0070708_100022662 3300005445 Bacteria 5329
74 Ga0070708_100134488 3300005445 Bacteria 2290
75 Ga0070708_100147272 3300005445 Bacteria 2188
76 Ga0070708_100182492 3300005445 Bacteria 1962
77 Ga0070708_100210712 3300005445 Bacteria 1821
78 Ga0070708_100514080 3300005445 Unclassified 1129
79 Ga0070663_100001583 3300005455 Bacteria 12524
80 Ga0070663_100058233 3300005455 Unclassified 2774
81 Ga0070663_100202162 3300005455 Bacteria 1551
82 Ga0070678_100014781 3300005456 Unclassified 4937
83 Ga0070662_100007366 3300005457 Bacteria 7129
84 Ga0070681_10013120 3300005458 Bacteria 8231
85 Ga0070681_10023043 3300005458 Bacteria 6261
86 Ga0070681_10050013 3300005458 Unclassified 4172
87 Ga0070681_10196413 3300005458 Bacteria 1936
88 Ga0070681_10708545 3300005458 Unclassified 922
89 Ga0070706_100002718 3300005467 Bacteria 17695
90 Ga0070707_100043153 3300005468 Bacteria 4317
91 Ga0070707_100217838 3300005468 Bacteria 1860
92 Ga0070707_100511377 3300005468 Bacteria 1163
93 Ga0070707_100580287 3300005468 Bacteria 1083
94 Ga0070698_100169559 3300005471 Bacteria 2124
95 Ga0070699_100014701 3300005518 Bacteria 6731
96 Ga0070699_100092300 3300005518 Bacteria 2648
97 Ga0070699_100255190 3300005518 Bacteria 1567
98 Ga0070699_100383218 3300005518 Unclassified 1270
99 Ga0070679_100057638 3300005530 Unclassified 3872
100 Ga0070679_100107684 3300005530 Bacteria 2773
101 Ga0070679_100131331 3300005530 Bacteria 2485
102 Ga0070679_100497605 3300005530 Unclassified 1163
103 Ga0070684_100100654 3300005535 Bacteria 2581
104 Ga0070684_100114557 3300005535 Bacteria 2420
105 Ga0070697_100000326 3300005536 Bacteria 37671
106 Ga0070697_100011012 3300005536 Bacteria 7065
107 Ga0070697_100011538 3300005536 Bacteria 6903
108 Ga0070697_100026945 3300005536 Bacteria 4596
109 Ga0070697_100145934 3300005536 Unclassified 1991
110 Ga0070697_100163468 3300005536 Bacteria 1881
111 Ga0070697_100169918 3300005536 Bacteria 1845
112 Ga0070697_100263634 3300005536 Bacteria 1476
113 Ga0068853_100000041 3300005539 Bacteria 104733
114 Ga0068853_100074178 3300005539 Unclassified 2968
115 Ga0068853_100128518 3300005539 Bacteria 2266
116 Ga0068853_100161418 3300005539 Bacteria 2023
117 Ga0070695_100065390 3300005545 Bacteria 2368
118 Ga0070695_100122838 3300005545 Unclassified 1779
119 Ga0070696_100242520 3300005546 Bacteria 1360
120 Ga0070693_100017058 3300005547 Bacteria 3768
121 Ga0070665_100002740 3300005548 Bacteria 19089
122 Ga0070665_100128605 3300005548 Bacteria 2535
123 Ga0070665_100202526 3300005548 Unclassified 1985
124 Ga0068855_100001421 3300005563 Bacteria 29751
125 Ga0068855_100007086 3300005563 Bacteria 13598
126 Ga0068855_100103090 3300005563 Bacteria 3283
127 Ga0068855_100182725 3300005563 Bacteria 2370
128 Ga0068855_100551094 3300005563 Bacteria 1248
129 Ga0068855_100596962 3300005563 Unclassified 1191
130 Ga0070664_100028967 3300005564 Unclassified 4613
131 Ga0068857_100040374 3300005577 Unclassified 4138
132 Ga0068857_100199467 3300005577 Bacteria 1824
133 Ga0068854_100000122 3300005578 Bacteria 53557
134 Ga0068854_100004655 3300005578 Bacteria 8657
135 Ga0068854_100012486 3300005578 Bacteria 5565
136 Ga0068856_100001532 3300005614 Bacteria 24221
137 Ga0068856_100001724 3300005614 Bacteria 22874
138 Ga0068856_100084818 3300005614 Bacteria 3147
139 Ga0068856_100275654 3300005614 Bacteria 1698
140 Ga0068852_100006220 3300005616 Bacteria 8608
141 Ga0068859_100069216 3300005617 Bacteria 3564
142 Ga0068859_100661688 3300005617 Unclassified 1136
143 Ga0068864_100002560 3300005618 Bacteria 15015
144 Ga0068864_100166538 3300005618 Bacteria 2007
145 Ga0068866_10007100 3300005718 Unclassified 4682
146 Ga0068866_10188617 3300005718 Unclassified 1223
147 Ga0068851_10022899 3300005834 Bacteria 3049
148 Ga0068851_10162447 3300005834 Bacteria 1228
149 Ga0068870_10099249 3300005840 Unclassified 1642
150 Ga0068863_100246309 3300005841 Unclassified 1726
151 Ga0068863_100312803 3300005841 Bacteria 1525
152 Ga0068858_100012338 3300005842 Bacteria 8057
153 Ga0068858_100051663 3300005842 Unclassified 3803
154 Ga0068860_100014915 3300005843 Bacteria 7599
155 Ga0068860_100017349 3300005843 Bacteria 7014
156 Ga0068862_101143201 3300005844 Unclassified 775
157 Ga0081455_10187249 3300005937 Unclassified 1562
158 Ga0070717_10001232 3300006028 Bacteria 17417
159 Ga0070717_10002444 3300006028 Bacteria 13112
160 Ga0070717_10020392 3300006028 Bacteria 5213
161 Ga0070717_10022002 3300006028 Bacteria 5031
162 Ga0070717_10080035 3300006028 Unclassified 2741
163 Ga0070717_10091757 3300006028 Bacteria 2565
164 Ga0070717_10100743 3300006028 Bacteria 2453
165 Ga0070717_10165414 3300006028 Unclassified 1921
166 Ga0070717_10188568 3300006028 Bacteria 1801
167 Ga0070717_10239227 3300006028 Unclassified 1600
168 Ga0070717_10325563 3300006028 Unclassified 1370
169 Ga0070717_10583582 3300006028 Bacteria 1013
170 Ga0070715_10006010 3300006163 Bacteria 4095
171 Ga0070715_10009792 3300006163 Bacteria 3392
172 Ga0070715_10033649 3300006163 Bacteria 2096
173 Ga0070715_10086850 3300006163 Bacteria 1431
174 Ga0070716_100000354 3300006173 Bacteria 18784
175 Ga0070716_100013004 3300006173 Unclassified 4231
176 Ga0070716_100020719 3300006173 Bacteria 3455
177 Ga0070716_100037906 3300006173 Bacteria 2666
178 Ga0070716_100060291 3300006173 Unclassified 2191
179 Ga0070716_100069700 3300006173 Bacteria 2062
180 Ga0070716_100087231 3300006173 Bacteria 1880
181 Ga0070716_100135372 3300006173 Bacteria 1564
182 Ga0070716_100273149 3300006173 Bacteria 1163
183 Ga0070716_100327496 3300006173 Bacteria 1076
184 Ga0070716_100464490 3300006173 Bacteria 926
185 Ga0070712_100006375 3300006175 Bacteria 7319
186 Ga0070712_100023999 3300006175 Bacteria 4035
187 Ga0070712_100033247 3300006175 Bacteria 3488
188 Ga0070712_100034649 3300006175 Bacteria 3423
189 Ga0070712_100063059 3300006175 Unclassified 2623
190 Ga0070712_100127114 3300006175 Unclassified 1927
191 Ga0070712_100135417 3300006175 Bacteria 1873
192 Ga0070712_100291568 3300006175 Unclassified 1317
193 Ga0097621_100000034 3300006237 Bacteria 69159
194 Ga0097621_100019759 3300006237 Bacteria 5178
195 Ga0097621_100026888 3300006237 Unclassified 4520
196 Ga0097621_100067291 3300006237 Bacteria 2952
197 Ga0097621_100420697 3300006237 Unclassified 1199
198 Ga0068871_100000819 3300006358 Bacteria 20831
199 Ga0068871_100008170 3300006358 Bacteria 7519
200 Ga0068871_100145113 3300006358 Bacteria 2020
201 Ga0068871_100170052 3300006358 Unclassified 1868
202 Ga0068871_100213398 3300006358 Bacteria 1670
203 Ga0075430_100190189 3300006846 Unclassified 1706
204 Ga0075431_100140971 3300006847 Unclassified 2485
205 Ga0075433_10004547 3300006852 Bacteria 10818
206 Ga0075433_10008310 3300006852 Bacteria 8275
207 Ga0075433_10498326 3300006852 Bacteria 1072
208 Ga0075434_100000235 3300006871 Bacteria 38289
209 Ga0075434_100004271 3300006871 Bacteria 12817
210 Ga0075434_100020351 3300006871 Bacteria 6435
211 Ga0075434_100033552 3300006871 Bacteria 5066
212 Ga0075434_100232600 3300006871 Bacteria 1863
213 Ga0075429_100029806 3300006880 Bacteria 4740
214 Ga0068865_100299098 3300006881 Bacteria 1287
215 Ga0068865_100531565 3300006881 Unclassified 985
216 Ga0075436_100002580 3300006914 Bacteria 12453
217 Ga0075436_100005980 3300006914 Bacteria 8355
218 Ga0075436_100008969 3300006914 Bacteria 6844
219 Ga0075436_100090790 3300006914 Bacteria 2124
220 Ga0075436_100100340 3300006914 Bacteria 2016
221 Ga0075436_100163182 3300006914 Bacteria 1571
222 Ga0097620_100069219 3300006931 Bacteria 3564
223 Ga0097620_100661662 3300006931 Unclassified 1136
224 Ga0075435_100003821 3300007076 Bacteria 10277
225 Ga0075435_100007962 3300007076 Bacteria 7584
226 Ga0075435_100091169 3300007076 Unclassified 2515
227 Ga0075435_100185332 3300007076 Unclassified 1760
228 Ga0075435_100299519 3300007076 Unclassified 1375
229 Ga0099794_10000033 3300007265 Bacteria 57721
230 Ga0105240_10004264 3300009093 Bacteria 21862
231 Ga0105240_10038089 3300009093 Bacteria 6172
232 Ga0105240_10040354 3300009093 Bacteria 5971
233 Ga0105240_10042413 3300009093 Bacteria 5798
234 Ga0105240_10047360 3300009093 Bacteria 5441
235 Ga0105240_10227221 3300009093 Bacteria 2171
236 Ga0105240_10377040 3300009093 Bacteria 1603
237 Ga0105245_10000411 3300009098 Bacteria 39875
238 Ga0105245_10247513 3300009098 Unclassified 1731
239 Ga0105245_10273445 3300009098 Bacteria 1648
240 Ga0114129_10006148 3300009147 Bacteria 17029
241 Ga0114129_10074350 3300009147 Unclassified 4733
242 Ga0114129_10098137 3300009147 Bacteria 4055
243 Ga0114129_10599373 3300009147 Bacteria 1427
244 Ga0105241_10008117 3300009174 Bacteria 7728
245 Ga0105241_10039967 3300009174 Unclassified 3539
246 Ga0105241_10328312 3300009174 Bacteria 1321
247 Ga0105241_10335533 3300009174 Bacteria 1308
248 Ga0105242_10076575 3300009176 Bacteria 2789
249 Ga0105242_10143932 3300009176 Unclassified 2072
250 Ga0105248_10011027 3300009177 Bacteria 9969
251 Ga0105248_10044402 3300009177 Bacteria 4984
252 Ga0105248_10069980 3300009177 Unclassified 3940
253 Ga0105248_10161420 3300009177 Bacteria 2528
254 Ga0105248_10399384 3300009177 Bacteria 1548
255 Ga0105248_10571794 3300009177 Bacteria 1275
256 Ga0105248_10957926 3300009177 Bacteria 966
257 Ga0105237_10014906 3300009545 Bacteria 8105
258 Ga0105237_10038741 3300009545 Bacteria 4813
259 Ga0105237_10244648 3300009545 Unclassified 1795
260 Ga0105237_10340471 3300009545 Bacteria 1504
261 Ga0105237_10484699 3300009545 Bacteria 1243
