F476207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 260 | 702 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300006163|Ga0070715_10086850|Ga0070715_100868502 |
| Length | 275 |
| Sequence | VRVSVIIPTHNEAKAIGRVLADLPSNLVTEVIVVDSNSNDGTPEIAAKMGARLLQEPRRGYGRACLTGLAAANAPDVVVFLDGDYSDRPSELPILIQPILDGRADITLGSRRRERRSAGALPWHQVLGNRLAASLIRLLYRLDITDLGPFRAGRADVLGALGLEEKTYGWAVEMILKGALAGYRVIEVPVSYYPRIGKSKISGTLKGTIGAGWFILSLIVRYYFRRRIGATPKPAAHQNYATLERDGGAIVRERPCTGNHGESTEARHGQDSPYA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 109 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 202 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.43 |
| Metatranscriptomes | 1.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.56 |
| Rhizosphere | 94.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000349 | 3300000546 | Bacteria | 8109 |
| 2 | LJNas_1009783 | 3300000546 | Unclassified | 1024 |
| 3 | Ga0065712_10010322 | 3300005290 | Bacteria | 2115 |
| 4 | Ga0070658_10214408 | 3300005327 | Bacteria | 1627 |
| 5 | Ga0070676_10004271 | 3300005328 | Bacteria | 7506 |
| 6 | Ga0070683_100009472 | 3300005329 | Bacteria | 8331 |
| 7 | Ga0070683_100194454 | 3300005329 | Bacteria | 1926 |
| 8 | Ga0070683_100631946 | 3300005329 | Bacteria | 1025 |
| 9 | Ga0070690_100109004 | 3300005330 | Bacteria | 1845 |
| 10 | Ga0070670_100012988 | 3300005331 | Bacteria | 7131 |
| 11 | Ga0070670_100202703 | 3300005331 | Bacteria | 1724 |
| 12 | Ga0068869_100042663 | 3300005334 | Bacteria | 3253 |
| 13 | Ga0068869_100131910 | 3300005334 | Bacteria | 1921 |
| 14 | Ga0068869_100158088 | 3300005334 | Bacteria | 1763 |
| 15 | Ga0070666_10007921 | 3300005335 | Bacteria | 6564 |
| 16 | Ga0070666_10227042 | 3300005335 | Bacteria | 1318 |
| 17 | Ga0070680_100040194 | 3300005336 | Unclassified | 3786 |
| 18 | Ga0070680_100157142 | 3300005336 | Bacteria | 1910 |
| 19 | Ga0070680_100199043 | 3300005336 | Unclassified | 1689 |
| 20 | Ga0070680_100408162 | 3300005336 | Bacteria | 1158 |
| 21 | Ga0068868_100094805 | 3300005338 | Bacteria | 2408 |
| 22 | Ga0070660_100009894 | 3300005339 | Bacteria | 6726 |
| 23 | Ga0070660_100141774 | 3300005339 | Unclassified | 1928 |
| 24 | Ga0070661_100078921 | 3300005344 | Bacteria | 2428 |
| 25 | Ga0070661_100612181 | 3300005344 | Unclassified | 881 |
| 26 | Ga0070668_100265344 | 3300005347 | Bacteria | 1429 |
| 27 | Ga0070669_100027856 | 3300005353 | Bacteria | 4067 |
| 28 | Ga0070675_100252454 | 3300005354 | Bacteria | 1544 |
| 29 | Ga0070671_100018649 | 3300005355 | Bacteria | 5638 |
| 30 | Ga0070671_100026671 | 3300005355 | Unclassified | 4751 |
| 31 | Ga0070671_100240237 | 3300005355 | Bacteria | 1537 |
| 32 | Ga0070671_100499019 | 3300005355 | Unclassified | 1047 |
| 33 | Ga0070673_100275847 | 3300005364 | Bacteria | 1473 |
| 34 | Ga0070659_100022184 | 3300005366 | Bacteria | 4843 |
| 35 | Ga0070659_100148454 | 3300005366 | Bacteria | 1911 |
| 36 | Ga0070667_100008621 | 3300005367 | Bacteria | 8450 |
| 37 | Ga0070709_10015593 | 3300005434 | Unclassified | 4327 |
| 38 | Ga0070709_10047348 | 3300005434 | Bacteria | 2678 |
| 39 | Ga0070709_10070357 | 3300005434 | Bacteria | 2255 |
| 40 | Ga0070709_10099697 | 3300005434 | Bacteria | 1933 |
| 41 | Ga0070709_10101062 | 3300005434 | Bacteria | 1921 |
| 42 | Ga0070709_10224941 | 3300005434 | Bacteria | 1340 |
| 43 | Ga0070709_10572290 | 3300005434 | Bacteria | 867 |
| 44 | Ga0070714_100000231 | 3300005435 | Bacteria | 44130 |
| 45 | Ga0070714_100002825 | 3300005435 | Bacteria | 12811 |
| 46 | Ga0070714_100016881 | 3300005435 | Bacteria | 5905 |
| 47 | Ga0070714_100040186 | 3300005435 | Unclassified | 3941 |
| 48 | Ga0070714_100040692 | 3300005435 | Unclassified | 3918 |
| 49 | Ga0070714_100077770 | 3300005435 | Bacteria | 2882 |
| 50 | Ga0070714_100080724 | 3300005435 | Bacteria | 2830 |
| 51 | Ga0070714_100123982 | 3300005435 | Bacteria | 2301 |
| 52 | Ga0070714_100131459 | 3300005435 | Bacteria | 2237 |
| 53 | Ga0070714_100179564 | 3300005435 | Bacteria | 1925 |
| 54 | Ga0070714_100642992 | 3300005435 | Bacteria | 1021 |
| 55 | Ga0070713_100037457 | 3300005436 | Unclassified | 3921 |
| 56 | Ga0070713_100044039 | 3300005436 | Bacteria | 3652 |
| 57 | Ga0070713_100050310 | 3300005436 | Unclassified | 3442 |
| 58 | Ga0070713_100067106 | 3300005436 | Bacteria | 3019 |
| 59 | Ga0070713_100079724 | 3300005436 | Bacteria | 2790 |
| 60 | Ga0070713_100126421 | 3300005436 | Bacteria | 2249 |
| 61 | Ga0070713_100183904 | 3300005436 | Bacteria | 1879 |
| 62 | Ga0070713_100338960 | 3300005436 | Bacteria | 1393 |
| 63 | Ga0070713_100834149 | 3300005436 | Unclassified | 885 |
| 64 | Ga0070710_10000598 | 3300005437 | Bacteria | 17193 |
| 65 | Ga0070710_10030372 | 3300005437 | Bacteria | 2907 |
| 66 | Ga0070710_10086096 | 3300005437 | Bacteria | 1845 |
| 67 | Ga0070711_100000159 | 3300005439 | Bacteria | 36590 |
| 68 | Ga0070711_100004814 | 3300005439 | Bacteria | 8007 |
| 69 | Ga0070711_100036059 | 3300005439 | Bacteria | 3312 |
| 70 | Ga0070711_100219153 | 3300005439 | Bacteria | 1478 |
| 71 | Ga0070705_100090729 | 3300005440 | Bacteria | 1903 |
| 72 | Ga0070708_100015426 | 3300005445 | Bacteria | 6311 |
| 73 | Ga0070708_100022662 | 3300005445 | Bacteria | 5329 |
| 74 | Ga0070708_100134488 | 3300005445 | Bacteria | 2290 |
| 75 | Ga0070708_100147272 | 3300005445 | Bacteria | 2188 |
| 76 | Ga0070708_100182492 | 3300005445 | Bacteria | 1962 |
| 77 | Ga0070708_100210712 | 3300005445 | Bacteria | 1821 |
| 78 | Ga0070708_100514080 | 3300005445 | Unclassified | 1129 |
| 79 | Ga0070663_100001583 | 3300005455 | Bacteria | 12524 |
| 80 | Ga0070663_100058233 | 3300005455 | Unclassified | 2774 |
| 81 | Ga0070663_100202162 | 3300005455 | Bacteria | 1551 |
| 82 | Ga0070678_100014781 | 3300005456 | Unclassified | 4937 |
| 83 | Ga0070662_100007366 | 3300005457 | Bacteria | 7129 |
| 84 | Ga0070681_10013120 | 3300005458 | Bacteria | 8231 |
| 85 | Ga0070681_10023043 | 3300005458 | Bacteria | 6261 |
| 86 | Ga0070681_10050013 | 3300005458 | Unclassified | 4172 |
| 87 | Ga0070681_10196413 | 3300005458 | Bacteria | 1936 |
| 88 | Ga0070681_10708545 | 3300005458 | Unclassified | 922 |
| 89 | Ga0070706_100002718 | 3300005467 | Bacteria | 17695 |
| 90 | Ga0070707_100043153 | 3300005468 | Bacteria | 4317 |
| 91 | Ga0070707_100217838 | 3300005468 | Bacteria | 1860 |
| 92 | Ga0070707_100511377 | 3300005468 | Bacteria | 1163 |
| 93 | Ga0070707_100580287 | 3300005468 | Bacteria | 1083 |
| 94 | Ga0070698_100169559 | 3300005471 | Bacteria | 2124 |
| 95 | Ga0070699_100014701 | 3300005518 | Bacteria | 6731 |
| 96 | Ga0070699_100092300 | 3300005518 | Bacteria | 2648 |
| 97 | Ga0070699_100255190 | 3300005518 | Bacteria | 1567 |
| 98 | Ga0070699_100383218 | 3300005518 | Unclassified | 1270 |
| 99 | Ga0070679_100057638 | 3300005530 | Unclassified | 3872 |