262 Ga0105238_10034553 3300009551 Bacteria 5143
263 Ga0105238_10036544 3300009551 Bacteria 4994
264 Ga0105249_10017407 3300009553 Bacteria 6380
265 Ga0105249_10525858 3300009553 Bacteria 1231
266 Ga0099796_10045110 3300010159 Bacteria 1509
267 Ga0105239_10021480 3300010375 Bacteria 7116
268 Ga0105239_10095242 3300010375 Unclassified 3289
269 Ga0105239_10204751 3300010375 Bacteria 2211
270 Ga0105239_10270453 3300010375 Bacteria 1911
271 Ga0105246_10020182 3300011119 Unclassified 4272
272 Ga0157373_10007167 3300013100 Bacteria 8319
273 Ga0157371_10138302 3300013102 Bacteria 1735
274 Ga0157370_10002484 3300013104 Bacteria 22231
275 Ga0157370_10581091 3300013104 Unclassified 1026
276 Ga0157370_10582087 3300013104 Bacteria 1025
277 Ga0157369_10010669 3300013105 Bacteria 10456
278 Ga0157369_10119097 3300013105 Unclassified 2802
279 Ga0157369_10155259 3300013105 Bacteria 2418
280 Ga0157369_10399861 3300013105 Bacteria 1425
281 Ga0157374_10000249 3300013296 Bacteria 49808
282 Ga0157374_10000787 3300013296 Bacteria 27777
283 Ga0157374_10009849 3300013296 Bacteria 8202
284 Ga0157374_10128064 3300013296 Unclassified 2455
285 Ga0157374_10136988 3300013296 Bacteria 2374
286 Ga0157374_10731504 3300013296 Unclassified 1003
287 Ga0157378_10000008 3300013297 Bacteria 162605
288 Ga0157378_10001217 3300013297 Bacteria 23322
289 Ga0157378_10003381 3300013297 Bacteria 14183
290 Ga0157378_10011452 3300013297 Bacteria 7761
291 Ga0157378_10038080 3300013297 Unclassified 4261
292 Ga0163162_10008783 3300013306 Bacteria 9822
293 Ga0157372_10000436 3300013307 Bacteria 45959
294 Ga0157372_10000992 3300013307 Bacteria 31047
295 Ga0157372_10030521 3300013307 Bacteria 5897
296 Ga0157372_10141022 3300013307 Bacteria 2776
297 Ga0157375_10024068 3300013308 Bacteria 5630
298 Ga0157375_10117717 3300013308 Bacteria 2763
299 Ga0157375_10813244 3300013308 Unclassified 1083
300 Ga0163163_10018345 3300014325 Bacteria 6548
301 Ga0163163_10064958 3300014325 Bacteria 3621
302 Ga0163163_10186746 3300014325 Bacteria 2120
303 Ga0163163_10239781 3300014325 Bacteria 1863
304 Ga0182008_10021637 3300014497 Bacteria 3302
305 Ga0157379_10003566 3300014968 Bacteria 13181
306 Ga0157376_10001493 3300014969 Bacteria 15434
307 Ga0157376_10002140 3300014969 Bacteria 13309
308 Ga0157376_10088787 3300014969 Unclassified 2671
309 Ga0182006_1046599 3300015261 Bacteria 1684
310 Ga0182007_10028080 3300015262 Bacteria 1935
311 Ga0182005_1011524 3300015265 Bacteria 2518
312 Ga0213873_10074341 3300021358 Unclassified 941
313 Ga0213872_10001338 3300021361 Bacteria 16267
314 Ga0213872_10001709 3300021361 Bacteria 13824
315 Ga0213872_10002491 3300021361 Bacteria 10775
316 Ga0213872_10031819 3300021361 Bacteria 2418
317 Ga0213872_10045545 3300021361 Bacteria 1996
318 Ga0213872_10094590 3300021361 Bacteria 1335
319 Ga0213872_10104727 3300021361 Bacteria 1259
320 Ga0213876_10056935 3300021384 Bacteria 2064
321 Ga0213875_10009771 3300021388 Bacteria 4843
322 Ga0213875_10080460 3300021388 Bacteria 1520
323 Ga0213875_10223533 3300021388 Unclassified 887
324 Ga0213871_10008210 3300021441 Bacteria 2292
325 Ga0228598_1001283 3300024227 Bacteria 5531
326 Ga0207656_10072300 3300025321 Bacteria 1535
327 Ga0207656_10091279 3300025321 Bacteria 1383
328 Ga0207692_10003006 3300025898 Bacteria 6536
329 Ga0207692_10040499 3300025898 Bacteria 2299
330 Ga0207692_10086083 3300025898 Bacteria 1692
331 Ga0207692_10106975 3300025898 Bacteria 1545
332 Ga0207642_10167351 3300025899 Unclassified 1186
333 Ga0207680_10112310 3300025903 Unclassified 1769
334 Ga0207647_10006284 3300025904 Bacteria 8650
335 Ga0207685_10006465 3300025905 Bacteria 3193
336 Ga0207685_10013507 3300025905 Bacteria 2528
337 Ga0207685_10020451 3300025905 Unclassified 2200
338 Ga0207699_10011334 3300025906 Bacteria 4498
339 Ga0207699_10015299 3300025906 Unclassified 3981
340 Ga0207699_10089353 3300025906 Bacteria 1931
341 Ga0207699_10117445 3300025906 Bacteria 1715
342 Ga0207699_10213385 3300025906 Bacteria 1314
343 Ga0207699_10471827 3300025906 Unclassified 903
344 Ga0207645_10096239 3300025907 Bacteria 1907
345 Ga0207705_10190255 3300025909 Bacteria 1552
346 Ga0207684_10000973 3300025910 Bacteria 32084
347 Ga0207684_10002906 3300025910 Bacteria 16981
348 Ga0207684_10125543 3300025910 Bacteria 2202
349 Ga0207654_10008704 3300025911 Bacteria 5144
350 Ga0207707_10015200 3300025912 Bacteria 6702
351 Ga0207707_10029186 3300025912 Bacteria 4821
352 Ga0207707_10086116 3300025912 Bacteria 2746
353 Ga0207707_10150117 3300025912 Bacteria 2038
354 Ga0207695_10005455 3300025913 Bacteria 16847
355 Ga0207695_10009167 3300025913 Bacteria 12278
356 Ga0207695_10025939 3300025913 Bacteria 6549
357 Ga0207695_10107005 3300025913 Bacteria 2782
358 Ga0207671_10096036 3300025914 Bacteria 2239
359 Ga0207693_10002464 3300025915 Bacteria 16079
360 Ga0207693_10005557 3300025915 Bacteria 10490
361 Ga0207693_10007800 3300025915 Bacteria 8785
362 Ga0207693_10013939 3300025915 Bacteria 6473
363 Ga0207693_10015230 3300025915 Bacteria 6172
364 Ga0207693_10032918 3300025915 Bacteria 4091
365 Ga0207693_10038900 3300025915 Bacteria 3744
366 Ga0207693_10130900 3300025915 Bacteria 1972
367 Ga0207693_10434100 3300025915 Unclassified 1027
368 Ga0207663_10000965 3300025916 Bacteria 13150
369 Ga0207663_10012760 3300025916 Unclassified 4551
370 Ga0207663_10066743 3300025916 Unclassified 2304
371 Ga0207663_10491865 3300025916 Unclassified 952
372 Ga0207663_10669175 3300025916 Unclassified 820
373 Ga0207660_10267115 3300025917 Bacteria 1354
374 Ga0207657_10001667 3300025919 Bacteria 23967
375 Ga0207657_10010205 3300025919 Bacteria 9383
376 Ga0207649_10065523 3300025920 Bacteria 2300
377 Ga0207649_10088524 3300025920 Bacteria 2022
378 Ga0207652_10083234 3300025921 Unclassified 2801
379 Ga0207652_10123880 3300025921 Bacteria 2301
380 Ga0207652_10263798 3300025921 Unclassified 1554
381 Ga0207652_10311790 3300025921 Unclassified 1420
382 Ga0207646_10006332 3300025922 Bacteria 12262
383 Ga0207646_10007050 3300025922 Bacteria 11497
384 Ga0207646_10045458 3300025922 Bacteria 3942
385 Ga0207646_10105087 3300025922 Bacteria 2532
386 Ga0207646_10171569 3300025922 Bacteria 1959
387 Ga0207646_10332408 3300025922 Unclassified 1373
388 Ga0207681_10303896 3300025923 Unclassified 1263
389 Ga0207694_10063306 3300025924 Bacteria 2881
390 Ga0207694_10092037 3300025924 Bacteria 2393
391 Ga0207650_10672896 3300025925 Bacteria 873
392 Ga0207659_10433059 3300025926 Unclassified 1105
393 Ga0207687_10000141 3300025927 Bacteria 48006
394 Ga0207700_10006490 3300025928 Bacteria 7068
395 Ga0207700_10008629 3300025928 Bacteria 6326
396 Ga0207700_10018967 3300025928 Bacteria 4637
397 Ga0207700_10028873 3300025928 Unclassified 3908
398 Ga0207700_10028932 3300025928 Bacteria 3905
399 Ga0207700_10112223 3300025928 Bacteria 2196
400 Ga0207700_10185866 3300025928 Bacteria 1743
401 Ga0207700_10247750 3300025928 Unclassified 1521
402 Ga0207700_10326187 3300025928 Unclassified 1332
403 Ga0207700_10468180 3300025928 Bacteria 1112
404 Ga0207700_10586354 3300025928 Unclassified 992
405 Ga0207664_10000033 3300025929 Bacteria 176549
406 Ga0207664_10050872 3300025929 Bacteria 3269
407 Ga0207664_10136687 3300025929 Bacteria 2069
408 Ga0207664_10142917 3300025929 Unclassified 2026
409 Ga0207664_10159823 3300025929 Bacteria 1921
410 Ga0207664_10388694 3300025929 Unclassified 1239
411 Ga0207664_10466259 3300025929 Bacteria 1129
412 Ga0207664_10646445 3300025929 Bacteria 950
413 Ga0207664_10740070 3300025929 Bacteria 884
414 Ga0207644_10017386 3300025931 Unclassified 4855
415 Ga0207644_10127442 3300025931 Bacteria 1944
416 Ga0207644_10175159 3300025931 Bacteria 1678
417 Ga0207690_10006731 3300025932 Bacteria 6811
418 Ga0207690_10118299 3300025932 Unclassified 1920
419 Ga0207706_10009258 3300025933 Bacteria 9050
420 Ga0207706_10016470 3300025933 Bacteria 6671
421 Ga0207686_10624807 3300025934 Unclassified 850
422 Ga0207709_10354244 3300025935 Unclassified 1109
423 Ga0207704_10069593 3300025938 Bacteria 2224
424 Ga0207704_10109315 3300025938 Unclassified 1864
425 Ga0207665_10000596 3300025939 Bacteria 24294
426 Ga0207665_10008819 3300025939 Bacteria 6629
427 Ga0207665_10014915 3300025939 Bacteria 5105
428 Ga0207665_10021588 3300025939 Unclassified 4235
429 Ga0207665_10052040 3300025939 Bacteria 2758
430 Ga0207665_10084007 3300025939 Unclassified 2197
431 Ga0207665_10095860 3300025939 Unclassified 2063
432 Ga0207665_10184528 3300025939 Bacteria 1512
433 Ga0207665_10315896 3300025939 Bacteria 1171
434 Ga0207711_10062942 3300025941 Bacteria 3202
435 Ga0207711_10779816 3300025941 Bacteria 890
436 Ga0207689_10095246 3300025942 Bacteria 2445
437 Ga0207661_10001952 3300025944 Bacteria 14178
438 Ga0207661_10005239 3300025944 Bacteria 9117
439 Ga0207661_10147408 3300025944 Bacteria 2032
440 Ga0207661_10430664 3300025944 Unclassified 1199
441 Ga0207679_10011893 3300025945 Bacteria 5657
442 Ga0207679_10191162 3300025945 Bacteria 1702
443 Ga0207667_10001192 3300025949 Bacteria 32605
444 Ga0207667_10001239 3300025949 Bacteria 32026
445 Ga0207667_10187553 3300025949 Bacteria 2123
446 Ga0207667_10210046 3300025949 Bacteria 1995
447 Ga0207667_10219774 3300025949 Bacteria 1947
448 Ga0207667_10262487 3300025949 Bacteria 1766
449 Ga0207640_10000057 3300025981 Bacteria 93580
450 Ga0207640_10000158 3300025981 Bacteria 49097
451 Ga0207640_10004462 3300025981 Bacteria 7584
452 Ga0207640_10068667 3300025981 Bacteria 2376