| 100 | Ga0070679_100107684 | 3300005530 | Bacteria | 2773 |
| 101 | Ga0070679_100131331 | 3300005530 | Bacteria | 2485 |
| 102 | Ga0070679_100497605 | 3300005530 | Unclassified | 1163 |
| 103 | Ga0070684_100100654 | 3300005535 | Bacteria | 2581 |
| 104 | Ga0070684_100114557 | 3300005535 | Bacteria | 2420 |
| 105 | Ga0070697_100000326 | 3300005536 | Bacteria | 37671 |
| 106 | Ga0070697_100011012 | 3300005536 | Bacteria | 7065 |
| 107 | Ga0070697_100011538 | 3300005536 | Bacteria | 6903 |
| 108 | Ga0070697_100026945 | 3300005536 | Bacteria | 4596 |
| 109 | Ga0070697_100145934 | 3300005536 | Unclassified | 1991 |
| 110 | Ga0070697_100163468 | 3300005536 | Bacteria | 1881 |
| 111 | Ga0070697_100169918 | 3300005536 | Bacteria | 1845 |
| 112 | Ga0070697_100263634 | 3300005536 | Bacteria | 1476 |
| 113 | Ga0068853_100000041 | 3300005539 | Bacteria | 104733 |
| 114 | Ga0068853_100074178 | 3300005539 | Unclassified | 2968 |
| 115 | Ga0068853_100128518 | 3300005539 | Bacteria | 2266 |
| 116 | Ga0068853_100161418 | 3300005539 | Bacteria | 2023 |
| 117 | Ga0070695_100065390 | 3300005545 | Bacteria | 2368 |
| 118 | Ga0070695_100122838 | 3300005545 | Unclassified | 1779 |
| 119 | Ga0070696_100242520 | 3300005546 | Bacteria | 1360 |
| 120 | Ga0070693_100017058 | 3300005547 | Bacteria | 3768 |
| 121 | Ga0070665_100002740 | 3300005548 | Bacteria | 19089 |
| 122 | Ga0070665_100128605 | 3300005548 | Bacteria | 2535 |
| 123 | Ga0070665_100202526 | 3300005548 | Unclassified | 1985 |
| 124 | Ga0068855_100001421 | 3300005563 | Bacteria | 29751 |
| 125 | Ga0068855_100007086 | 3300005563 | Bacteria | 13598 |
| 126 | Ga0068855_100103090 | 3300005563 | Bacteria | 3283 |
| 127 | Ga0068855_100182725 | 3300005563 | Bacteria | 2370 |
| 128 | Ga0068855_100551094 | 3300005563 | Bacteria | 1248 |
| 129 | Ga0068855_100596962 | 3300005563 | Unclassified | 1191 |
| 130 | Ga0070664_100028967 | 3300005564 | Unclassified | 4613 |
| 131 | Ga0068857_100040374 | 3300005577 | Unclassified | 4138 |
| 132 | Ga0068857_100199467 | 3300005577 | Bacteria | 1824 |
| 133 | Ga0068854_100000122 | 3300005578 | Bacteria | 53557 |
| 134 | Ga0068854_100004655 | 3300005578 | Bacteria | 8657 |
| 135 | Ga0068854_100012486 | 3300005578 | Bacteria | 5565 |
| 136 | Ga0068856_100001532 | 3300005614 | Bacteria | 24221 |
| 137 | Ga0068856_100001724 | 3300005614 | Bacteria | 22874 |
| 138 | Ga0068856_100084818 | 3300005614 | Bacteria | 3147 |
| 139 | Ga0068856_100275654 | 3300005614 | Bacteria | 1698 |
| 140 | Ga0068852_100006220 | 3300005616 | Bacteria | 8608 |
| 141 | Ga0068859_100069216 | 3300005617 | Bacteria | 3564 |
| 142 | Ga0068859_100661688 | 3300005617 | Unclassified | 1136 |
| 143 | Ga0068864_100002560 | 3300005618 | Bacteria | 15015 |
| 144 | Ga0068864_100166538 | 3300005618 | Bacteria | 2007 |
| 145 | Ga0068866_10007100 | 3300005718 | Unclassified | 4682 |
| 146 | Ga0068866_10188617 | 3300005718 | Unclassified | 1223 |
| 147 | Ga0068851_10022899 | 3300005834 | Bacteria | 3049 |
| 148 | Ga0068851_10162447 | 3300005834 | Bacteria | 1228 |
| 149 | Ga0068870_10099249 | 3300005840 | Unclassified | 1642 |
| 150 | Ga0068863_100246309 | 3300005841 | Unclassified | 1726 |
| 151 | Ga0068863_100312803 | 3300005841 | Bacteria | 1525 |
| 152 | Ga0068858_100012338 | 3300005842 | Bacteria | 8057 |
| 153 | Ga0068858_100051663 | 3300005842 | Unclassified | 3803 |
| 154 | Ga0068860_100014915 | 3300005843 | Bacteria | 7599 |
| 155 | Ga0068860_100017349 | 3300005843 | Bacteria | 7014 |
| 156 | Ga0068862_101143201 | 3300005844 | Unclassified | 775 |
| 157 | Ga0081455_10187249 | 3300005937 | Unclassified | 1562 |
| 158 | Ga0070717_10001232 | 3300006028 | Bacteria | 17417 |
| 159 | Ga0070717_10002444 | 3300006028 | Bacteria | 13112 |
| 160 | Ga0070717_10020392 | 3300006028 | Bacteria | 5213 |
| 161 | Ga0070717_10022002 | 3300006028 | Bacteria | 5031 |
| 162 | Ga0070717_10080035 | 3300006028 | Unclassified | 2741 |
| 163 | Ga0070717_10091757 | 3300006028 | Bacteria | 2565 |
| 164 | Ga0070717_10100743 | 3300006028 | Bacteria | 2453 |
| 165 | Ga0070717_10165414 | 3300006028 | Unclassified | 1921 |
| 166 | Ga0070717_10188568 | 3300006028 | Bacteria | 1801 |
| 167 | Ga0070717_10239227 | 3300006028 | Unclassified | 1600 |
| 168 | Ga0070717_10325563 | 3300006028 | Unclassified | 1370 |
| 169 | Ga0070717_10583582 | 3300006028 | Bacteria | 1013 |
| 170 | Ga0070715_10006010 | 3300006163 | Bacteria | 4095 |
| 171 | Ga0070715_10009792 | 3300006163 | Bacteria | 3392 |
| 172 | Ga0070715_10033649 | 3300006163 | Bacteria | 2096 |
| 173 | Ga0070715_10086850 | 3300006163 | Bacteria | 1431 |
| 174 | Ga0070716_100000354 | 3300006173 | Bacteria | 18784 |
| 175 | Ga0070716_100013004 | 3300006173 | Unclassified | 4231 |
| 176 | Ga0070716_100020719 | 3300006173 | Bacteria | 3455 |
| 177 | Ga0070716_100037906 | 3300006173 | Bacteria | 2666 |
| 178 | Ga0070716_100060291 | 3300006173 | Unclassified | 2191 |
| 179 | Ga0070716_100069700 | 3300006173 | Bacteria | 2062 |
| 180 | Ga0070716_100087231 | 3300006173 | Bacteria | 1880 |
| 181 | Ga0070716_100135372 | 3300006173 | Bacteria | 1564 |
| 182 | Ga0070716_100273149 | 3300006173 | Bacteria | 1163 |
| 183 | Ga0070716_100327496 | 3300006173 | Bacteria | 1076 |
| 184 | Ga0070716_100464490 | 3300006173 | Bacteria | 926 |
| 185 | Ga0070712_100006375 | 3300006175 | Bacteria | 7319 |
| 186 | Ga0070712_100023999 | 3300006175 | Bacteria | 4035 |
| 187 | Ga0070712_100033247 | 3300006175 | Bacteria | 3488 |
| 188 | Ga0070712_100034649 | 3300006175 | Bacteria | 3423 |
| 189 | Ga0070712_100063059 | 3300006175 | Unclassified | 2623 |
| 190 | Ga0070712_100127114 | 3300006175 | Unclassified | 1927 |
| 191 | Ga0070712_100135417 | 3300006175 | Bacteria | 1873 |
| 192 | Ga0070712_100291568 | 3300006175 | Unclassified | 1317 |
| 193 | Ga0097621_100000034 | 3300006237 | Bacteria | 69159 |
| 194 | Ga0097621_100019759 | 3300006237 | Bacteria | 5178 |
| 195 | Ga0097621_100026888 | 3300006237 | Unclassified | 4520 |
| 196 | Ga0097621_100067291 | 3300006237 | Bacteria | 2952 |
| 197 | Ga0097621_100420697 | 3300006237 | Unclassified | 1199 |
| 198 | Ga0068871_100000819 | 3300006358 | Bacteria | 20831 |
| 199 | Ga0068871_100008170 | 3300006358 | Bacteria | 7519 |
| 200 | Ga0068871_100145113 | 3300006358 | Bacteria | 2020 |
| 201 | Ga0068871_100170052 | 3300006358 | Unclassified | 1868 |
| 202 | Ga0068871_100213398 | 3300006358 | Bacteria | 1670 |
| 203 | Ga0075430_100190189 | 3300006846 | Unclassified | 1706 |
| 204 | Ga0075431_100140971 | 3300006847 | Unclassified | 2485 |
| 205 | Ga0075433_10004547 | 3300006852 | Bacteria | 10818 |
| 206 | Ga0075433_10008310 | 3300006852 | Bacteria | 8275 |
| 207 | Ga0075433_10498326 | 3300006852 | Bacteria | 1072 |
| 208 | Ga0075434_100000235 | 3300006871 | Bacteria | 38289 |
| 209 | Ga0075434_100004271 | 3300006871 | Bacteria | 12817 |
| 210 | Ga0075434_100020351 | 3300006871 | Bacteria | 6435 |
| 211 | Ga0075434_100033552 | 3300006871 | Bacteria | 5066 |
| 212 | Ga0075434_100232600 | 3300006871 | Bacteria | 1863 |
| 213 | Ga0075429_100029806 | 3300006880 | Bacteria | 4740 |
| 214 | Ga0068865_100299098 | 3300006881 | Bacteria | 1287 |
| 215 | Ga0068865_100531565 | 3300006881 | Unclassified | 985 |
| 216 | Ga0075436_100002580 | 3300006914 | Bacteria | 12453 |
| 217 | Ga0075436_100005980 | 3300006914 | Bacteria | 8355 |
| 218 | Ga0075436_100008969 | 3300006914 | Bacteria | 6844 |
| 219 | Ga0075436_100090790 | 3300006914 | Bacteria | 2124 |
| 220 | Ga0075436_100100340 | 3300006914 | Bacteria | 2016 |
| 221 | Ga0075436_100163182 | 3300006914 | Bacteria | 1571 |
| 222 | Ga0097620_100069219 | 3300006931 | Bacteria | 3564 |
| 223 | Ga0097620_100661662 | 3300006931 | Unclassified | 1136 |
| 224 | Ga0075435_100003821 | 3300007076 | Bacteria | 10277 |
| 225 | Ga0075435_100007962 | 3300007076 | Bacteria | 7584 |
| 226 | Ga0075435_100091169 | 3300007076 | Unclassified | 2515 |
| 227 | Ga0075435_100185332 | 3300007076 | Unclassified | 1760 |
| 228 | Ga0075435_100299519 | 3300007076 | Unclassified | 1375 |
| 229 | Ga0099794_10000033 | 3300007265 | Bacteria | 57721 |
| 230 | Ga0105240_10004264 | 3300009093 | Bacteria | 21862 |
| 231 | Ga0105240_10038089 | 3300009093 | Bacteria | 6172 |
| 232 | Ga0105240_10040354 | 3300009093 | Bacteria | 5971 |
| 233 | Ga0105240_10042413 | 3300009093 | Bacteria | 5798 |
| 234 | Ga0105240_10047360 | 3300009093 | Bacteria | 5441 |
| 235 | Ga0105240_10227221 | 3300009093 | Bacteria | 2171 |
| 236 | Ga0105240_10377040 | 3300009093 | Bacteria | 1603 |
| 237 | Ga0105245_10000411 | 3300009098 | Bacteria | 39875 |
| 238 | Ga0105245_10247513 | 3300009098 | Unclassified | 1731 |
| 239 | Ga0105245_10273445 | 3300009098 | Bacteria | 1648 |
| 240 | Ga0114129_10006148 | 3300009147 | Bacteria | 17029 |
| 241 | Ga0114129_10074350 | 3300009147 | Unclassified | 4733 |
| 242 | Ga0114129_10098137 | 3300009147 | Bacteria | 4055 |
| 243 | Ga0114129_10599373 | 3300009147 | Bacteria | 1427 |
| 244 | Ga0105241_10008117 | 3300009174 | Bacteria | 7728 |
| 245 | Ga0105241_10039967 | 3300009174 | Unclassified | 3539 |
| 246 | Ga0105241_10328312 | 3300009174 | Bacteria | 1321 |
| 247 | Ga0105241_10335533 | 3300009174 | Bacteria | 1308 |
| 248 | Ga0105242_10076575 | 3300009176 | Bacteria | 2789 |
| 249 | Ga0105242_10143932 | 3300009176 | Unclassified | 2072 |
| 250 | Ga0105248_10011027 | 3300009177 | Bacteria | 9969 |
| 251 | Ga0105248_10044402 | 3300009177 | Bacteria | 4984 |
| 252 | Ga0105248_10069980 | 3300009177 | Unclassified | 3940 |
| 253 | Ga0105248_10161420 | 3300009177 | Bacteria | 2528 |
| 254 | Ga0105248_10399384 | 3300009177 | Bacteria | 1548 |
| 255 | Ga0105248_10571794 | 3300009177 | Bacteria | 1275 |
| 256 | Ga0105248_10957926 | 3300009177 | Bacteria | 966 |
| 257 | Ga0105237_10014906 | 3300009545 | Bacteria | 8105 |
| 258 | Ga0105237_10038741 | 3300009545 | Bacteria | 4813 |
| 259 | Ga0105237_10244648 | 3300009545 | Unclassified | 1795 |
| 260 | Ga0105237_10340471 | 3300009545 | Bacteria | 1504 |
| 261 | Ga0105237_10484699 | 3300009545 | Bacteria | 1243 |
| 262 | Ga0105238_10034553 | 3300009551 | Bacteria | 5143 |
| 263 | Ga0105238_10036544 | 3300009551 | Bacteria | 4994 |
| 264 | Ga0105249_10017407 | 3300009553 | Bacteria | 6380 |
| 265 | Ga0105249_10525858 | 3300009553 | Bacteria | 1231 |
| 266 | Ga0099796_10045110 | 3300010159 | Bacteria | 1509 |
| 267 | Ga0105239_10021480 | 3300010375 | Bacteria | 7116 |
| 268 | Ga0105239_10095242 | 3300010375 | Unclassified | 3289 |
| 269 | Ga0105239_10204751 | 3300010375 | Bacteria | 2211 |
| 270 | Ga0105239_10270453 | 3300010375 | Bacteria | 1911 |
| 271 | Ga0105246_10020182 | 3300011119 | Unclassified | 4272 |
| 272 | Ga0157373_10007167 | 3300013100 | Bacteria | 8319 |
| 273 | Ga0157371_10138302 | 3300013102 | Bacteria | 1735 |
| 274 | Ga0157370_10002484 | 3300013104 | Bacteria | 22231 |
| 275 | Ga0157370_10581091 | 3300013104 | Unclassified | 1026 |
| 276 | Ga0157370_10582087 | 3300013104 | Bacteria | 1025 |
| 277 | Ga0157369_10010669 | 3300013105 | Bacteria | 10456 |
| 278 | Ga0157369_10119097 | 3300013105 | Unclassified | 2802 |
| 279 | Ga0157369_10155259 | 3300013105 | Bacteria | 2418 |
| 280 | Ga0157369_10399861 | 3300013105 | Bacteria | 1425 |
| 281 | Ga0157374_10000249 | 3300013296 | Bacteria | 49808 |
| 282 | Ga0157374_10000787 | 3300013296 | Bacteria | 27777 |
| 283 | Ga0157374_10009849 | 3300013296 | Bacteria | 8202 |
| 284 | Ga0157374_10128064 | 3300013296 | Unclassified | 2455 |
| 285 | Ga0157374_10136988 | 3300013296 | Bacteria | 2374 |
| 286 | Ga0157374_10731504 | 3300013296 | Unclassified | 1003 |
| 287 | Ga0157378_10000008 | 3300013297 | Bacteria | 162605 |
| 288 | Ga0157378_10001217 | 3300013297 | Bacteria | 23322 |
| 289 | Ga0157378_10003381 | 3300013297 | Bacteria | 14183 |
| 290 | Ga0157378_10011452 | 3300013297 | Bacteria | 7761 |
| 291 | Ga0157378_10038080 | 3300013297 | Unclassified | 4261 |
| 292 | Ga0163162_10008783 | 3300013306 | Bacteria | 9822 |
| 293 | Ga0157372_10000436 | 3300013307 | Bacteria | 45959 |
| 294 | Ga0157372_10000992 | 3300013307 | Bacteria | 31047 |
| 295 | Ga0157372_10030521 | 3300013307 | Bacteria | 5897 |
| 296 | Ga0157372_10141022 | 3300013307 | Bacteria | 2776 |
| 297 | Ga0157375_10024068 | 3300013308 | Bacteria | 5630 |
| 298 | Ga0157375_10117717 | 3300013308 | Bacteria | 2763 |
| 299 | Ga0157375_10813244 | 3300013308 | Unclassified | 1083 |
| 300 | Ga0163163_10018345 | 3300014325 | Bacteria | 6548 |
| 301 | Ga0163163_10064958 | 3300014325 | Bacteria | 3621 |
| 302 | Ga0163163_10186746 | 3300014325 | Bacteria | 2120 |
| 303 | Ga0163163_10239781 | 3300014325 | Bacteria | 1863 |
| 304 | Ga0182008_10021637 | 3300014497 | Bacteria | 3302 |
| 305 | Ga0157379_10003566 | 3300014968 | Bacteria | 13181 |
| 306 | Ga0157376_10001493 | 3300014969 | Bacteria | 15434 |
| 307 | Ga0157376_10002140 | 3300014969 | Bacteria | 13309 |
| 308 | Ga0157376_10088787 | 3300014969 | Unclassified | 2671 |
| 309 | Ga0182006_1046599 | 3300015261 | Bacteria | 1684 |
| 310 | Ga0182007_10028080 | 3300015262 | Bacteria | 1935 |
| 311 | Ga0182005_1011524 | 3300015265 | Bacteria | 2518 |
| 312 | Ga0213873_10074341 | 3300021358 | Unclassified | 941 |
| 313 | Ga0213872_10001338 | 3300021361 | Bacteria | 16267 |
| 314 | Ga0213872_10001709 | 3300021361 | Bacteria | 13824 |
| 315 | Ga0213872_10002491 | 3300021361 | Bacteria | 10775 |
| 316 | Ga0213872_10031819 | 3300021361 | Bacteria | 2418 |
| 317 | Ga0213872_10045545 | 3300021361 | Bacteria | 1996 |
| 318 | Ga0213872_10094590 | 3300021361 | Bacteria | 1335 |
| 319 | Ga0213872_10104727 | 3300021361 | Bacteria | 1259 |
| 320 | Ga0213876_10056935 | 3300021384 | Bacteria | 2064 |