453 Ga0207658_10009142 3300025986 Bacteria 6722
454 Ga0207677_10068958 3300026023 Bacteria 2485
455 Ga0207703_10110369 3300026035 Unclassified 2346
456 Ga0207639_10000016 3300026041 Bacteria 262939
457 Ga0207639_10225636 3300026041 Unclassified 1621
458 Ga0207678_10000903 3300026067 Bacteria 27239
459 Ga0207678_10081936 3300026067 Unclassified 2761
460 Ga0207678_10221465 3300026067 Unclassified 1620
461 Ga0207702_10001513 3300026078 Bacteria 22979
462 Ga0207702_10002159 3300026078 Bacteria 18888
463 Ga0207702_10016811 3300026078 Bacteria 6055
464 Ga0207702_10172398 3300026078 Bacteria 1985
465 Ga0207702_10224439 3300026078 Unclassified 1752
466 Ga0207702_10306028 3300026078 Unclassified 1510
467 Ga0207702_10384566 3300026078 Unclassified 1350
468 Ga0207641_10088629 3300026088 Bacteria 2702
469 Ga0207641_10176111 3300026088 Bacteria 1956
470 Ga0207641_10382407 3300026088 Bacteria 1348
471 Ga0207641_11084520 3300026088 Unclassified 799
472 Ga0207648_10005015 3300026089 Bacteria 13446
473 Ga0207648_10010627 3300026089 Bacteria 8702
474 Ga0207674_10044672 3300026116 Bacteria 4563
475 Ga0207674_10047118 3300026116 Unclassified 4422
476 Ga0207683_10015510 3300026121 Bacteria 6487
477 Ga0207698_10053084 3300026142 Unclassified 3109
478 Ga0207698_10517645 3300026142 Bacteria 1164
479 Ga0209588_1000006 3300027671 Bacteria 184445
480 Ga0209588_1009128 3300027671 Unclassified 2957
481 Ga0209588_1010182 3300027671 Bacteria 2823
482 Ga0268266_10007114 3300028379 Bacteria 10150
483 Ga0268266_10120259 3300028379 Unclassified 2337
484 Ga0268265_10918769 3300028380 Unclassified 860
485 Ga0268264_10010932 3300028381 Bacteria 7498
486 Ga0265762_1004191 3300030760 Bacteria 2584
487 Ga0265762_1016240 3300030760 Bacteria 1350
488 Ga0265763_1009638 3300030763 Bacteria 881
489 Ga0265770_1013007 3300030878 Unclassified 1239
490 Ga0265760_10004082 3300031090 Unclassified 4207
491 Ga0265760_10005650 3300031090 Bacteria 3579
492 Ga0265760_10010730 3300031090 Bacteria 2617
493 Ga0265760_10015676 3300031090 Bacteria 2174
494 Ga0265760_10042346 3300031090 Bacteria 1359
495 Ga0265760_10094101 3300031090 Unclassified 941
496 Ga0265760_10132109 3300031090 Bacteria 808
497 Ga0373926_0000619 3300035083 Bacteria 9661
498 Ga0373926_0001291 3300035083 Bacteria 7536
499 Ga0373926_0017249 3300035083 Unclassified 2477
500 Ga0373934_0000830 3300035086 Bacteria 11167
501 Ga0373934_0036650 3300035086 Bacteria 1932
502 Ga0373944_0043642 3300035089 Unclassified 1394
503 Ga0373923_0077297 3300035111 Bacteria 1439
504 Ga0373936_0009809 3300035113 Bacteria 3614
505 Ga0373953_0004359 3300035117 Unclassified 4506
506 Ga0373954_0000402 3300035118 Bacteria 16198
507 Ga0373954_0011555 3300035118 Bacteria 3915
508 Ga0373954_0163616 3300035118 Bacteria 1089
509 Ga0373956_0035799 3300035119 Unclassified 2190
510 Ga0373956_0047938 3300035119 Bacteria 1912
511 Ga0373957_0055850 3300035120 Unclassified 1519
512 Ga0373943_0000093 3300035170 Bacteria 32989
513 Ga0373943_0065347 3300035170 Bacteria 1829
514 Ga0373943_0078696 3300035170 Bacteria 1686
515 Ga0373946_0001175 3300035171 Bacteria 9070
516 Ga0373946_0040162 3300035171 Bacteria 1913
517 Ga0373946_0218051 3300035171 Bacteria 920
518 Ga0373955_0013271 3300035172 Bacteria 3979
519 Ga0373955_0142455 3300035172 Unclassified 1406
520 Ga0373942_0034388 3300035207 Unclassified 1356
521 Ga0373924_0023109 3300035410 Unclassified 2435
522 Ga0373931_0011405 3300035691 Unclassified 4294
523 Ga0373935_0000406 3300035692 Bacteria 22423
524 Ga0373935_0045385 3300035692 Bacteria 2773
525 Ga0373927_0000351 3300035695 Bacteria 36072
526 Ga0373927_0005076 3300035695 Bacteria 9107
527 Ga0373927_0009237 3300035695 Bacteria 6613
528 Ga0373927_0038721 3300035695 Bacteria 3095
529 Ga0373927_0057875 3300035695 Bacteria 2506
530 Ga0373927_0067963 3300035695 Bacteria 2306
531 Ga0373933_0000375 3300035724 Bacteria 28675
532 Ga0373933_0010901 3300035724 Bacteria 4991
533 Ga0373947_0003946 3300035725 Bacteria 8720
534 Ga0373947_0015910 3300035725 Bacteria 4321
535 Ga0373947_0022859 3300035725 Unclassified 3629
536 Ga0373947_0135446 3300035725 Bacteria 1575
537 Ga0373937_0000082 3300036401 Bacteria 87971
538 Ga0373937_0003011 3300036401 Bacteria 14130
539 Ga0373937_0009898 3300036401 Bacteria 8312
540 Ga0373937_0044675 3300036401 Bacteria 4047
541 Ga0373937_0078351 3300036401 Bacteria 3054
542 Ga0373937_0258866 3300036401 Bacteria 1641
543 Ga0373925_0001716 3300037068 Bacteria 18475
544 Ga0373925_0007208 3300037068 Bacteria 8128
545 Ga0373925_0007869 3300037068 Bacteria 7763
546 Ga0373925_0023003 3300037068 Bacteria 4548
547 Ga0373925_0517547 3300037068 Unclassified 980
548 Ga0395900_0173907 3300037418 Unclassified 2191
549 Ga0395898_0247788 3300037466 Unclassified 1699
550 Ga0436364_0042355 3300037853 Unclassified 4466
551 Ga0436364_0524449 3300037853 Unclassified 3644
552 Ga0436364_0868968 3300037853 Bacteria 1365
553 Ga0436364_1479972 3300037853 Bacteria 8306
554 Ga0395901_0069456 3300038443 Bacteria 3669
555 Ga0395901_0667415 3300038443 Unclassified 1041
556 Ga0242420_030418 3300038996 Bacteria 1000
557 Ga0436365_0031849 3300039437 Bacteria 47942
558 Ga0436365_1035977 3300039437 Bacteria 3956
559 Ga0436365_1116478 3300039437 Bacteria 7415
560 Ga0436360_0680576 3300039438 Bacteria 8776
561 Ga0436360_1228382 3300039438 Bacteria 4781
562 Ga0436361_0091471 3300039447 Bacteria 5518
563 Ga0436361_0169123 3300039447 Bacteria 4146
564 Ga0436361_0400616 3300039447 Bacteria 83329
565 Ga0436361_0502041 3300039447 Unclassified 990
566 Ga0436361_0672781 3300039447 Unclassified 3722
567 Ga0436361_0705926 3300039447 Bacteria 3484
568 Ga0436361_0775789 3300039447 Unclassified 2270
569 Ga0436361_0797421 3300039447 Bacteria 2176
570 Ga0436361_0875242 3300039447 Unclassified 1180
571 Ga0436363_0436454 3300039450 Bacteria 3703
572 Ga0436363_0493680 3300039450 Unclassified 3630
573 Ga0436363_0875210 3300039450 Bacteria 2001
574 Ga0436363_1630748 3300039450 Unclassified 1229
575 Ga0436362_0092701 3300039453 Bacteria 1580
576 Ga0436362_0405422 3300039453 Bacteria 2604
577 Ga0436362_0539068 3300039453 Bacteria 6207
578 Ga0451577_0081585 3300042876 Bacteria 2885
579 Ga0451577_0330959 3300042876 Bacteria 1381
580 Ga0453683_0218324 3300044673 Unclassified 1212
581 Ga0466964_0211108 3300044706 Unclassified 937
582 Ga0453684_0062176 3300044712 Bacteria 4785
583 Ga0453684_0285831 3300044712 Bacteria 1879
584 Ga0453684_0864965 3300044712 Bacteria 971
585 Ga0451576_0112174 3300045051 Bacteria 2838
586 Ga0451576_0413200 3300045051 Unclassified 1415
587 Ga0451576_0591900 3300045051 Unclassified 1166
588 Ga0451576_0631099 3300045051 Unclassified 1126
589 Ga0466967_0009451 3300045976 Bacteria 7233
590 Ga0466967_0127475 3300045976 Bacteria 2359
591 Ga0466967_0715932 3300045976 Unclassified 992
592 Ga0495592_0046432 3300046454 Bacteria 3238
593 Ga0495629_0054939 3300046459 Bacteria 2785
594 Ga0495651_0239363 3300046462 Unclassified 1246
595 Ga0495653_0044063 3300046463 Bacteria 3465
596 Ga0495580_0004001 3300046472 Bacteria 12437
597 Ga0495580_0006097 3300046472 Bacteria 9858
598 Ga0495580_0051162 3300046472 Bacteria 2921
599 Ga0495580_0085653 3300046472 Unclassified 2195
600 Ga0495582_0010407 3300046473 Bacteria 5116
601 Ga0495582_0024529 3300046473 Bacteria 3300
602 Ga0495639_0037357 3300046475 Bacteria 2176
603 Ga0495664_0064965 3300046477 Unclassified 2175
604 Ga0495664_0068823 3300046477 Unclassified 2113
605 Ga0495594_0041072 3300046499 Bacteria 2533
606 Ga0495608_0015490 3300046511 Bacteria 5288
607 Ga0495628_0161288 3300046516 Bacteria 1704
608 Ga0495630_0005548 3300046517 Bacteria 8904
609 Ga0495630_0046166 3300046517 Bacteria 3256
610 Ga0495630_0269710 3300046517 Bacteria 1300
611 Ga0495666_0038176 3300046526 Bacteria 2336
612 Ga0495666_0102548 3300046526 Bacteria 1348
613 Ga0495652_0293184 3300046529 Unclassified 1186
614 Ga0495665_0005685 3300046531 Bacteria 6729
615 Ga0495665_0010204 3300046531 Bacteria 5089
616 Ga0495665_0043956 3300046531 Unclassified 2375
617 Ga0495640_0010896 3300046533 Bacteria 7008
618 Ga0495586_0055264 3300046535 Bacteria 2151
619 Ga0495587_0003381 3300046536 Bacteria 10641
620 Ga0495587_0219283 3300046536 Bacteria 1073
621 Ga0495645_0081315 3300046543 Unclassified 2324
622 Ga0495622_0169289 3300046557 Unclassified 983
623 Ga0495667_0040669 3300046559 Unclassified 3086
624 Ga0495635_0042731 3300046663 Unclassified 3129
625 Ga0495635_0080644 3300046663 Bacteria 2227
626 Ga0495623_0106551 3300046679 Unclassified 1703
627 Ga0495623_0256534 3300046679 Bacteria 981
628 Ga0495647_0004251 3300046681 Bacteria 4638
629 Ga0495658_0008227 3300046683 Bacteria 5167
630 Ga0495613_0068203 3300046689 Bacteria 2594
631 Ga0495624_0044011 3300046690 Unclassified 2847
632 Ga0495670_0174275 3300046691 Bacteria 1134
633 Ga0495604_0000235 3300047317 Bacteria 49754
634 Ga0495674_0031040 3300047319 Bacteria 4856
635 Ga0495674_0060600 3300047319 Bacteria 3301
636 Ga0495674_0092937 3300047319 Bacteria 2575
637 Ga0495674_0099208 3300047319 Bacteria 2480
638 Ga0495676_0024901 3300047321 Bacteria 5172
639 Ga0495676_0138852 3300047321 Bacteria 1744
640 Ga0495676_0146067 3300047321 Bacteria 1689
641 Ga0495675_0168846 3300047444 Bacteria 1344
642 Ga0495684_0023950 3300047471 Unclassified 4695
643 Ga0495684_0082815 3300047471 Bacteria 2434
644 Ga0495602_0055071 3300048088 Unclassified 3505
645 Ga0495614_0026234 3300048089 Bacteria 2511
646 Ga0496100_0018636 3300048903 Unclassified 4122
647 Ga0496100_0395855 3300048903 Unclassified 1051
648 Ga0496100_0599525 3300048903 Unclassified 855
649 Ga0496101_0024720 3300048904 Bacteria 4161
650 Ga0496101_0081636 3300048904 Unclassified 2392
651 Ga0496101_0120502 3300048904 Bacteria 1983
652 Ga0496102_0003254 3300048905 Bacteria 13781
653 Ga0496102_0073061 3300048905 Unclassified 3153
654 Ga0496103_0027212 3300048906 Bacteria 3463
655 Ga0496103_0046043 3300048906 Bacteria 2692
656 Ga0496104_0021762 3300048907 Bacteria 5889
657 Ga0496105_0040427 3300048908 Bacteria 3845
658 Ga0496105_0722410 3300048908 Bacteria 763
659 Ga0496106_0354205 3300048909 Unclassified 1179
660 Ga0496108_0169891 3300048911 Bacteria 1886
661 Ga0496109_0038109 3300048912 Bacteria 4345
662 Ga0496109_0153116 3300048912 Bacteria 2159
663 Ga0496111_0051037 3300048914 Bacteria 2986
664 Ga0496112_0001829 3300048915 Bacteria 16733
665 Ga0496112_0021016 3300048915 Bacteria 6200
666 Ga0496112_0096825 3300048915 Bacteria 2921
667 Ga0496112_0109408 3300048915 Unclassified 2733
668 Ga0496112_0317599 3300048915 Bacteria 1502
669 Ga0496115_0042209 3300048918 Bacteria 3633
670 Ga0496115_0482676 3300048918 Unclassified 998
671 nmdc:mga05p37_42655_c1 3300050507 Bacteria 5576
672 nmdc:mga06r32_214002_c1 3300050510 Unclassified 1915
673 nmdc:mga08y16_384683_c1 3300050511 Bacteria 1438
674 nmdc:mga0n895_119480_c1 3300050512 Bacteria 2656
675 nmdc:mga0n895_129088_c1 3300050512 Bacteria 2552
676 nmdc:mga0n895_17170_c1 3300050512 Bacteria 6668
677 nmdc:mga0n895_4333_c1 3300050512 Bacteria 11630
678 nmdc:mga0n895_449647_c1 3300050512 Bacteria 1301
679 nmdc:mga0n895_6406_c1 3300050512 Bacteria 9987
680 nmdc:mga0n895_679426_c1 3300050512 Unclassified 1027
681 nmdc:mga0n895_696767_c1 3300050512 Unclassified 1012
682 nmdc:mga0rr50_140_c1 3300050513 Bacteria 39942
683 nmdc:mga0rr50_165242_c1 3300050513 Bacteria 1799
684 nmdc:mga0rr50_172327_c1 3300050513 Unclassified 1764
685 nmdc:mga0rr50_19118_c1 3300050513 Bacteria 4617
686 nmdc:mga0rr50_26280_c1 3300050513 Bacteria 4059
687 nmdc:mga0rr50_37308_c1 3300050513 Bacteria 3507
688 nmdc:mga0rr50_65554_c1 3300050513 Unclassified 2751
689 nmdc:mga0rr50_707053_c1 3300050513 Unclassified 860
690 nmdc:mga0rr50_74004_c1 3300050513 Unclassified 2606
691 nmdc:mga08x19_115419_c1 3300050514 Bacteria 1795
692 nmdc:mga08x19_11550_c1 3300050514 Bacteria 5315
693 nmdc:mga08x19_14044_c1 3300050514 Unclassified 4852
694 nmdc:mga08x19_171535_c1 3300050514 Bacteria 1478
695 nmdc:mga08x19_177582_c1 3300050514 Unclassified 1453
696 nmdc:mga08x19_22938_c1 3300050514 Bacteria 3870
697 nmdc:mga08x19_243722_c1 3300050514 Bacteria 1240
698 nmdc:mga08x19_43093_c1 3300050514 Bacteria 2879
699 nmdc:mga08x19_591227_c1 3300050514 Bacteria 786
700 nmdc:mga08x19_87945_c1 3300050514 Unclassified 2047
701 nmdc:mga0a205_40577_c1 3300050515 Bacteria 4481
702 nmdc:mga0a205_449_c1 3300050515 Bacteria 31835

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10517645 Ga0207698_105176453 202
2 3300025928 Ga0207700_10008629 Ga0207700_100086293 213
3 3300005436 Ga0070713_100050310 Ga0070713_1000503102 215
4 3300046477 Ga0495664_0064965 Ga0495664_0064965_908_1705 215
5 3300046543 Ga0495645_0081315 Ga0495645_0081315_717_1514 215
6 3300013297 Ga0157378_10003381 Ga0157378_100033817 217
7 3300013308 Ga0157375_10813244 Ga0157375_108132441 217
8 3300005445 Ga0070708_100182492 Ga0070708_1001824923 221
9 3300021388 Ga0213875_10009771 Ga0213875_100097713 221
10 3300025911 Ga0207654_10008704 Ga0207654_100087042 222
11 3300005614 Ga0068856_100001532 Ga0068856_10000153221 223
12 3300026078 Ga0207702_10001513 Ga0207702_1000151316 224
13 3300037068 Ga0373925_0023003 Ga0373925_0023003_1807_2481 224
14 3300005435 Ga0070714_100123982 Ga0070714_1001239822 225
15 3300005563 Ga0068855_100596962 Ga0068855_1005969622 225
16 3300006237 Ga0097621_100420697 Ga0097621_1004206972 225
17 3300009174 Ga0105241_10039967 Ga0105241_100399673 225
18 3300009545 Ga0105237_10014906 Ga0105237_100149062 225
19 3300013100 Ga0157373_10007167 Ga0157373_100071679 225
20 3300013105 Ga0157369_10119097 Ga0157369_101190973 225
21 3300013296 Ga0157374_10731504 Ga0157374_107315041 225
22 3300013307 Ga0157372_10000992 Ga0157372_1000099223 225
23 3300025910 Ga0207684_10125543 Ga0207684_101255432 225
24 3300025929 Ga0207664_10159823 Ga0207664_101598232 225
25 3300048915 Ga0496112_0109408 Ga0496112_0109408_835_1527 225
26 3300050514 nmdc:mga08x19_591227_c1 nmdc:mga08x19_591227_c1_25_753 225
27 3300009093 Ga0105240_10038089 Ga0105240_100380893 226
28 3300009174 Ga0105241_10328312 Ga0105241_103283122 226
29 3300009545 Ga0105237_10340471 Ga0105237_103404712 226
30 3300013105 Ga0157369_10155259 Ga0157369_101552593 226
31 3300025910 Ga0207684_10000973 Ga0207684_1000097313 226
32 3300025922 Ga0207646_10006332 Ga0207646_1000633213 226
33 3300025928 Ga0207700_10018967 Ga0207700_100189675 226
34 3300035170 Ga0373943_0065347 Ga0373943_0065347_1022_1702 226
35 3300035692 Ga0373935_0045385 Ga0373935_0045385_1129_1809 226
36 3300035695 Ga0373927_0067963 Ga0373927_0067963_1069_1749 226
37 3300035725 Ga0373947_0015910 Ga0373947_0015910_975_1655 226
38 3300037068 Ga0373925_0007869 Ga0373925_0007869_5033_5713 226
39 3300037853 Ga0436364_0868968 Ga0436364_0868968_134_814 226
40 3300046472 Ga0495580_0004001 Ga0495580_0004001_4238_4918 226
41 3300046473 Ga0495582_0024529 Ga0495582_0024529_948_1628 226
42 3300046531 Ga0495665_0010204 Ga0495665_0010204_2631_3311 226
43 3300050512 nmdc:mga0n895_119480_c1 nmdc:mga0n895_119480_c1_959_1639 226
44 3300050513 nmdc:mga0rr50_37308_c1 nmdc:mga0rr50_37308_c1_217_897 226
45 3300050514 nmdc:mga08x19_171535_c1 nmdc:mga08x19_171535_c1_716_1396 226
46 3300005530 Ga0070679_100497605 Ga0070679_1004976052 227
47 3300006358 Ga0068871_100145113 Ga0068871_1001451133 227
48 3300025916 Ga0207663_10066743 Ga0207663_100667433 227
49 3300026078 Ga0207702_10016811 Ga0207702_100168113 227
50 3300037068 Ga0373925_0517547 Ga0373925_0517547_100_873 227
51 3300050511 nmdc:mga08y16_384683_c1 nmdc:mga08y16_384683_c1_179_865 227
52 3300005435 Ga0070714_100040186 Ga0070714_1000401863 228
53 3300005436 Ga0070713_100338960 Ga0070713_1003389602 228
54 3300005458 Ga0070681_10023043 Ga0070681_100230435 228
55 3300005530 Ga0070679_100131331 Ga0070679_1001313313 228
56 3300005563 Ga0068855_100551094 Ga0068855_1005510942 228
57 3300005614 Ga0068856_100275654 Ga0068856_1002756542 228
58 3300006028 Ga0070717_10080035 Ga0070717_100800352 228
59 3300006175 Ga0070712_100033247 Ga0070712_1000332473 228
60 3300006914 Ga0075436_100008969 Ga0075436_1000089695 228
61 3300009177 Ga0105248_10399384 Ga0105248_103993842 228
62 3300025898 Ga0207692_10040499 Ga0207692_100404993 228
63 3300025912 Ga0207707_10086116 Ga0207707_100861163 228
64 3300025913 Ga0207695_10107005 Ga0207695_101070053 228
65 3300025915 Ga0207693_10013939 Ga0207693_100139395 228
66 3300025921 Ga0207652_10311790 Ga0207652_103117902 228
67 3300039447 Ga0436361_0502041 Ga0436361_0502041_99_806 228
68 3300045976 Ga0466967_0715932 Ga0466967_0715932_99_824 228
69 3300048915 Ga0496112_0096825 Ga0496112_0096825_228_914 228
70 3300005336 Ga0070680_100157142 Ga0070680_1001571422 229
71 3300005437 Ga0070710_10000598 Ga0070710_1000059811 229
72 3300025898 Ga0207692_10003006 Ga0207692_100030064 229
73 3300005518 Ga0070699_100014701 Ga0070699_1000147017 230
74 3300005518 Ga0070699_100383218 Ga0070699_1003832182 230
75 3300005536 Ga0070697_100026945 Ga0070697_1000269454 230
76 3300006163 Ga0070715_10006010 Ga0070715_100060103 230
77 3300006173 Ga0070716_100020719 Ga0070716_1000207194 230
78 3300006173 Ga0070716_100060291 Ga0070716_1000602913 230
79 3300025905 Ga0207685_10013507 Ga0207685_100135073 230
80 3300025922 Ga0207646_10045458 Ga0207646_100454583 230
81 3300025939 Ga0207665_10052040 Ga0207665_100520402 230
82 3300030878 Ga0265770_1013007 Ga0265770_10130072 230
83 3300038996 Ga0242420_030418 Ga0242420_030418_58_753 230
84 3300050513 nmdc:mga0rr50_165242_c1 nmdc:mga0rr50_165242_c1_827_1573 230
85 3300005445 Ga0070708_100015426 Ga0070708_1000154262 231
86 3300005458 Ga0070681_10050013 Ga0070681_100500134 231
87 3300007265 Ga0099794_10000033 Ga0099794_100000334 231
88 3300025921 Ga0207652_10083234 Ga0207652_100832344 231
89 3300027671 Ga0209588_1000006 Ga0209588_100000639 231
90 3300039453 Ga0436362_0092701 Ga0436362_0092701_76_783 231
91 3300047319 Ga0495674_0099208 Ga0495674_0099208_761_1486 231
92 3300005434 Ga0070709_10099697 Ga0070709_100996972 232
93 3300005436 Ga0070713_100037457 Ga0070713_1000374572 232
94 3300005437 Ga0070710_10086096 Ga0070710_100860962 232
95 3300005439 Ga0070711_100000159 Ga0070711_10000015922 232
96 3300005439 Ga0070711_100004814 Ga0070711_1000048144 232
97 3300006028 Ga0070717_10002444 Ga0070717_100024446 232
98 3300006175 Ga0070712_100006375 Ga0070712_1000063754 232
99 3300013296 Ga0157374_10136988 Ga0157374_101369882 232
100 3300013297 Ga0157378_10038080 Ga0157378_100380805 232
101 3300025906 Ga0207699_10089353 Ga0207699_100893532 232
102 3300025915 Ga0207693_10002464 Ga0207693_100024643 232
103 3300025915 Ga0207693_10005557 Ga0207693_100055578 232
104 3300025916 Ga0207663_10000965 Ga0207663_100009655 232
105 3300025916 Ga0207663_10012760 Ga0207663_100127602 232
106 3300025928 Ga0207700_10006490 Ga0207700_100064906 232
107 3300031090 Ga0265760_10004082 Ga0265760_100040821 232
108 3300035691 Ga0373931_0011405 Ga0373931_0011405_2047_2745 232