| 321 | Ga0213875_10009771 | 3300021388 | Bacteria | 4843 |
| 322 | Ga0213875_10080460 | 3300021388 | Bacteria | 1520 |
| 323 | Ga0213875_10223533 | 3300021388 | Unclassified | 887 |
| 324 | Ga0213871_10008210 | 3300021441 | Bacteria | 2292 |
| 325 | Ga0228598_1001283 | 3300024227 | Bacteria | 5531 |
| 326 | Ga0207656_10072300 | 3300025321 | Bacteria | 1535 |
| 327 | Ga0207656_10091279 | 3300025321 | Bacteria | 1383 |
| 328 | Ga0207692_10003006 | 3300025898 | Bacteria | 6536 |
| 329 | Ga0207692_10040499 | 3300025898 | Bacteria | 2299 |
| 330 | Ga0207692_10086083 | 3300025898 | Bacteria | 1692 |
| 331 | Ga0207692_10106975 | 3300025898 | Bacteria | 1545 |
| 332 | Ga0207642_10167351 | 3300025899 | Unclassified | 1186 |
| 333 | Ga0207680_10112310 | 3300025903 | Unclassified | 1769 |
| 334 | Ga0207647_10006284 | 3300025904 | Bacteria | 8650 |
| 335 | Ga0207685_10006465 | 3300025905 | Bacteria | 3193 |
| 336 | Ga0207685_10013507 | 3300025905 | Bacteria | 2528 |
| 337 | Ga0207685_10020451 | 3300025905 | Unclassified | 2200 |
| 338 | Ga0207699_10011334 | 3300025906 | Bacteria | 4498 |
| 339 | Ga0207699_10015299 | 3300025906 | Unclassified | 3981 |
| 340 | Ga0207699_10089353 | 3300025906 | Bacteria | 1931 |
| 341 | Ga0207699_10117445 | 3300025906 | Bacteria | 1715 |
| 342 | Ga0207699_10213385 | 3300025906 | Bacteria | 1314 |
| 343 | Ga0207699_10471827 | 3300025906 | Unclassified | 903 |
| 344 | Ga0207645_10096239 | 3300025907 | Bacteria | 1907 |
| 345 | Ga0207705_10190255 | 3300025909 | Bacteria | 1552 |
| 346 | Ga0207684_10000973 | 3300025910 | Bacteria | 32084 |
| 347 | Ga0207684_10002906 | 3300025910 | Bacteria | 16981 |
| 348 | Ga0207684_10125543 | 3300025910 | Bacteria | 2202 |
| 349 | Ga0207654_10008704 | 3300025911 | Bacteria | 5144 |
| 350 | Ga0207707_10015200 | 3300025912 | Bacteria | 6702 |
| 351 | Ga0207707_10029186 | 3300025912 | Bacteria | 4821 |
| 352 | Ga0207707_10086116 | 3300025912 | Bacteria | 2746 |
| 353 | Ga0207707_10150117 | 3300025912 | Bacteria | 2038 |
| 354 | Ga0207695_10005455 | 3300025913 | Bacteria | 16847 |
| 355 | Ga0207695_10009167 | 3300025913 | Bacteria | 12278 |
| 356 | Ga0207695_10025939 | 3300025913 | Bacteria | 6549 |
| 357 | Ga0207695_10107005 | 3300025913 | Bacteria | 2782 |
| 358 | Ga0207671_10096036 | 3300025914 | Bacteria | 2239 |
| 359 | Ga0207693_10002464 | 3300025915 | Bacteria | 16079 |
| 360 | Ga0207693_10005557 | 3300025915 | Bacteria | 10490 |
| 361 | Ga0207693_10007800 | 3300025915 | Bacteria | 8785 |
| 362 | Ga0207693_10013939 | 3300025915 | Bacteria | 6473 |
| 363 | Ga0207693_10015230 | 3300025915 | Bacteria | 6172 |
| 364 | Ga0207693_10032918 | 3300025915 | Bacteria | 4091 |
| 365 | Ga0207693_10038900 | 3300025915 | Bacteria | 3744 |
| 366 | Ga0207693_10130900 | 3300025915 | Bacteria | 1972 |
| 367 | Ga0207693_10434100 | 3300025915 | Unclassified | 1027 |
| 368 | Ga0207663_10000965 | 3300025916 | Bacteria | 13150 |
| 369 | Ga0207663_10012760 | 3300025916 | Unclassified | 4551 |
| 370 | Ga0207663_10066743 | 3300025916 | Unclassified | 2304 |
| 371 | Ga0207663_10491865 | 3300025916 | Unclassified | 952 |
| 372 | Ga0207663_10669175 | 3300025916 | Unclassified | 820 |
| 373 | Ga0207660_10267115 | 3300025917 | Bacteria | 1354 |
| 374 | Ga0207657_10001667 | 3300025919 | Bacteria | 23967 |
| 375 | Ga0207657_10010205 | 3300025919 | Bacteria | 9383 |
| 376 | Ga0207649_10065523 | 3300025920 | Bacteria | 2300 |
| 377 | Ga0207649_10088524 | 3300025920 | Bacteria | 2022 |
| 378 | Ga0207652_10083234 | 3300025921 | Unclassified | 2801 |
| 379 | Ga0207652_10123880 | 3300025921 | Bacteria | 2301 |
| 380 | Ga0207652_10263798 | 3300025921 | Unclassified | 1554 |
| 381 | Ga0207652_10311790 | 3300025921 | Unclassified | 1420 |
| 382 | Ga0207646_10006332 | 3300025922 | Bacteria | 12262 |
| 383 | Ga0207646_10007050 | 3300025922 | Bacteria | 11497 |
| 384 | Ga0207646_10045458 | 3300025922 | Bacteria | 3942 |
| 385 | Ga0207646_10105087 | 3300025922 | Bacteria | 2532 |
| 386 | Ga0207646_10171569 | 3300025922 | Bacteria | 1959 |
| 387 | Ga0207646_10332408 | 3300025922 | Unclassified | 1373 |
| 388 | Ga0207681_10303896 | 3300025923 | Unclassified | 1263 |
| 389 | Ga0207694_10063306 | 3300025924 | Bacteria | 2881 |
| 390 | Ga0207694_10092037 | 3300025924 | Bacteria | 2393 |
| 391 | Ga0207650_10672896 | 3300025925 | Bacteria | 873 |
| 392 | Ga0207659_10433059 | 3300025926 | Unclassified | 1105 |
| 393 | Ga0207687_10000141 | 3300025927 | Bacteria | 48006 |
| 394 | Ga0207700_10006490 | 3300025928 | Bacteria | 7068 |
| 395 | Ga0207700_10008629 | 3300025928 | Bacteria | 6326 |
| 396 | Ga0207700_10018967 | 3300025928 | Bacteria | 4637 |
| 397 | Ga0207700_10028873 | 3300025928 | Unclassified | 3908 |
| 398 | Ga0207700_10028932 | 3300025928 | Bacteria | 3905 |
| 399 | Ga0207700_10112223 | 3300025928 | Bacteria | 2196 |
| 400 | Ga0207700_10185866 | 3300025928 | Bacteria | 1743 |
| 401 | Ga0207700_10247750 | 3300025928 | Unclassified | 1521 |
| 402 | Ga0207700_10326187 | 3300025928 | Unclassified | 1332 |
| 403 | Ga0207700_10468180 | 3300025928 | Bacteria | 1112 |
| 404 | Ga0207700_10586354 | 3300025928 | Unclassified | 992 |
| 405 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 406 | Ga0207664_10050872 | 3300025929 | Bacteria | 3269 |
| 407 | Ga0207664_10136687 | 3300025929 | Bacteria | 2069 |
| 408 | Ga0207664_10142917 | 3300025929 | Unclassified | 2026 |
| 409 | Ga0207664_10159823 | 3300025929 | Bacteria | 1921 |
| 410 | Ga0207664_10388694 | 3300025929 | Unclassified | 1239 |
| 411 | Ga0207664_10466259 | 3300025929 | Bacteria | 1129 |
| 412 | Ga0207664_10646445 | 3300025929 | Bacteria | 950 |
| 413 | Ga0207664_10740070 | 3300025929 | Bacteria | 884 |
| 414 | Ga0207644_10017386 | 3300025931 | Unclassified | 4855 |
| 415 | Ga0207644_10127442 | 3300025931 | Bacteria | 1944 |
| 416 | Ga0207644_10175159 | 3300025931 | Bacteria | 1678 |
| 417 | Ga0207690_10006731 | 3300025932 | Bacteria | 6811 |
| 418 | Ga0207690_10118299 | 3300025932 | Unclassified | 1920 |
| 419 | Ga0207706_10009258 | 3300025933 | Bacteria | 9050 |
| 420 | Ga0207706_10016470 | 3300025933 | Bacteria | 6671 |
| 421 | Ga0207686_10624807 | 3300025934 | Unclassified | 850 |
| 422 | Ga0207709_10354244 | 3300025935 | Unclassified | 1109 |
| 423 | Ga0207704_10069593 | 3300025938 | Bacteria | 2224 |
| 424 | Ga0207704_10109315 | 3300025938 | Unclassified | 1864 |
| 425 | Ga0207665_10000596 | 3300025939 | Bacteria | 24294 |
| 426 | Ga0207665_10008819 | 3300025939 | Bacteria | 6629 |
| 427 | Ga0207665_10014915 | 3300025939 | Bacteria | 5105 |
| 428 | Ga0207665_10021588 | 3300025939 | Unclassified | 4235 |
| 429 | Ga0207665_10052040 | 3300025939 | Bacteria | 2758 |
| 430 | Ga0207665_10084007 | 3300025939 | Unclassified | 2197 |
| 431 | Ga0207665_10095860 | 3300025939 | Unclassified | 2063 |