109 3300039437 Ga0436365_1035977 Ga0436365_1035977_981_1688 232
110 3300039450 Ga0436363_0875210 Ga0436363_0875210_1049_1750 232
111 3300039453 Ga0436362_0539068 Ga0436362_0539068_5420_6127 232
112 3300046559 Ga0495667_0040669 Ga0495667_0040669_2278_2976 232
113 3300005355 Ga0070671_100499019 Ga0070671_1004990191 233
114 3300005435 Ga0070714_100040692 Ga0070714_1000406928 233
115 3300005435 Ga0070714_100179564 Ga0070714_1001795641 233
116 3300005436 Ga0070713_100126421 Ga0070713_1001264212 233
117 3300005437 Ga0070710_10030372 Ga0070710_100303721 233
118 3300005445 Ga0070708_100134488 Ga0070708_1001344882 233
119 3300005518 Ga0070699_100092300 Ga0070699_1000923003 233
120 3300005536 Ga0070697_100263634 Ga0070697_1002636342 233
121 3300005548 Ga0070665_100128605 Ga0070665_1001286053 233
122 3300005617 Ga0068859_100069216 Ga0068859_1000692162 233
123 3300006028 Ga0070717_10188568 Ga0070717_101885683 233
124 3300006358 Ga0068871_100170052 Ga0068871_1001700522 233
125 3300006852 Ga0075433_10008310 Ga0075433_100083107 233
126 3300006871 Ga0075434_100000235 Ga0075434_10000023520 233
127 3300006914 Ga0075436_100163182 Ga0075436_1001631822 233
128 3300006931 Ga0097620_100069219 Ga0097620_1000692192 233
129 3300007076 Ga0075435_100003821 Ga0075435_1000038213 233
130 3300009093 Ga0105240_10042413 Ga0105240_100424134 233
131 3300009147 Ga0114129_10599373 Ga0114129_105993732 233
132 3300009176 Ga0105242_10143932 Ga0105242_101439322 233
133 3300009177 Ga0105248_10044402 Ga0105248_100444022 233
134 3300009177 Ga0105248_10957926 Ga0105248_109579261 233
135 3300009553 Ga0105249_10017407 Ga0105249_100174071 233
136 3300010159 Ga0099796_10045110 Ga0099796_100451102 233
137 3300013104 Ga0157370_10581091 Ga0157370_105810912 233
138 3300013296 Ga0157374_10009849 Ga0157374_100098498 233
139 3300013297 Ga0157378_10011452 Ga0157378_100114524 233
140 3300013306 Ga0163162_10008783 Ga0163162_100087836 233
141 3300013308 Ga0157375_10024068 Ga0157375_100240681 233
142 3300013308 Ga0157375_10117717 Ga0157375_101177173 233
143 3300014325 Ga0163163_10018345 Ga0163163_100183457 233
144 3300014325 Ga0163163_10064958 Ga0163163_100649584 233
145 3300014325 Ga0163163_10186746 Ga0163163_101867462 233
146 3300014969 Ga0157376_10002140 Ga0157376_100021407 233
147 3300014969 Ga0157376_10088787 Ga0157376_100887873 233
148 3300025915 Ga0207693_10038900 Ga0207693_100389002 233
149 3300025922 Ga0207646_10332408 Ga0207646_103324082 233
150 3300025928 Ga0207700_10326187 Ga0207700_103261872 233
151 3300025929 Ga0207664_10136687 Ga0207664_101366872 233
152 3300031090 Ga0265760_10005650 Ga0265760_100056503 233
153 3300031090 Ga0265760_10042346 Ga0265760_100423461 233
154 3300035083 Ga0373926_0017249 Ga0373926_0017249_514_1218 233
155 3300035086 Ga0373934_0000830 Ga0373934_0000830_7937_8638 233
156 3300035117 Ga0373953_0004359 Ga0373953_0004359_2491_3192 233
157 3300035118 Ga0373954_0000402 Ga0373954_0000402_7467_8168 233
158 3300035118 Ga0373954_0163616 Ga0373954_0163616_206_907 233
159 3300035119 Ga0373956_0035799 Ga0373956_0035799_395_1096 233
160 3300035119 Ga0373956_0047938 Ga0373956_0047938_192_893 233
161 3300035120 Ga0373957_0055850 Ga0373957_0055850_376_1077 233
162 3300035171 Ga0373946_0040162 Ga0373946_0040162_759_1460 233
163 3300035172 Ga0373955_0142455 Ga0373955_0142455_296_997 233
164 3300035207 Ga0373942_0034388 Ga0373942_0034388_229_930 233
165 3300035410 Ga0373924_0023109 Ga0373924_0023109_816_1517 233
166 3300035695 Ga0373927_0009237 Ga0373927_0009237_2826_3530 233
167 3300035724 Ga0373933_0000375 Ga0373933_0000375_1536_2237 233
168 3300035724 Ga0373933_0010901 Ga0373933_0010901_1240_1941 233
169 3300036401 Ga0373937_0000082 Ga0373937_0000082_42176_42877 233
170 3300036401 Ga0373937_0003011 Ga0373937_0003011_13019_13720 233
171 3300036401 Ga0373937_0009898 Ga0373937_0009898_5266_5967 233
172 3300036401 Ga0373937_0078351 Ga0373937_0078351_699_1400 233
173 3300039447 Ga0436361_0169123 Ga0436361_0169123_1962_2663 233
174 3300039447 Ga0436361_0775789 Ga0436361_0775789_924_1625 233
175 3300039447 Ga0436361_0875242 Ga0436361_0875242_244_945 233
176 3300039450 Ga0436363_1630748 Ga0436363_1630748_455_1156 233
177 3300044706 Ga0466964_0211108 Ga0466964_0211108_164_865 233
178 3300045051 Ga0451576_0112174 Ga0451576_0112174_350_1051 233
179 3300045051 Ga0451576_0591900 Ga0451576_0591900_240_950 233
180 3300045976 Ga0466967_0009451 Ga0466967_0009451_3059_3766 233
181 3300045976 Ga0466967_0127475 Ga0466967_0127475_300_1001 233
182 3300046454 Ga0495592_0046432 Ga0495592_0046432_2082_2783 233
183 3300046462 Ga0495651_0239363 Ga0495651_0239363_227_928 233
184 3300046472 Ga0495580_0006097 Ga0495580_0006097_5320_6030 233
185 3300046472 Ga0495580_0051162 Ga0495580_0051162_755_1456 233
186 3300046499 Ga0495594_0041072 Ga0495594_0041072_1434_2135 233
187 3300046511 Ga0495608_0015490 Ga0495608_0015490_2311_3012 233
188 3300046529 Ga0495652_0293184 Ga0495652_0293184_169_870 233
189 3300046531 Ga0495665_0043956 Ga0495665_0043956_148_849 233
190 3300046536 Ga0495587_0003381 Ga0495587_0003381_7517_8218 233
191 3300046536 Ga0495587_0219283 Ga0495587_0219283_106_879 233
192 3300046663 Ga0495635_0042731 Ga0495635_0042731_1930_2631 233
193 3300046679 Ga0495623_0256534 Ga0495623_0256534_135_836 233
194 3300046691 Ga0495670_0174275 Ga0495670_0174275_184_885 233
195 3300047317 Ga0495604_0000235 Ga0495604_0000235_7188_7889 233
196 3300047471 Ga0495684_0023950 Ga0495684_0023950_1276_1977 233
197 3300048088 Ga0495602_0055071 Ga0495602_0055071_854_1555 233
198 3300048903 Ga0496100_0599525 Ga0496100_0599525_112_813 233
199 3300048904 Ga0496101_0081636 Ga0496101_0081636_1555_2256 233
200 3300048905 Ga0496102_0003254 Ga0496102_0003254_7993_8694 233
201 3300048905 Ga0496102_0073061 Ga0496102_0073061_788_1489 233
202 3300048907 Ga0496104_0021762 Ga0496104_0021762_2305_3006 233
203 3300048908 Ga0496105_0722410 Ga0496105_0722410_35_736 233
204 3300048909 Ga0496106_0354205 Ga0496106_0354205_355_1056 233
205 3300048912 Ga0496109_0038109 Ga0496109_0038109_1202_1903 233
206 3300048915 Ga0496112_0001829 Ga0496112_0001829_15849_16550 233
207 3300048918 Ga0496115_0482676 Ga0496115_0482676_56_757 233
208 3300050512 nmdc:mga0n895_17170_c1 nmdc:mga0n895_17170_c1_4656_5357 233
209 3300050512 nmdc:mga0n895_696767_c1 nmdc:mga0n895_696767_c1_70_777 233
210 3300050513 nmdc:mga0rr50_19118_c1 nmdc:mga0rr50_19118_c1_2958_3659 233
211 3300050514 nmdc:mga08x19_115419_c1 nmdc:mga08x19_115419_c1_812_1522 233
212 3300050514 nmdc:mga08x19_22938_c1 nmdc:mga08x19_22938_c1_3075_3776 233
213 3300050515 nmdc:mga0a205_449_c1 nmdc:mga0a205_449_c1_25029_25730 233
214 3300000546 LJNas_1009783 LJNas_10097831 234
215 3300005329 Ga0070683_100194454 Ga0070683_1001944542 234
216 3300005334 Ga0068869_100131910 Ga0068869_1001319103 234
217 3300005434 Ga0070709_10101062 Ga0070709_101010622 234
218 3300005435 Ga0070714_100016881 Ga0070714_1000168814 234
219 3300005467 Ga0070706_100002718 Ga0070706_1000027182 234
220 3300005468 Ga0070707_100043153 Ga0070707_1000431532 234
221 3300005468 Ga0070707_100511377 Ga0070707_1005113772 234
222 3300005536 Ga0070697_100000326 Ga0070697_10000032632 234
223 3300005536 Ga0070697_100169918 Ga0070697_1001699184 234
224 3300006028 Ga0070717_10001232 Ga0070717_100012323 234
225 3300006028 Ga0070717_10091757 Ga0070717_100917573 234
226 3300006173 Ga0070716_100069700 Ga0070716_1000697003 234
227 3300006852 Ga0075433_10004547 Ga0075433_100045476 234
228 3300006852 Ga0075433_10498326 Ga0075433_104983262 234
229 3300006871 Ga0075434_100033552 Ga0075434_1000335526 234
230 3300007076 Ga0075435_100091169 Ga0075435_1000911693 234
231 3300007076 Ga0075435_100185332 Ga0075435_1001853322 234
232 3300009147 Ga0114129_10006148 Ga0114129_1000614815 234
233 3300025906 Ga0207699_10117445 Ga0207699_101174452 234
234 3300025910 Ga0207684_10002906 Ga0207684_1000290616 234
235 3300025939 Ga0207665_10315896 Ga0207665_103158961 234
236 3300030760 Ga0265762_1016240 Ga0265762_10162402 234
237 3300039437 Ga0436365_0031849 Ga0436365_0031849_8863_9579 234
238 3300039450 Ga0436363_0436454 Ga0436363_0436454_137_853 234
239 3300044673 Ga0453683_0218324 Ga0453683_0218324_406_1134 234
240 3300046459 Ga0495629_0054939 Ga0495629_0054939_750_1454 234
241 3300046473 Ga0495582_0010407 Ga0495582_0010407_3740_4444 234
242 3300046475 Ga0495639_0037357 Ga0495639_0037357_1353_2114 234
243 3300046526 Ga0495666_0038176 Ga0495666_0038176_1550_2311 234
244 3300046531 Ga0495665_0005685 Ga0495665_0005685_5639_6400 234
245 3300046533 Ga0495640_0010896 Ga0495640_0010896_486_1247 234
246 3300046535 Ga0495586_0055264 Ga0495586_0055264_31_735 234
247 3300046557 Ga0495622_0169289 Ga0495622_0169289_158_919 234
248 3300046681 Ga0495647_0004251 Ga0495647_0004251_3464_4225 234
249 3300046683 Ga0495658_0008227 Ga0495658_0008227_1513_2217 234
250 3300046689 Ga0495613_0068203 Ga0495613_0068203_340_1101 234
251 3300047319 Ga0495674_0060600 Ga0495674_0060600_956_1717 234
252 3300047321 Ga0495676_0024901 Ga0495676_0024901_4395_5156 234
253 3300048089 Ga0495614_0026234 Ga0495614_0026234_969_1730 234
254 3300048903 Ga0496100_0395855 Ga0496100_0395855_74_835 234
255 3300048904 Ga0496101_0024720 Ga0496101_0024720_2028_2789 234
256 3300048918 Ga0496115_0042209 Ga0496115_0042209_2509_3270 234
257 3300050512 nmdc:mga0n895_129088_c1 nmdc:mga0n895_129088_c1_1581_2288 234
258 3300050513 nmdc:mga0rr50_172327_c1 nmdc:mga0rr50_172327_c1_616_1320 234
259 3300050513 nmdc:mga0rr50_74004_c1 nmdc:mga0rr50_74004_c1_1179_1886 234
260 3300050515 nmdc:mga0a205_40577_c1 nmdc:mga0a205_40577_c1_1135_1848 234
261 3300000546 LJNas_1000349 LJNas_10003495 235
262 3300005290 Ga0065712_10010322 Ga0065712_100103222 235
263 3300005327 Ga0070658_10214408 Ga0070658_102144082 235
264 3300005328 Ga0070676_10004271 Ga0070676_100042717 235
265 3300005329 Ga0070683_100009472 Ga0070683_1000094723 235
266 3300005329 Ga0070683_100631946 Ga0070683_1006319462 235
267 3300005330 Ga0070690_100109004 Ga0070690_1001090042 235
268 3300005331 Ga0070670_100012988 Ga0070670_1000129883 235
269 3300005331 Ga0070670_100202703 Ga0070670_1002027032 235
270 3300005334 Ga0068869_100042663 Ga0068869_1000426632 235
271 3300005334 Ga0068869_100158088 Ga0068869_1001580881 235
272 3300005335 Ga0070666_10007921 Ga0070666_100079217 235
273 3300005335 Ga0070666_10227042 Ga0070666_102270421 235
274 3300005336 Ga0070680_100040194 Ga0070680_1000401943 235
275 3300005336 Ga0070680_100199043 Ga0070680_1001990432 235
276 3300005336 Ga0070680_100408162 Ga0070680_1004081622 235
277 3300005338 Ga0068868_100094805 Ga0068868_1000948052 235
278 3300005339 Ga0070660_100009894 Ga0070660_1000098944 235
279 3300005339 Ga0070660_100141774 Ga0070660_1001417742 235
280 3300005344 Ga0070661_100078921 Ga0070661_1000789212 235
281 3300005344 Ga0070661_100612181 Ga0070661_1006121811 235
282 3300005347 Ga0070668_100265344 Ga0070668_1002653442 235
283 3300005353 Ga0070669_100027856 Ga0070669_1000278563 235
284 3300005354 Ga0070675_100252454 Ga0070675_1002524542 235
285 3300005355 Ga0070671_100018649 Ga0070671_1000186495 235
286 3300005355 Ga0070671_100026671 Ga0070671_1000266712 235
287 3300005355 Ga0070671_100240237 Ga0070671_1002402371 235
288 3300005364 Ga0070673_100275847 Ga0070673_1002758472 235
289 3300005366 Ga0070659_100022184 Ga0070659_1000221842 235
290 3300005366 Ga0070659_100148454 Ga0070659_1001484542 235
291 3300005367 Ga0070667_100008621 Ga0070667_1000086212 235
292 3300005434 Ga0070709_10015593 Ga0070709_100155934 235
293 3300005434 Ga0070709_10047348 Ga0070709_100473483 235
294 3300005434 Ga0070709_10070357 Ga0070709_100703574 235
295 3300005434 Ga0070709_10224941 Ga0070709_102249412 235
296 3300005434 Ga0070709_10572290 Ga0070709_105722902 235
297 3300005435 Ga0070714_100000231 Ga0070714_10000023110 235
298 3300005435 Ga0070714_100002825 Ga0070714_1000028253 235
299 3300005435 Ga0070714_100077770 Ga0070714_1000777702 235
300 3300005435 Ga0070714_100080724 Ga0070714_1000807242 235
301 3300005435 Ga0070714_100131459 Ga0070714_1001314593 235
302 3300005435 Ga0070714_100642992 Ga0070714_1006429921 235
303 3300005436 Ga0070713_100044039 Ga0070713_1000440394 235
304 3300005436 Ga0070713_100067106 Ga0070713_1000671062 235
305 3300005436 Ga0070713_100079724 Ga0070713_1000797243 235
306 3300005436 Ga0070713_100183904 Ga0070713_1001839042 235
307 3300005436 Ga0070713_100834149 Ga0070713_1008341492 235
308 3300005439 Ga0070711_100036059 Ga0070711_1000360593 235
309 3300005439 Ga0070711_100219153 Ga0070711_1002191532 235
310 3300005440 Ga0070705_100090729 Ga0070705_1000907291 235
311 3300005445 Ga0070708_100022662 Ga0070708_1000226622 235
312 3300005445 Ga0070708_100147272 Ga0070708_1001472722 235
313 3300005445 Ga0070708_100210712 Ga0070708_1002107122 235
314 3300005445 Ga0070708_100514080 Ga0070708_1005140801 235
315 3300005455 Ga0070663_100001583 Ga0070663_1000015834 235
316 3300005455 Ga0070663_100058233 Ga0070663_1000582333 235
317 3300005455 Ga0070663_100202162 Ga0070663_1002021621 235
318 3300005456 Ga0070678_100014781 Ga0070678_1000147815 235
319 3300005457 Ga0070662_100007366 Ga0070662_1000073667 235
320 3300005458 Ga0070681_10013120 Ga0070681_1001312010 235
321 3300005458 Ga0070681_10196413 Ga0070681_101964132 235
322 3300005458 Ga0070681_10708545 Ga0070681_107085451 235
323 3300005468 Ga0070707_100217838 Ga0070707_1002178382 235
324 3300005468 Ga0070707_100580287 Ga0070707_1005802872 235
325 3300005471 Ga0070698_100169559 Ga0070698_1001695593 235
326 3300005518 Ga0070699_100255190 Ga0070699_1002551902 235
327 3300005530 Ga0070679_100057638 Ga0070679_1000576383 235
328 3300005530 Ga0070679_100107684 Ga0070679_1001076843 235
329 3300005535 Ga0070684_100100654 Ga0070684_1001006543 235
330 3300005535 Ga0070684_100114557 Ga0070684_1001145573 235
331 3300005536 Ga0070697_100011012 Ga0070697_1000110127 235
332 3300005536 Ga0070697_100011538 Ga0070697_1000115383 235
333 3300005536 Ga0070697_100145934 Ga0070697_1001459343 235
334 3300005536 Ga0070697_100163468 Ga0070697_1001634683 235
335 3300005539 Ga0068853_100000041 Ga0068853_10000004165 235
336 3300005539 Ga0068853_100074178 Ga0068853_1000741782 235
337 3300005539 Ga0068853_100128518 Ga0068853_1001285183 235
338 3300005539 Ga0068853_100161418 Ga0068853_1001614182 235
339 3300005545 Ga0070695_100065390 Ga0070695_1000653903 235
340 3300005545 Ga0070695_100122838 Ga0070695_1001228383 235
341 3300005546 Ga0070696_100242520 Ga0070696_1002425201 235
342 3300005547 Ga0070693_100017058 Ga0070693_1000170583 235
343 3300005548 Ga0070665_100002740 Ga0070665_1000027405 235
344 3300005548 Ga0070665_100202526 Ga0070665_1002025262 235
345 3300005563 Ga0068855_100001421 Ga0068855_10000142117 235
346 3300005563 Ga0068855_100007086 Ga0068855_1000070868 235
347 3300005563 Ga0068855_100103090 Ga0068855_1001030902 235
348 3300005563 Ga0068855_100182725 Ga0068855_1001827253 235
349 3300005564 Ga0070664_100028967 Ga0070664_1000289675 235
350 3300005577 Ga0068857_100040374 Ga0068857_1000403745 235
351 3300005577 Ga0068857_100199467 Ga0068857_1001994672 235
352 3300005578 Ga0068854_100000122 Ga0068854_10000012236 235
353 3300005578 Ga0068854_100004655 Ga0068854_1000046553 235
354 3300005578 Ga0068854_100012486 Ga0068854_1000124862 235
355 3300005614 Ga0068856_100001724 Ga0068856_10000172423 235
356 3300005614 Ga0068856_100084818 Ga0068856_1000848182 235
357 3300005616 Ga0068852_100006220 Ga0068852_10000622010 235
358 3300005617 Ga0068859_100661688 Ga0068859_1006616882 235
359 3300005618 Ga0068864_100002560 Ga0068864_10000256018 235
360 3300005618 Ga0068864_100166538 Ga0068864_1001665382 235
361 3300005718 Ga0068866_10007100 Ga0068866_100071003 235
362 3300005718 Ga0068866_10188617 Ga0068866_101886172 235
363 3300005834 Ga0068851_10022899 Ga0068851_100228992 235
364 3300005834 Ga0068851_10162447 Ga0068851_101624471 235
365 3300005840 Ga0068870_10099249 Ga0068870_100992491 235
366 3300005841 Ga0068863_100246309 Ga0068863_1002463093 235
367 3300005841 Ga0068863_100312803 Ga0068863_1003128032 235
368 3300005842 Ga0068858_100012338 Ga0068858_1000123384 235
369 3300005842 Ga0068858_100051663 Ga0068858_1000516634 235
370 3300005843 Ga0068860_100014915 Ga0068860_1000149152 235
371 3300005843 Ga0068860_100017349 Ga0068860_1000173495 235
372 3300005844 Ga0068862_101143201 Ga0068862_1011432011 235
373 3300005937 Ga0081455_10187249 Ga0081455_101872492 235
374 3300006028 Ga0070717_10020392 Ga0070717_100203922 235
375 3300006028 Ga0070717_10022002 Ga0070717_100220029 235
376 3300006028 Ga0070717_10100743 Ga0070717_101007433 235
377 3300006028 Ga0070717_10165414 Ga0070717_101654142 235
378 3300006028 Ga0070717_10239227 Ga0070717_102392272 235
379 3300006028 Ga0070717_10325563 Ga0070717_103255632 235
380 3300006028 Ga0070717_10583582 Ga0070717_105835821 235
381 3300006163 Ga0070715_10009792 Ga0070715_100097924 235
382 3300006163 Ga0070715_10033649 Ga0070715_100336492 235
383 3300006163 Ga0070715_10086850 Ga0070715_100868502 235
384 3300006173 Ga0070716_100000354 Ga0070716_1000003543 235
385 3300006173 Ga0070716_100013004 Ga0070716_1000130045 235
386 3300006173 Ga0070716_100037906 Ga0070716_1000379063 235
387 3300006173 Ga0070716_100087231 Ga0070716_1000872312 235
388 3300006173 Ga0070716_100135372 Ga0070716_1001353722 235
389 3300006173 Ga0070716_100273149 Ga0070716_1002731491 235
390 3300006173 Ga0070716_100327496 Ga0070716_1003274961 235
391 3300006173 Ga0070716_100464490 Ga0070716_1004644902 235
392 3300006175 Ga0070712_100023999 Ga0070712_1000239993 235
393 3300006175 Ga0070712_100034649 Ga0070712_1000346493 235
394 3300006175 Ga0070712_100063059 Ga0070712_1000630593 235
395 3300006175 Ga0070712_100127114 Ga0070712_1001271143 235
396 3300006175 Ga0070712_100135417 Ga0070712_1001354172 235
397 3300006175 Ga0070712_100291568 Ga0070712_1002915682 235
398 3300006237 Ga0097621_100000034 Ga0097621_1000000348 235
399 3300006237 Ga0097621_100019759 Ga0097621_1000197595 235
400 3300006237 Ga0097621_100026888 Ga0097621_1000268885 235
401 3300006237 Ga0097621_100067291 Ga0097621_1000672914 235
402 3300006358 Ga0068871_100000819 Ga0068871_1000008198 235
403 3300006358 Ga0068871_100008170 Ga0068871_1000081708 235
404 3300006358 Ga0068871_100213398 Ga0068871_1002133982 235
405 3300006846 Ga0075430_100190189 Ga0075430_1001901892 235
406 3300006847 Ga0075431_100140971 Ga0075431_1001409714 235
407 3300006871 Ga0075434_100004271 Ga0075434_10000427113 235
408 3300006871 Ga0075434_100020351 Ga0075434_1000203516 235
409 3300006871 Ga0075434_100232600 Ga0075434_1002326002 235
410 3300006880 Ga0075429_100029806 Ga0075429_1000298062 235
411 3300006881 Ga0068865_100299098 Ga0068865_1002990982 235
412 3300006881 Ga0068865_100531565 Ga0068865_1005315652 235
413 3300006914 Ga0075436_100002580 Ga0075436_1000025807 235
414 3300006914 Ga0075436_100005980 Ga0075436_1000059806 235