| 432 | Ga0207665_10184528 | 3300025939 | Bacteria | 1512 |
| 433 | Ga0207665_10315896 | 3300025939 | Bacteria | 1171 |
| 434 | Ga0207711_10062942 | 3300025941 | Bacteria | 3202 |
| 435 | Ga0207711_10779816 | 3300025941 | Bacteria | 890 |
| 436 | Ga0207689_10095246 | 3300025942 | Bacteria | 2445 |
| 437 | Ga0207661_10001952 | 3300025944 | Bacteria | 14178 |
| 438 | Ga0207661_10005239 | 3300025944 | Bacteria | 9117 |
| 439 | Ga0207661_10147408 | 3300025944 | Bacteria | 2032 |
| 440 | Ga0207661_10430664 | 3300025944 | Unclassified | 1199 |
| 441 | Ga0207679_10011893 | 3300025945 | Bacteria | 5657 |
| 442 | Ga0207679_10191162 | 3300025945 | Bacteria | 1702 |
| 443 | Ga0207667_10001192 | 3300025949 | Bacteria | 32605 |
| 444 | Ga0207667_10001239 | 3300025949 | Bacteria | 32026 |
| 445 | Ga0207667_10187553 | 3300025949 | Bacteria | 2123 |
| 446 | Ga0207667_10210046 | 3300025949 | Bacteria | 1995 |
| 447 | Ga0207667_10219774 | 3300025949 | Bacteria | 1947 |
| 448 | Ga0207667_10262487 | 3300025949 | Bacteria | 1766 |
| 449 | Ga0207640_10000057 | 3300025981 | Bacteria | 93580 |
| 450 | Ga0207640_10000158 | 3300025981 | Bacteria | 49097 |
| 451 | Ga0207640_10004462 | 3300025981 | Bacteria | 7584 |
| 452 | Ga0207640_10068667 | 3300025981 | Bacteria | 2376 |
| 453 | Ga0207658_10009142 | 3300025986 | Bacteria | 6722 |
| 454 | Ga0207677_10068958 | 3300026023 | Bacteria | 2485 |
| 455 | Ga0207703_10110369 | 3300026035 | Unclassified | 2346 |
| 456 | Ga0207639_10000016 | 3300026041 | Bacteria | 262939 |
| 457 | Ga0207639_10225636 | 3300026041 | Unclassified | 1621 |
| 458 | Ga0207678_10000903 | 3300026067 | Bacteria | 27239 |
| 459 | Ga0207678_10081936 | 3300026067 | Unclassified | 2761 |
| 460 | Ga0207678_10221465 | 3300026067 | Unclassified | 1620 |
| 461 | Ga0207702_10001513 | 3300026078 | Bacteria | 22979 |
| 462 | Ga0207702_10002159 | 3300026078 | Bacteria | 18888 |
| 463 | Ga0207702_10016811 | 3300026078 | Bacteria | 6055 |
| 464 | Ga0207702_10172398 | 3300026078 | Bacteria | 1985 |
| 465 | Ga0207702_10224439 | 3300026078 | Unclassified | 1752 |
| 466 | Ga0207702_10306028 | 3300026078 | Unclassified | 1510 |
| 467 | Ga0207702_10384566 | 3300026078 | Unclassified | 1350 |
| 468 | Ga0207641_10088629 | 3300026088 | Bacteria | 2702 |
| 469 | Ga0207641_10176111 | 3300026088 | Bacteria | 1956 |
| 470 | Ga0207641_10382407 | 3300026088 | Bacteria | 1348 |
| 471 | Ga0207641_11084520 | 3300026088 | Unclassified | 799 |
| 472 | Ga0207648_10005015 | 3300026089 | Bacteria | 13446 |
| 473 | Ga0207648_10010627 | 3300026089 | Bacteria | 8702 |
| 474 | Ga0207674_10044672 | 3300026116 | Bacteria | 4563 |
| 475 | Ga0207674_10047118 | 3300026116 | Unclassified | 4422 |
| 476 | Ga0207683_10015510 | 3300026121 | Bacteria | 6487 |
| 477 | Ga0207698_10053084 | 3300026142 | Unclassified | 3109 |
| 478 | Ga0207698_10517645 | 3300026142 | Bacteria | 1164 |
| 479 | Ga0209588_1000006 | 3300027671 | Bacteria | 184445 |
| 480 | Ga0209588_1009128 | 3300027671 | Unclassified | 2957 |
| 481 | Ga0209588_1010182 | 3300027671 | Bacteria | 2823 |
| 482 | Ga0268266_10007114 | 3300028379 | Bacteria | 10150 |
| 483 | Ga0268266_10120259 | 3300028379 | Unclassified | 2337 |
| 484 | Ga0268265_10918769 | 3300028380 | Unclassified | 860 |
| 485 | Ga0268264_10010932 | 3300028381 | Bacteria | 7498 |
| 486 | Ga0265762_1004191 | 3300030760 | Bacteria | 2584 |
| 487 | Ga0265762_1016240 | 3300030760 | Bacteria | 1350 |
| 488 | Ga0265763_1009638 | 3300030763 | Bacteria | 881 |
| 489 | Ga0265770_1013007 | 3300030878 | Unclassified | 1239 |
| 490 | Ga0265760_10004082 | 3300031090 | Unclassified | 4207 |
| 491 | Ga0265760_10005650 | 3300031090 | Bacteria | 3579 |
| 492 | Ga0265760_10010730 | 3300031090 | Bacteria | 2617 |
| 493 | Ga0265760_10015676 | 3300031090 | Bacteria | 2174 |
| 494 | Ga0265760_10042346 | 3300031090 | Bacteria | 1359 |
| 495 | Ga0265760_10094101 | 3300031090 | Unclassified | 941 |
| 496 | Ga0265760_10132109 | 3300031090 | Bacteria | 808 |
| 497 | Ga0373926_0000619 | 3300035083 | Bacteria | 9661 |
| 498 | Ga0373926_0001291 | 3300035083 | Bacteria | 7536 |
| 499 | Ga0373926_0017249 | 3300035083 | Unclassified | 2477 |
| 500 | Ga0373934_0000830 | 3300035086 | Bacteria | 11167 |
| 501 | Ga0373934_0036650 | 3300035086 | Bacteria | 1932 |
| 502 | Ga0373944_0043642 | 3300035089 | Unclassified | 1394 |
| 503 | Ga0373923_0077297 | 3300035111 | Bacteria | 1439 |
| 504 | Ga0373936_0009809 | 3300035113 | Bacteria | 3614 |
| 505 | Ga0373953_0004359 | 3300035117 | Unclassified | 4506 |
| 506 | Ga0373954_0000402 | 3300035118 | Bacteria | 16198 |
| 507 | Ga0373954_0011555 | 3300035118 | Bacteria | 3915 |
| 508 | Ga0373954_0163616 | 3300035118 | Bacteria | 1089 |
| 509 | Ga0373956_0035799 | 3300035119 | Unclassified | 2190 |
| 510 | Ga0373956_0047938 | 3300035119 | Bacteria | 1912 |
| 511 | Ga0373957_0055850 | 3300035120 | Unclassified | 1519 |
| 512 | Ga0373943_0000093 | 3300035170 | Bacteria | 32989 |
| 513 | Ga0373943_0065347 | 3300035170 | Bacteria | 1829 |
| 514 | Ga0373943_0078696 | 3300035170 | Bacteria | 1686 |
| 515 | Ga0373946_0001175 | 3300035171 | Bacteria | 9070 |
| 516 | Ga0373946_0040162 | 3300035171 | Bacteria | 1913 |
| 517 | Ga0373946_0218051 | 3300035171 | Bacteria | 920 |
| 518 | Ga0373955_0013271 | 3300035172 | Bacteria | 3979 |
| 519 | Ga0373955_0142455 | 3300035172 | Unclassified | 1406 |
| 520 | Ga0373942_0034388 | 3300035207 | Unclassified | 1356 |
| 521 | Ga0373924_0023109 | 3300035410 | Unclassified | 2435 |
| 522 | Ga0373931_0011405 | 3300035691 | Unclassified | 4294 |
| 523 | Ga0373935_0000406 | 3300035692 | Bacteria | 22423 |
| 524 | Ga0373935_0045385 | 3300035692 | Bacteria | 2773 |
| 525 | Ga0373927_0000351 | 3300035695 | Bacteria | 36072 |
| 526 | Ga0373927_0005076 | 3300035695 | Bacteria | 9107 |
| 527 | Ga0373927_0009237 | 3300035695 | Bacteria | 6613 |
| 528 | Ga0373927_0038721 | 3300035695 | Bacteria | 3095 |
| 529 | Ga0373927_0057875 | 3300035695 | Bacteria | 2506 |
| 530 | Ga0373927_0067963 | 3300035695 | Bacteria | 2306 |
| 531 | Ga0373933_0000375 | 3300035724 | Bacteria | 28675 |
| 532 | Ga0373933_0010901 | 3300035724 | Bacteria | 4991 |
| 533 | Ga0373947_0003946 | 3300035725 | Bacteria | 8720 |
| 534 | Ga0373947_0015910 | 3300035725 | Bacteria | 4321 |
| 535 | Ga0373947_0022859 | 3300035725 | Unclassified | 3629 |
| 536 | Ga0373947_0135446 | 3300035725 | Bacteria | 1575 |
| 537 | Ga0373937_0000082 | 3300036401 | Bacteria | 87971 |
| 538 | Ga0373937_0003011 | 3300036401 | Bacteria | 14130 |
| 539 | Ga0373937_0009898 | 3300036401 | Bacteria | 8312 |
| 540 | Ga0373937_0044675 | 3300036401 | Bacteria | 4047 |
| 541 | Ga0373937_0078351 | 3300036401 | Bacteria | 3054 |
| 542 | Ga0373937_0258866 | 3300036401 | Bacteria | 1641 |
| 543 | Ga0373925_0001716 | 3300037068 | Bacteria | 18475 |
| 544 | Ga0373925_0007208 | 3300037068 | Bacteria | 8128 |
| 545 | Ga0373925_0007869 | 3300037068 | Bacteria | 7763 |
| 546 | Ga0373925_0023003 | 3300037068 | Bacteria | 4548 |
| 547 | Ga0373925_0517547 | 3300037068 | Unclassified | 980 |
| 548 | Ga0395900_0173907 | 3300037418 | Unclassified | 2191 |
| 549 | Ga0395898_0247788 | 3300037466 | Unclassified | 1699 |
| 550 | Ga0436364_0042355 | 3300037853 | Unclassified | 4466 |
| 551 | Ga0436364_0524449 | 3300037853 | Unclassified | 3644 |
| 552 | Ga0436364_0868968 | 3300037853 | Bacteria | 1365 |
| 553 | Ga0436364_1479972 | 3300037853 | Bacteria | 8306 |
| 554 | Ga0395901_0069456 | 3300038443 | Bacteria | 3669 |
| 555 | Ga0395901_0667415 | 3300038443 | Unclassified | 1041 |
| 556 | Ga0242420_030418 | 3300038996 | Bacteria | 1000 |
| 557 | Ga0436365_0031849 | 3300039437 | Bacteria | 47942 |
| 558 | Ga0436365_1035977 | 3300039437 | Bacteria | 3956 |
| 559 | Ga0436365_1116478 | 3300039437 | Bacteria | 7415 |
| 560 | Ga0436360_0680576 | 3300039438 | Bacteria | 8776 |
| 561 | Ga0436360_1228382 | 3300039438 | Bacteria | 4781 |
| 562 | Ga0436361_0091471 | 3300039447 | Bacteria | 5518 |
| 563 | Ga0436361_0169123 | 3300039447 | Bacteria | 4146 |
| 564 | Ga0436361_0400616 | 3300039447 | Bacteria | 83329 |
| 565 | Ga0436361_0502041 | 3300039447 | Unclassified | 990 |
| 566 | Ga0436361_0672781 | 3300039447 | Unclassified | 3722 |
| 567 | Ga0436361_0705926 | 3300039447 | Bacteria | 3484 |
| 568 | Ga0436361_0775789 | 3300039447 | Unclassified | 2270 |
| 569 | Ga0436361_0797421 | 3300039447 | Bacteria | 2176 |
| 570 | Ga0436361_0875242 | 3300039447 | Unclassified | 1180 |
| 571 | Ga0436363_0436454 | 3300039450 | Bacteria | 3703 |
| 572 | Ga0436363_0493680 | 3300039450 | Unclassified | 3630 |
| 573 | Ga0436363_0875210 | 3300039450 | Bacteria | 2001 |
| 574 | Ga0436363_1630748 | 3300039450 | Unclassified | 1229 |
| 575 | Ga0436362_0092701 | 3300039453 | Bacteria | 1580 |
| 576 | Ga0436362_0405422 | 3300039453 | Bacteria | 2604 |
| 577 | Ga0436362_0539068 | 3300039453 | Bacteria | 6207 |
| 578 | Ga0451577_0081585 | 3300042876 | Bacteria | 2885 |
| 579 | Ga0451577_0330959 | 3300042876 | Bacteria | 1381 |
| 580 | Ga0453683_0218324 | 3300044673 | Unclassified | 1212 |
| 581 | Ga0466964_0211108 | 3300044706 | Unclassified | 937 |
| 582 | Ga0453684_0062176 | 3300044712 | Bacteria | 4785 |
| 583 | Ga0453684_0285831 | 3300044712 | Bacteria | 1879 |
| 584 | Ga0453684_0864965 | 3300044712 | Bacteria | 971 |
| 585 | Ga0451576_0112174 | 3300045051 | Bacteria | 2838 |
| 586 | Ga0451576_0413200 | 3300045051 | Unclassified | 1415 |
| 587 | Ga0451576_0591900 | 3300045051 | Unclassified | 1166 |
| 588 | Ga0451576_0631099 | 3300045051 | Unclassified | 1126 |
| 589 | Ga0466967_0009451 | 3300045976 | Bacteria | 7233 |
| 590 | Ga0466967_0127475 | 3300045976 | Bacteria | 2359 |
| 591 | Ga0466967_0715932 | 3300045976 | Unclassified | 992 |
| 592 | Ga0495592_0046432 | 3300046454 | Bacteria | 3238 |
| 593 | Ga0495629_0054939 | 3300046459 | Bacteria | 2785 |
| 594 | Ga0495651_0239363 | 3300046462 | Unclassified | 1246 |
| 595 | Ga0495653_0044063 | 3300046463 | Bacteria | 3465 |
| 596 | Ga0495580_0004001 | 3300046472 | Bacteria | 12437 |
| 597 | Ga0495580_0006097 | 3300046472 | Bacteria | 9858 |
| 598 | Ga0495580_0051162 | 3300046472 | Bacteria | 2921 |
| 599 | Ga0495580_0085653 | 3300046472 | Unclassified | 2195 |
| 600 | Ga0495582_0010407 | 3300046473 | Bacteria | 5116 |
| 601 | Ga0495582_0024529 | 3300046473 | Bacteria | 3300 |
| 602 | Ga0495639_0037357 | 3300046475 | Bacteria | 2176 |
| 603 | Ga0495664_0064965 | 3300046477 | Unclassified | 2175 |
| 604 | Ga0495664_0068823 | 3300046477 | Unclassified | 2113 |
| 605 | Ga0495594_0041072 | 3300046499 | Bacteria | 2533 |
| 606 | Ga0495608_0015490 | 3300046511 | Bacteria | 5288 |
| 607 | Ga0495628_0161288 | 3300046516 | Bacteria | 1704 |
| 608 | Ga0495630_0005548 | 3300046517 | Bacteria | 8904 |
| 609 | Ga0495630_0046166 | 3300046517 | Bacteria | 3256 |
| 610 | Ga0495630_0269710 | 3300046517 | Bacteria | 1300 |
| 611 | Ga0495666_0038176 | 3300046526 | Bacteria | 2336 |
| 612 | Ga0495666_0102548 | 3300046526 | Bacteria | 1348 |
| 613 | Ga0495652_0293184 | 3300046529 | Unclassified | 1186 |
| 614 | Ga0495665_0005685 | 3300046531 | Bacteria | 6729 |
| 615 | Ga0495665_0010204 | 3300046531 | Bacteria | 5089 |
| 616 | Ga0495665_0043956 | 3300046531 | Unclassified | 2375 |
| 617 | Ga0495640_0010896 | 3300046533 | Bacteria | 7008 |
| 618 | Ga0495586_0055264 | 3300046535 | Bacteria | 2151 |
| 619 | Ga0495587_0003381 | 3300046536 | Bacteria | 10641 |
| 620 | Ga0495587_0219283 | 3300046536 | Bacteria | 1073 |
| 621 | Ga0495645_0081315 | 3300046543 | Unclassified | 2324 |
| 622 | Ga0495622_0169289 | 3300046557 | Unclassified | 983 |
| 623 | Ga0495667_0040669 | 3300046559 | Unclassified | 3086 |
| 624 | Ga0495635_0042731 | 3300046663 | Unclassified | 3129 |
| 625 | Ga0495635_0080644 | 3300046663 | Bacteria | 2227 |
| 626 | Ga0495623_0106551 | 3300046679 | Unclassified | 1703 |
| 627 | Ga0495623_0256534 | 3300046679 | Bacteria | 981 |
| 628 | Ga0495647_0004251 | 3300046681 | Bacteria | 4638 |
| 629 | Ga0495658_0008227 | 3300046683 | Bacteria | 5167 |
| 630 | Ga0495613_0068203 | 3300046689 | Bacteria | 2594 |
| 631 | Ga0495624_0044011 | 3300046690 | Unclassified | 2847 |
| 632 | Ga0495670_0174275 | 3300046691 | Bacteria | 1134 |
| 633 | Ga0495604_0000235 | 3300047317 | Bacteria | 49754 |
| 634 | Ga0495674_0031040 | 3300047319 | Bacteria | 4856 |
| 635 | Ga0495674_0060600 | 3300047319 | Bacteria | 3301 |
| 636 | Ga0495674_0092937 | 3300047319 | Bacteria | 2575 |
| 637 | Ga0495674_0099208 | 3300047319 | Bacteria | 2480 |
| 638 | Ga0495676_0024901 | 3300047321 | Bacteria | 5172 |
| 639 | Ga0495676_0138852 | 3300047321 | Bacteria | 1744 |
| 640 | Ga0495676_0146067 | 3300047321 | Bacteria | 1689 |
| 641 | Ga0495675_0168846 | 3300047444 | Bacteria | 1344 |
| 642 | Ga0495684_0023950 | 3300047471 | Unclassified | 4695 |
| 643 | Ga0495684_0082815 | 3300047471 | Bacteria | 2434 |
| 644 | Ga0495602_0055071 | 3300048088 | Unclassified | 3505 |
| 645 | Ga0495614_0026234 | 3300048089 | Bacteria | 2511 |
| 646 | Ga0496100_0018636 | 3300048903 | Unclassified | 4122 |
| 647 | Ga0496100_0395855 | 3300048903 | Unclassified | 1051 |
| 648 | Ga0496100_0599525 | 3300048903 | Unclassified | 855 |
| 649 | Ga0496101_0024720 | 3300048904 | Bacteria | 4161 |
| 650 | Ga0496101_0081636 | 3300048904 | Unclassified | 2392 |
| 651 | Ga0496101_0120502 | 3300048904 | Bacteria | 1983 |
| 652 | Ga0496102_0003254 | 3300048905 | Bacteria | 13781 |
| 653 | Ga0496102_0073061 | 3300048905 | Unclassified | 3153 |
| 654 | Ga0496103_0027212 | 3300048906 | Bacteria | 3463 |
| 655 | Ga0496103_0046043 | 3300048906 | Bacteria | 2692 |
| 656 | Ga0496104_0021762 | 3300048907 | Bacteria | 5889 |