415 3300006914 Ga0075436_100090790 Ga0075436_1000907902 235
416 3300006914 Ga0075436_100100340 Ga0075436_1001003403 235
417 3300006931 Ga0097620_100661662 Ga0097620_1006616621 235
418 3300007076 Ga0075435_100007962 Ga0075435_1000079623 235
419 3300007076 Ga0075435_100299519 Ga0075435_1002995192 235
420 3300009093 Ga0105240_10004264 Ga0105240_1000426411 235
421 3300009093 Ga0105240_10040354 Ga0105240_100403542 235
422 3300009093 Ga0105240_10047360 Ga0105240_100473605 235
423 3300009093 Ga0105240_10227221 Ga0105240_102272212 235
424 3300009093 Ga0105240_10377040 Ga0105240_103770402 235
425 3300009098 Ga0105245_10000411 Ga0105245_100004112 235
426 3300009098 Ga0105245_10247513 Ga0105245_102475132 235
427 3300009098 Ga0105245_10273445 Ga0105245_102734452 235
428 3300009147 Ga0114129_10074350 Ga0114129_100743504 235
429 3300009147 Ga0114129_10098137 Ga0114129_100981377 235
430 3300009174 Ga0105241_10008117 Ga0105241_1000811712 235
431 3300009174 Ga0105241_10335533 Ga0105241_103355332 235
432 3300009176 Ga0105242_10076575 Ga0105242_100765753 235
433 3300009177 Ga0105248_10011027 Ga0105248_100110275 235
434 3300009177 Ga0105248_10069980 Ga0105248_100699804 235
435 3300009177 Ga0105248_10161420 Ga0105248_101614203 235
436 3300009177 Ga0105248_10571794 Ga0105248_105717942 235
437 3300009545 Ga0105237_10038741 Ga0105237_100387414 235
438 3300009545 Ga0105237_10244648 Ga0105237_102446483 235
439 3300009545 Ga0105237_10484699 Ga0105237_104846991 235
440 3300009551 Ga0105238_10034553 Ga0105238_100345532 235
441 3300009551 Ga0105238_10036544 Ga0105238_100365442 235
442 3300009553 Ga0105249_10525858 Ga0105249_105258582 235
443 3300010375 Ga0105239_10021480 Ga0105239_100214808 235
444 3300010375 Ga0105239_10095242 Ga0105239_100952423 235
445 3300010375 Ga0105239_10204751 Ga0105239_102047513 235
446 3300010375 Ga0105239_10270453 Ga0105239_102704532 235
447 3300011119 Ga0105246_10020182 Ga0105246_100201826 235
448 3300013102 Ga0157371_10138302 Ga0157371_101383023 235
449 3300013104 Ga0157370_10002484 Ga0157370_100024848 235
450 3300013104 Ga0157370_10582087 Ga0157370_105820872 235
451 3300013105 Ga0157369_10010669 Ga0157369_1001066911 235
452 3300013105 Ga0157369_10399861 Ga0157369_103998612 235
453 3300013296 Ga0157374_10000249 Ga0157374_100002497 235
454 3300013296 Ga0157374_10000787 Ga0157374_100007877 235
455 3300013296 Ga0157374_10128064 Ga0157374_101280642 235
456 3300013297 Ga0157378_10000008 Ga0157378_1000000818 235
457 3300013297 Ga0157378_10001217 Ga0157378_100012179 235
458 3300013307 Ga0157372_10000436 Ga0157372_100004367 235
459 3300013307 Ga0157372_10030521 Ga0157372_100305214 235
460 3300013307 Ga0157372_10141022 Ga0157372_101410222 235
461 3300014325 Ga0163163_10239781 Ga0163163_102397811 235
462 3300014497 Ga0182008_10021637 Ga0182008_100216372 235
463 3300014968 Ga0157379_10003566 Ga0157379_100035667 235
464 3300014969 Ga0157376_10001493 Ga0157376_100014932 235
465 3300015261 Ga0182006_1046599 Ga0182006_10465992 235
466 3300015262 Ga0182007_10028080 Ga0182007_100280801 235
467 3300015265 Ga0182005_1011524 Ga0182005_10115242 235
468 3300021358 Ga0213873_10074341 Ga0213873_100743411 235
469 3300021361 Ga0213872_10001338 Ga0213872_1000133815 235
470 3300021361 Ga0213872_10001709 Ga0213872_100017096 235
471 3300021361 Ga0213872_10002491 Ga0213872_100024913 235
472 3300021361 Ga0213872_10031819 Ga0213872_100318192 235
473 3300021361 Ga0213872_10045545 Ga0213872_100455453 235
474 3300021361 Ga0213872_10094590 Ga0213872_100945902 235
475 3300021361 Ga0213872_10104727 Ga0213872_101047272 235
476 3300021384 Ga0213876_10056935 Ga0213876_100569352 235
477 3300021388 Ga0213875_10080460 Ga0213875_100804602 235
478 3300021388 Ga0213875_10223533 Ga0213875_102235331 235
479 3300021441 Ga0213871_10008210 Ga0213871_100082102 235
480 3300024227 Ga0228598_1001283 Ga0228598_10012836 235
481 3300025321 Ga0207656_10072300 Ga0207656_100723002 235
482 3300025321 Ga0207656_10091279 Ga0207656_100912791 235
483 3300025898 Ga0207692_10086083 Ga0207692_100860832 235
484 3300025898 Ga0207692_10106975 Ga0207692_101069752 235
485 3300025899 Ga0207642_10167351 Ga0207642_101673512 235
486 3300025903 Ga0207680_10112310 Ga0207680_101123102 235
487 3300025904 Ga0207647_10006284 Ga0207647_100062847 235
488 3300025905 Ga0207685_10006465 Ga0207685_100064653 235
489 3300025905 Ga0207685_10020451 Ga0207685_100204512 235
490 3300025906 Ga0207699_10011334 Ga0207699_100113343 235
491 3300025906 Ga0207699_10015299 Ga0207699_100152994 235
492 3300025906 Ga0207699_10213385 Ga0207699_102133852 235
493 3300025906 Ga0207699_10471827 Ga0207699_104718271 235
494 3300025907 Ga0207645_10096239 Ga0207645_100962393 235
495 3300025909 Ga0207705_10190255 Ga0207705_101902552 235
496 3300025912 Ga0207707_10015200 Ga0207707_100152003 235
497 3300025912 Ga0207707_10029186 Ga0207707_100291862 235
498 3300025912 Ga0207707_10150117 Ga0207707_101501172 235
499 3300025913 Ga0207695_10005455 Ga0207695_1000545511 235
500 3300025913 Ga0207695_10009167 Ga0207695_100091674 235
501 3300025913 Ga0207695_10025939 Ga0207695_100259396 235
502 3300025914 Ga0207671_10096036 Ga0207671_100960361 235
503 3300025915 Ga0207693_10007800 Ga0207693_100078005 235
504 3300025915 Ga0207693_10015230 Ga0207693_100152303 235
505 3300025915 Ga0207693_10032918 Ga0207693_100329182 235
506 3300025915 Ga0207693_10130900 Ga0207693_101309002 235
507 3300025915 Ga0207693_10434100 Ga0207693_104341001 235
508 3300025916 Ga0207663_10491865 Ga0207663_104918652 235
509 3300025916 Ga0207663_10669175 Ga0207663_106691751 235
510 3300025917 Ga0207660_10267115 Ga0207660_102671152 235
511 3300025919 Ga0207657_10001667 Ga0207657_100016674 235
512 3300025919 Ga0207657_10010205 Ga0207657_100102054 235
513 3300025920 Ga0207649_10065523 Ga0207649_100655231 235
514 3300025920 Ga0207649_10088524 Ga0207649_100885242 235
515 3300025921 Ga0207652_10123880 Ga0207652_101238802 235
516 3300025921 Ga0207652_10263798 Ga0207652_102637982 235
517 3300025922 Ga0207646_10007050 Ga0207646_100070505 235
518 3300025922 Ga0207646_10105087 Ga0207646_101050873 235
519 3300025922 Ga0207646_10171569 Ga0207646_101715692 235
520 3300025923 Ga0207681_10303896 Ga0207681_103038961 235
521 3300025924 Ga0207694_10063306 Ga0207694_100633063 235
522 3300025924 Ga0207694_10092037 Ga0207694_100920372 235
523 3300025925 Ga0207650_10672896 Ga0207650_106728962 235
524 3300025926 Ga0207659_10433059 Ga0207659_104330592 235
525 3300025927 Ga0207687_10000141 Ga0207687_1000014110 235
526 3300025928 Ga0207700_10028873 Ga0207700_100288732 235
527 3300025928 Ga0207700_10028932 Ga0207700_100289323 235
528 3300025928 Ga0207700_10112223 Ga0207700_101122232 235
529 3300025928 Ga0207700_10185866 Ga0207700_101858661 235
530 3300025928 Ga0207700_10247750 Ga0207700_102477503 235
531 3300025928 Ga0207700_10468180 Ga0207700_104681801 235
532 3300025928 Ga0207700_10586354 Ga0207700_105863542 235
533 3300025929 Ga0207664_10000033 Ga0207664_10000033152 235
534 3300025929 Ga0207664_10050872 Ga0207664_100508723 235
535 3300025929 Ga0207664_10142917 Ga0207664_101429172 235
536 3300025929 Ga0207664_10388694 Ga0207664_103886942 235
537 3300025929 Ga0207664_10466259 Ga0207664_104662591 235
538 3300025929 Ga0207664_10646445 Ga0207664_106464452 235
539 3300025929 Ga0207664_10740070 Ga0207664_107400702 235
540 3300025931 Ga0207644_10017386 Ga0207644_100173863 235
541 3300025931 Ga0207644_10127442 Ga0207644_101274422 235
542 3300025931 Ga0207644_10175159 Ga0207644_101751592 235
543 3300025932 Ga0207690_10006731 Ga0207690_100067317 235
544 3300025932 Ga0207690_10118299 Ga0207690_101182992 235
545 3300025933 Ga0207706_10009258 Ga0207706_100092586 235
546 3300025933 Ga0207706_10016470 Ga0207706_100164704 235
547 3300025934 Ga0207686_10624807 Ga0207686_106248071 235
548 3300025935 Ga0207709_10354244 Ga0207709_103542442 235
549 3300025938 Ga0207704_10069593 Ga0207704_100695934 235
550 3300025938 Ga0207704_10109315 Ga0207704_101093153 235
551 3300025939 Ga0207665_10000596 Ga0207665_100005969 235
552 3300025939 Ga0207665_10008819 Ga0207665_100088195 235
553 3300025939 Ga0207665_10014915 Ga0207665_100149155 235
554 3300025939 Ga0207665_10021588 Ga0207665_100215885 235
555 3300025939 Ga0207665_10084007 Ga0207665_100840071 235
556 3300025939 Ga0207665_10095860 Ga0207665_100958602 235
557 3300025939 Ga0207665_10184528 Ga0207665_101845281 235
558 3300025941 Ga0207711_10062942 Ga0207711_100629424 235
559 3300025941 Ga0207711_10779816 Ga0207711_107798162 235
560 3300025942 Ga0207689_10095246 Ga0207689_100952462 235
561 3300025944 Ga0207661_10001952 Ga0207661_1000195216 235
562 3300025944 Ga0207661_10005239 Ga0207661_100052393 235
563 3300025944 Ga0207661_10147408 Ga0207661_101474081 235
564 3300025944 Ga0207661_10430664 Ga0207661_104306642 235
565 3300025945 Ga0207679_10011893 Ga0207679_100118932 235
566 3300025945 Ga0207679_10191162 Ga0207679_101911622 235
567 3300025949 Ga0207667_10001192 Ga0207667_1000119215 235
568 3300025949 Ga0207667_10001239 Ga0207667_1000123913 235
569 3300025949 Ga0207667_10187553 Ga0207667_101875532 235
570 3300025949 Ga0207667_10210046 Ga0207667_102100461 235
571 3300025949 Ga0207667_10219774 Ga0207667_102197742 235
572 3300025949 Ga0207667_10262487 Ga0207667_102624872 235
573 3300025981 Ga0207640_10000057 Ga0207640_1000005717 235
574 3300025981 Ga0207640_10000158 Ga0207640_1000015837 235
575 3300025981 Ga0207640_10004462 Ga0207640_100044624 235