| 657 | Ga0496105_0040427 | 3300048908 | Bacteria | 3845 |
| 658 | Ga0496105_0722410 | 3300048908 | Bacteria | 763 |
| 659 | Ga0496106_0354205 | 3300048909 | Unclassified | 1179 |
| 660 | Ga0496108_0169891 | 3300048911 | Bacteria | 1886 |
| 661 | Ga0496109_0038109 | 3300048912 | Bacteria | 4345 |
| 662 | Ga0496109_0153116 | 3300048912 | Bacteria | 2159 |
| 663 | Ga0496111_0051037 | 3300048914 | Bacteria | 2986 |
| 664 | Ga0496112_0001829 | 3300048915 | Bacteria | 16733 |
| 665 | Ga0496112_0021016 | 3300048915 | Bacteria | 6200 |
| 666 | Ga0496112_0096825 | 3300048915 | Bacteria | 2921 |
| 667 | Ga0496112_0109408 | 3300048915 | Unclassified | 2733 |
| 668 | Ga0496112_0317599 | 3300048915 | Bacteria | 1502 |
| 669 | Ga0496115_0042209 | 3300048918 | Bacteria | 3633 |
| 670 | Ga0496115_0482676 | 3300048918 | Unclassified | 998 |
| 671 | nmdc:mga05p37_42655_c1 | 3300050507 | Bacteria | 5576 |
| 672 | nmdc:mga06r32_214002_c1 | 3300050510 | Unclassified | 1915 |
| 673 | nmdc:mga08y16_384683_c1 | 3300050511 | Bacteria | 1438 |
| 674 | nmdc:mga0n895_119480_c1 | 3300050512 | Bacteria | 2656 |
| 675 | nmdc:mga0n895_129088_c1 | 3300050512 | Bacteria | 2552 |
| 676 | nmdc:mga0n895_17170_c1 | 3300050512 | Bacteria | 6668 |
| 677 | nmdc:mga0n895_4333_c1 | 3300050512 | Bacteria | 11630 |
| 678 | nmdc:mga0n895_449647_c1 | 3300050512 | Bacteria | 1301 |
| 679 | nmdc:mga0n895_6406_c1 | 3300050512 | Bacteria | 9987 |
| 680 | nmdc:mga0n895_679426_c1 | 3300050512 | Unclassified | 1027 |
| 681 | nmdc:mga0n895_696767_c1 | 3300050512 | Unclassified | 1012 |
| 682 | nmdc:mga0rr50_140_c1 | 3300050513 | Bacteria | 39942 |
| 683 | nmdc:mga0rr50_165242_c1 | 3300050513 | Bacteria | 1799 |
| 684 | nmdc:mga0rr50_172327_c1 | 3300050513 | Unclassified | 1764 |
| 685 | nmdc:mga0rr50_19118_c1 | 3300050513 | Bacteria | 4617 |
| 686 | nmdc:mga0rr50_26280_c1 | 3300050513 | Bacteria | 4059 |
| 687 | nmdc:mga0rr50_37308_c1 | 3300050513 | Bacteria | 3507 |
| 688 | nmdc:mga0rr50_65554_c1 | 3300050513 | Unclassified | 2751 |
| 689 | nmdc:mga0rr50_707053_c1 | 3300050513 | Unclassified | 860 |
| 690 | nmdc:mga0rr50_74004_c1 | 3300050513 | Unclassified | 2606 |
| 691 | nmdc:mga08x19_115419_c1 | 3300050514 | Bacteria | 1795 |
| 692 | nmdc:mga08x19_11550_c1 | 3300050514 | Bacteria | 5315 |
| 693 | nmdc:mga08x19_14044_c1 | 3300050514 | Unclassified | 4852 |
| 694 | nmdc:mga08x19_171535_c1 | 3300050514 | Bacteria | 1478 |
| 695 | nmdc:mga08x19_177582_c1 | 3300050514 | Unclassified | 1453 |
| 696 | nmdc:mga08x19_22938_c1 | 3300050514 | Bacteria | 3870 |
| 697 | nmdc:mga08x19_243722_c1 | 3300050514 | Bacteria | 1240 |
| 698 | nmdc:mga08x19_43093_c1 | 3300050514 | Bacteria | 2879 |
| 699 | nmdc:mga08x19_591227_c1 | 3300050514 | Bacteria | 786 |
| 700 | nmdc:mga08x19_87945_c1 | 3300050514 | Unclassified | 2047 |
| 701 | nmdc:mga0a205_40577_c1 | 3300050515 | Bacteria | 4481 |
| 702 | nmdc:mga0a205_449_c1 | 3300050515 | Bacteria | 31835 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026142 | Ga0207698_10517645 | Ga0207698_105176453 | 202 |
| 2 | 3300025928 | Ga0207700_10008629 | Ga0207700_100086293 | 213 |
| 3 | 3300005436 | Ga0070713_100050310 | Ga0070713_1000503102 | 215 |
| 4 | 3300046477 | Ga0495664_0064965 | Ga0495664_0064965_908_1705 | 215 |
| 5 | 3300046543 | Ga0495645_0081315 | Ga0495645_0081315_717_1514 | 215 |
| 6 | 3300013297 | Ga0157378_10003381 | Ga0157378_100033817 | 217 |
| 7 | 3300013308 | Ga0157375_10813244 | Ga0157375_108132441 | 217 |
| 8 | 3300005445 | Ga0070708_100182492 | Ga0070708_1001824923 | 221 |
| 9 | 3300021388 | Ga0213875_10009771 | Ga0213875_100097713 | 221 |
| 10 | 3300025911 | Ga0207654_10008704 | Ga0207654_100087042 | 222 |
| 11 | 3300005614 | Ga0068856_100001532 | Ga0068856_10000153221 | 223 |
| 12 | 3300026078 | Ga0207702_10001513 | Ga0207702_1000151316 | 224 |
| 13 | 3300037068 | Ga0373925_0023003 | Ga0373925_0023003_1807_2481 | 224 |
| 14 | 3300005435 | Ga0070714_100123982 | Ga0070714_1001239822 | 225 |
| 15 | 3300005563 | Ga0068855_100596962 | Ga0068855_1005969622 | 225 |
| 16 | 3300006237 | Ga0097621_100420697 | Ga0097621_1004206972 | 225 |
| 17 | 3300009174 | Ga0105241_10039967 | Ga0105241_100399673 | 225 |
| 18 | 3300009545 | Ga0105237_10014906 | Ga0105237_100149062 | 225 |
| 19 | 3300013100 | Ga0157373_10007167 | Ga0157373_100071679 | 225 |
| 20 | 3300013105 | Ga0157369_10119097 | Ga0157369_101190973 | 225 |
| 21 | 3300013296 | Ga0157374_10731504 | Ga0157374_107315041 | 225 |
| 22 | 3300013307 | Ga0157372_10000992 | Ga0157372_1000099223 | 225 |
| 23 | 3300025910 | Ga0207684_10125543 | Ga0207684_101255432 | 225 |
| 24 | 3300025929 | Ga0207664_10159823 | Ga0207664_101598232 | 225 |
| 25 | 3300048915 | Ga0496112_0109408 | Ga0496112_0109408_835_1527 | 225 |
| 26 | 3300050514 | nmdc:mga08x19_591227_c1 | nmdc:mga08x19_591227_c1_25_753 | 225 |
| 27 | 3300009093 | Ga0105240_10038089 | Ga0105240_100380893 | 226 |
| 28 | 3300009174 | Ga0105241_10328312 | Ga0105241_103283122 | 226 |
| 29 | 3300009545 | Ga0105237_10340471 | Ga0105237_103404712 | 226 |
| 30 | 3300013105 | Ga0157369_10155259 | Ga0157369_101552593 | 226 |
| 31 | 3300025910 | Ga0207684_10000973 | Ga0207684_1000097313 | 226 |
| 32 | 3300025922 | Ga0207646_10006332 | Ga0207646_1000633213 | 226 |
| 33 | 3300025928 | Ga0207700_10018967 | Ga0207700_100189675 | 226 |
| 34 | 3300035170 | Ga0373943_0065347 | Ga0373943_0065347_1022_1702 | 226 |
| 35 | 3300035692 | Ga0373935_0045385 | Ga0373935_0045385_1129_1809 | 226 |
| 36 | 3300035695 | Ga0373927_0067963 | Ga0373927_0067963_1069_1749 | 226 |
| 37 | 3300035725 | Ga0373947_0015910 | Ga0373947_0015910_975_1655 | 226 |
| 38 | 3300037068 | Ga0373925_0007869 | Ga0373925_0007869_5033_5713 | 226 |
| 39 | 3300037853 | Ga0436364_0868968 | Ga0436364_0868968_134_814 | 226 |
| 40 | 3300046472 | Ga0495580_0004001 | Ga0495580_0004001_4238_4918 | 226 |
| 41 | 3300046473 | Ga0495582_0024529 | Ga0495582_0024529_948_1628 | 226 |
| 42 | 3300046531 | Ga0495665_0010204 | Ga0495665_0010204_2631_3311 | 226 |
| 43 | 3300050512 | nmdc:mga0n895_119480_c1 | nmdc:mga0n895_119480_c1_959_1639 | 226 |
| 44 | 3300050513 | nmdc:mga0rr50_37308_c1 | nmdc:mga0rr50_37308_c1_217_897 | 226 |
| 45 | 3300050514 | nmdc:mga08x19_171535_c1 | nmdc:mga08x19_171535_c1_716_1396 | 226 |
| 46 | 3300005530 | Ga0070679_100497605 | Ga0070679_1004976052 | 227 |
| 47 | 3300006358 | Ga0068871_100145113 | Ga0068871_1001451133 | 227 |
| 48 | 3300025916 | Ga0207663_10066743 | Ga0207663_100667433 | 227 |
| 49 | 3300026078 | Ga0207702_10016811 | Ga0207702_100168113 | 227 |
| 50 | 3300037068 | Ga0373925_0517547 | Ga0373925_0517547_100_873 | 227 |
| 51 | 3300050511 | nmdc:mga08y16_384683_c1 | nmdc:mga08y16_384683_c1_179_865 | 227 |
| 52 | 3300005435 | Ga0070714_100040186 | Ga0070714_1000401863 | 228 |
| 53 | 3300005436 | Ga0070713_100338960 | Ga0070713_1003389602 | 228 |