576 3300025981 Ga0207640_10068667 Ga0207640_100686673 235
577 3300025986 Ga0207658_10009142 Ga0207658_100091427 235
578 3300026023 Ga0207677_10068958 Ga0207677_100689582 235
579 3300026035 Ga0207703_10110369 Ga0207703_101103692 235
580 3300026041 Ga0207639_10000016 Ga0207639_1000001653 235
581 3300026041 Ga0207639_10225636 Ga0207639_102256362 235
582 3300026067 Ga0207678_10000903 Ga0207678_1000090314 235
583 3300026067 Ga0207678_10081936 Ga0207678_100819363 235
584 3300026067 Ga0207678_10221465 Ga0207678_102214652 235
585 3300026078 Ga0207702_10002159 Ga0207702_1000215912 235
586 3300026078 Ga0207702_10172398 Ga0207702_101723983 235
587 3300026078 Ga0207702_10224439 Ga0207702_102244392 235
588 3300026078 Ga0207702_10306028 Ga0207702_103060282 235
589 3300026078 Ga0207702_10384566 Ga0207702_103845662 235
590 3300026088 Ga0207641_10088629 Ga0207641_100886294 235
591 3300026088 Ga0207641_10176111 Ga0207641_101761112 235
592 3300026088 Ga0207641_10382407 Ga0207641_103824072 235
593 3300026088 Ga0207641_11084520 Ga0207641_110845201 235
594 3300026089 Ga0207648_10005015 Ga0207648_100050151 235
595 3300026089 Ga0207648_10010627 Ga0207648_100106278 235
596 3300026116 Ga0207674_10044672 Ga0207674_100446724 235
597 3300026116 Ga0207674_10047118 Ga0207674_100471182 235
598 3300026121 Ga0207683_10015510 Ga0207683_100155102 235
599 3300026142 Ga0207698_10053084 Ga0207698_100530843 235
600 3300027671 Ga0209588_1009128 Ga0209588_10091283 235
601 3300027671 Ga0209588_1010182 Ga0209588_10101823 235
602 3300028379 Ga0268266_10007114 Ga0268266_100071146 235
603 3300028379 Ga0268266_10120259 Ga0268266_101202593 235
604 3300028380 Ga0268265_10918769 Ga0268265_109187691 235
605 3300028381 Ga0268264_10010932 Ga0268264_100109328 235
606 3300030760 Ga0265762_1004191 Ga0265762_10041913 235
607 3300030763 Ga0265763_1009638 Ga0265763_10096382 235
608 3300031090 Ga0265760_10010730 Ga0265760_100107303 235
609 3300031090 Ga0265760_10015676 Ga0265760_100156761 235
610 3300031090 Ga0265760_10094101 Ga0265760_100941011 235
611 3300031090 Ga0265760_10132109 Ga0265760_101321091 235
612 3300035083 Ga0373926_0000619 Ga0373926_0000619_6195_6902 235
613 3300035083 Ga0373926_0001291 Ga0373926_0001291_2370_3077 235
614 3300035086 Ga0373934_0036650 Ga0373934_0036650_554_1267 235
615 3300035089 Ga0373944_0043642 Ga0373944_0043642_598_1344 235
616 3300035111 Ga0373923_0077297 Ga0373923_0077297_128_841 235
617 3300035113 Ga0373936_0009809 Ga0373936_0009809_1623_2369 235
618 3300035118 Ga0373954_0011555 Ga0373954_0011555_2714_3427 235
619 3300035170 Ga0373943_0000093 Ga0373943_0000093_16900_17646 235
620 3300035170 Ga0373943_0078696 Ga0373943_0078696_676_1383 235
621 3300035171 Ga0373946_0001175 Ga0373946_0001175_2357_3064 235
622 3300035171 Ga0373946_0218051 Ga0373946_0218051_124_846 235
623 3300035172 Ga0373955_0013271 Ga0373955_0013271_956_1669 235
624 3300035692 Ga0373935_0000406 Ga0373935_0000406_15789_16535 235
625 3300035695 Ga0373927_0000351 Ga0373927_0000351_21601_22347 235
626 3300035695 Ga0373927_0005076 Ga0373927_0005076_2792_3499 235
627 3300035695 Ga0373927_0038721 Ga0373927_0038721_789_1502 235
628 3300035695 Ga0373927_0057875 Ga0373927_0057875_1753_2460 235
629 3300035725 Ga0373947_0003946 Ga0373947_0003946_6501_7247 235
630 3300035725 Ga0373947_0022859 Ga0373947_0022859_1187_1894 235
631 3300035725 Ga0373947_0135446 Ga0373947_0135446_327_1049 235
632 3300036401 Ga0373937_0044675 Ga0373937_0044675_1046_1759 235
633 3300036401 Ga0373937_0258866 Ga0373937_0258866_149_871 235
634 3300037068 Ga0373925_0001716 Ga0373925_0001716_12170_12877 235
635 3300037068 Ga0373925_0007208 Ga0373925_0007208_5602_6348 235
636 3300037418 Ga0395900_0173907 Ga0395900_0173907_122_829 235
637 3300037466 Ga0395898_0247788 Ga0395898_0247788_109_816 235
638 3300037853 Ga0436364_0042355 Ga0436364_0042355_3608_4315 235
639 3300037853 Ga0436364_0524449 Ga0436364_0524449_654_1361 235
640 3300037853 Ga0436364_1479972 Ga0436364_1479972_6867_7574 235
641 3300038443 Ga0395901_0069456 Ga0395901_0069456_1388_2125 235
642 3300038443 Ga0395901_0667415 Ga0395901_0667415_77_784 235
643 3300039437 Ga0436365_1116478 Ga0436365_1116478_5626_6333 235
644 3300039438 Ga0436360_0680576 Ga0436360_0680576_610_1317 235
645 3300039438 Ga0436360_1228382 Ga0436360_1228382_2772_3491 235
646 3300039447 Ga0436361_0091471 Ga0436361_0091471_3155_3874 235
647 3300039447 Ga0436361_0400616 Ga0436361_0400616_32697_33404 235
648 3300039447 Ga0436361_0672781 Ga0436361_0672781_451_1197 235
649 3300039447 Ga0436361_0705926 Ga0436361_0705926_2134_2853 235
650 3300039447 Ga0436361_0797421 Ga0436361_0797421_343_1062 235
651 3300039450 Ga0436363_0493680 Ga0436363_0493680_657_1364 235
652 3300039453 Ga0436362_0405422 Ga0436362_0405422_1515_2255 235
653 3300042876 Ga0451577_0081585 Ga0451577_0081585_1520_2233 235
654 3300042876 Ga0451577_0330959 Ga0451577_0330959_472_1209 235
655 3300044712 Ga0453684_0062176 Ga0453684_0062176_3239_3976 235
656 3300044712 Ga0453684_0285831 Ga0453684_0285831_393_1106 235
657 3300044712 Ga0453684_0864965 Ga0453684_0864965_233_940 235
658 3300045051 Ga0451576_0413200 Ga0451576_0413200_510_1223 235
659 3300045051 Ga0451576_0631099 Ga0451576_0631099_130_843 235
660 3300046463 Ga0495653_0044063 Ga0495653_0044063_724_1470 235
661 3300046472 Ga0495580_0085653 Ga0495580_0085653_298_1005 235
662 3300046477 Ga0495664_0068823 Ga0495664_0068823_1270_2016 235
663 3300046516 Ga0495628_0161288 Ga0495628_0161288_795_1541 235
664 3300046517 Ga0495630_0005548 Ga0495630_0005548_6564_7271 235
665 3300046517 Ga0495630_0046166 Ga0495630_0046166_2235_2942 235
666 3300046517 Ga0495630_0269710 Ga0495630_0269710_409_1155 235
667 3300046526 Ga0495666_0102548 Ga0495666_0102548_379_1086 235
668 3300046663 Ga0495635_0080644 Ga0495635_0080644_391_1137 235
669 3300046679 Ga0495623_0106551 Ga0495623_0106551_237_983 235
670 3300046690 Ga0495624_0044011 Ga0495624_0044011_16_762 235
671 3300047319 Ga0495674_0031040 Ga0495674_0031040_2967_3713 235
672 3300047319 Ga0495674_0092937 Ga0495674_0092937_922_1629 235
673 3300047321 Ga0495676_0138852 Ga0495676_0138852_121_867 235
674 3300047321 Ga0495676_0146067 Ga0495676_0146067_34_741 235
675 3300047444 Ga0495675_0168846 Ga0495675_0168846_263_970 235
676 3300047471 Ga0495684_0082815 Ga0495684_0082815_678_1424 235
677 3300048903 Ga0496100_0018636 Ga0496100_0018636_764_1471 235
678 3300048904 Ga0496101_0120502 Ga0496101_0120502_746_1453 235
679 3300048906 Ga0496103_0027212 Ga0496103_0027212_39_776 235
680 3300048906 Ga0496103_0046043 Ga0496103_0046043_1172_1879 235
681 3300048908 Ga0496105_0040427 Ga0496105_0040427_525_1256 235
682 3300048911 Ga0496108_0169891 Ga0496108_0169891_70_777 235
683 3300048912 Ga0496109_0153116 Ga0496109_0153116_648_1355 235
684 3300048914 Ga0496111_0051037 Ga0496111_0051037_1029_1736 235
685 3300048915 Ga0496112_0021016 Ga0496112_0021016_3567_4274 235
686 3300048915 Ga0496112_0317599 Ga0496112_0317599_105_836 235
687 3300050507 nmdc:mga05p37_42655_c1 nmdc:mga05p37_42655_c1_1987_2700 235
688 3300050510 nmdc:mga06r32_214002_c1 nmdc:mga06r32_214002_c1_683_1396 235
689 3300050512 nmdc:mga0n895_4333_c1 nmdc:mga0n895_4333_c1_7724_8437 235
690 3300050512 nmdc:mga0n895_449647_c1 nmdc:mga0n895_449647_c1_325_1038 235
691 3300050512 nmdc:mga0n895_6406_c1 nmdc:mga0n895_6406_c1_3046_3753 235
692 3300050512 nmdc:mga0n895_679426_c1 nmdc:mga0n895_679426_c1_160_867 235
693 3300050513 nmdc:mga0rr50_140_c1 nmdc:mga0rr50_140_c1_25784_26497 235
694 3300050513 nmdc:mga0rr50_26280_c1 nmdc:mga0rr50_26280_c1_164_871 235
695 3300050513 nmdc:mga0rr50_65554_c1 nmdc:mga0rr50_65554_c1_321_1034 235
696 3300050513 nmdc:mga0rr50_707053_c1 nmdc:mga0rr50_707053_c1_137_844 235
697 3300050514 nmdc:mga08x19_11550_c1 nmdc:mga08x19_11550_c1_1734_2441 235
698 3300050514 nmdc:mga08x19_14044_c1 nmdc:mga08x19_14044_c1_2977_3690 235
699 3300050514 nmdc:mga08x19_177582_c1 nmdc:mga08x19_177582_c1_722_1429 235
700 3300050514 nmdc:mga08x19_243722_c1 nmdc:mga08x19_243722_c1_209_916 235
701 3300050514 nmdc:mga08x19_43093_c1 nmdc:mga08x19_43093_c1_898_1605 235
702 3300050514 nmdc:mga08x19_87945_c1 nmdc:mga08x19_87945_c1_1081_1797 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

4

162

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7961 2 229
4y6n-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 0.7839 2 223
5jqx-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga 0.7827 2 222
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.7798 2 109
3ckq-assembly1.cif.gz_A-2 crystal structure of a mycobacterial protein 0.7784 2 222
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9463 3 215 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9206 3 215 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8541 3 215 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8286 1 222 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8266 5 220 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6J4VWC6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9694 4 223 GO:0016757
AF-A0A2D8SSQ6-F1-model_v4 deleted 0.9689 2 224
AF-A0A2E8H4R4-F1-model_v4 UDP-glucose--dolichyl-phosphate glucosyltransferase 0.9681 2 223 GO:0016757
AF-A0A7W0S4X3-F1-model_v4 Glycosyltransferase family 2 protein 0.9672 2 224 GO:0016757
AF-A0A537YDT4-F1-model_v4 Glycosyltransferase family 2 protein 0.9667 3 219 GO:0016757

Feature Viewer

pLDDT pTM Quality
87.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map