| 54 | 3300005458 | Ga0070681_10023043 | Ga0070681_100230435 | 228 |
| 55 | 3300005530 | Ga0070679_100131331 | Ga0070679_1001313313 | 228 |
| 56 | 3300005563 | Ga0068855_100551094 | Ga0068855_1005510942 | 228 |
| 57 | 3300005614 | Ga0068856_100275654 | Ga0068856_1002756542 | 228 |
| 58 | 3300006028 | Ga0070717_10080035 | Ga0070717_100800352 | 228 |
| 59 | 3300006175 | Ga0070712_100033247 | Ga0070712_1000332473 | 228 |
| 60 | 3300006914 | Ga0075436_100008969 | Ga0075436_1000089695 | 228 |
| 61 | 3300009177 | Ga0105248_10399384 | Ga0105248_103993842 | 228 |
| 62 | 3300025898 | Ga0207692_10040499 | Ga0207692_100404993 | 228 |
| 63 | 3300025912 | Ga0207707_10086116 | Ga0207707_100861163 | 228 |
| 64 | 3300025913 | Ga0207695_10107005 | Ga0207695_101070053 | 228 |
| 65 | 3300025915 | Ga0207693_10013939 | Ga0207693_100139395 | 228 |
| 66 | 3300025921 | Ga0207652_10311790 | Ga0207652_103117902 | 228 |
| 67 | 3300039447 | Ga0436361_0502041 | Ga0436361_0502041_99_806 | 228 |
| 68 | 3300045976 | Ga0466967_0715932 | Ga0466967_0715932_99_824 | 228 |
| 69 | 3300048915 | Ga0496112_0096825 | Ga0496112_0096825_228_914 | 228 |
| 70 | 3300005336 | Ga0070680_100157142 | Ga0070680_1001571422 | 229 |
| 71 | 3300005437 | Ga0070710_10000598 | Ga0070710_1000059811 | 229 |
| 72 | 3300025898 | Ga0207692_10003006 | Ga0207692_100030064 | 229 |
| 73 | 3300005518 | Ga0070699_100014701 | Ga0070699_1000147017 | 230 |
| 74 | 3300005518 | Ga0070699_100383218 | Ga0070699_1003832182 | 230 |
| 75 | 3300005536 | Ga0070697_100026945 | Ga0070697_1000269454 | 230 |
| 76 | 3300006163 | Ga0070715_10006010 | Ga0070715_100060103 | 230 |
| 77 | 3300006173 | Ga0070716_100020719 | Ga0070716_1000207194 | 230 |
| 78 | 3300006173 | Ga0070716_100060291 | Ga0070716_1000602913 | 230 |
| 79 | 3300025905 | Ga0207685_10013507 | Ga0207685_100135073 | 230 |
| 80 | 3300025922 | Ga0207646_10045458 | Ga0207646_100454583 | 230 |
| 81 | 3300025939 | Ga0207665_10052040 | Ga0207665_100520402 | 230 |
| 82 | 3300030878 | Ga0265770_1013007 | Ga0265770_10130072 | 230 |
| 83 | 3300038996 | Ga0242420_030418 | Ga0242420_030418_58_753 | 230 |
| 84 | 3300050513 | nmdc:mga0rr50_165242_c1 | nmdc:mga0rr50_165242_c1_827_1573 | 230 |
| 85 | 3300005445 | Ga0070708_100015426 | Ga0070708_1000154262 | 231 |
| 86 | 3300005458 | Ga0070681_10050013 | Ga0070681_100500134 | 231 |
| 87 | 3300007265 | Ga0099794_10000033 | Ga0099794_100000334 | 231 |
| 88 | 3300025921 | Ga0207652_10083234 | Ga0207652_100832344 | 231 |
| 89 | 3300027671 | Ga0209588_1000006 | Ga0209588_100000639 | 231 |
| 90 | 3300039453 | Ga0436362_0092701 | Ga0436362_0092701_76_783 | 231 |
| 91 | 3300047319 | Ga0495674_0099208 | Ga0495674_0099208_761_1486 | 231 |
| 92 | 3300005434 | Ga0070709_10099697 | Ga0070709_100996972 | 232 |
| 93 | 3300005436 | Ga0070713_100037457 | Ga0070713_1000374572 | 232 |
| 94 | 3300005437 | Ga0070710_10086096 | Ga0070710_100860962 | 232 |
| 95 | 3300005439 | Ga0070711_100000159 | Ga0070711_10000015922 | 232 |
| 96 | 3300005439 | Ga0070711_100004814 | Ga0070711_1000048144 | 232 |
| 97 | 3300006028 | Ga0070717_10002444 | Ga0070717_100024446 | 232 |
| 98 | 3300006175 | Ga0070712_100006375 | Ga0070712_1000063754 | 232 |
| 99 | 3300013296 | Ga0157374_10136988 | Ga0157374_101369882 | 232 |
| 100 | 3300013297 | Ga0157378_10038080 | Ga0157378_100380805 | 232 |
| 101 | 3300025906 | Ga0207699_10089353 | Ga0207699_100893532 | 232 |
| 102 | 3300025915 | Ga0207693_10002464 | Ga0207693_100024643 | 232 |
| 103 | 3300025915 | Ga0207693_10005557 | Ga0207693_100055578 | 232 |
| 104 | 3300025916 | Ga0207663_10000965 | Ga0207663_100009655 | 232 |
| 105 | 3300025916 | Ga0207663_10012760 | Ga0207663_100127602 | 232 |
| 106 | 3300025928 | Ga0207700_10006490 | Ga0207700_100064906 | 232 |
| 107 | 3300031090 | Ga0265760_10004082 | Ga0265760_100040821 | 232 |
| 108 | 3300035691 | Ga0373931_0011405 | Ga0373931_0011405_2047_2745 | 232 |
| 109 | 3300039437 | Ga0436365_1035977 | Ga0436365_1035977_981_1688 | 232 |
| 110 | 3300039450 | Ga0436363_0875210 | Ga0436363_0875210_1049_1750 | 232 |
| 111 | 3300039453 | Ga0436362_0539068 | Ga0436362_0539068_5420_6127 | 232 |
| 112 | 3300046559 | Ga0495667_0040669 | Ga0495667_0040669_2278_2976 | 232 |
| 113 | 3300005355 | Ga0070671_100499019 | Ga0070671_1004990191 | 233 |
| 114 | 3300005435 | Ga0070714_100040692 | Ga0070714_1000406928 | 233 |
| 115 | 3300005435 | Ga0070714_100179564 | Ga0070714_1001795641 | 233 |
| 116 | 3300005436 | Ga0070713_100126421 | Ga0070713_1001264212 | 233 |
| 117 | 3300005437 | Ga0070710_10030372 | Ga0070710_100303721 | 233 |
| 118 | 3300005445 | Ga0070708_100134488 | Ga0070708_1001344882 | 233 |
| 119 | 3300005518 | Ga0070699_100092300 | Ga0070699_1000923003 | 233 |
| 120 | 3300005536 | Ga0070697_100263634 | Ga0070697_1002636342 | 233 |
| 121 | 3300005548 | Ga0070665_100128605 | Ga0070665_1001286053 | 233 |
| 122 | 3300005617 | Ga0068859_100069216 | Ga0068859_1000692162 | 233 |
| 123 | 3300006028 | Ga0070717_10188568 | Ga0070717_101885683 | 233 |
| 124 | 3300006358 | Ga0068871_100170052 | Ga0068871_1001700522 | 233 |
| 125 | 3300006852 | Ga0075433_10008310 | Ga0075433_100083107 | 233 |
| 126 | 3300006871 | Ga0075434_100000235 | Ga0075434_10000023520 | 233 |
| 127 | 3300006914 | Ga0075436_100163182 | Ga0075436_1001631822 | 233 |
| 128 | 3300006931 | Ga0097620_100069219 | Ga0097620_1000692192 | 233 |
| 129 | 3300007076 | Ga0075435_100003821 | Ga0075435_1000038213 | 233 |
| 130 | 3300009093 | Ga0105240_10042413 | Ga0105240_100424134 | 233 |
| 131 | 3300009147 | Ga0114129_10599373 | Ga0114129_105993732 | 233 |
| 132 | 3300009176 | Ga0105242_10143932 | Ga0105242_101439322 | 233 |
| 133 | 3300009177 | Ga0105248_10044402 | Ga0105248_100444022 | 233 |
| 134 | 3300009177 | Ga0105248_10957926 | Ga0105248_109579261 | 233 |
| 135 | 3300009553 | Ga0105249_10017407 | Ga0105249_100174071 | 233 |
| 136 | 3300010159 | Ga0099796_10045110 | Ga0099796_100451102 | 233 |
| 137 | 3300013104 | Ga0157370_10581091 | Ga0157370_105810912 | 233 |
| 138 | 3300013296 | Ga0157374_10009849 | Ga0157374_100098498 | 233 |
| 139 | 3300013297 | Ga0157378_10011452 | Ga0157378_100114524 | 233 |
| 140 | 3300013306 | Ga0163162_10008783 | Ga0163162_100087836 | 233 |
| 141 | 3300013308 | Ga0157375_10024068 | Ga0157375_100240681 | 233 |
| 142 | 3300013308 | Ga0157375_10117717 | Ga0157375_101177173 | 233 |
| 143 | 3300014325 | Ga0163163_10018345 | Ga0163163_100183457 | 233 |
| 144 | 3300014325 | Ga0163163_10064958 | Ga0163163_100649584 | 233 |
| 145 | 3300014325 | Ga0163163_10186746 | Ga0163163_101867462 | 233 |
| 146 | 3300014969 | Ga0157376_10002140 | Ga0157376_100021407 | 233 |
| 147 | 3300014969 | Ga0157376_10088787 | Ga0157376_100887873 | 233 |
| 148 | 3300025915 | Ga0207693_10038900 | Ga0207693_100389002 | 233 |
| 149 | 3300025922 | Ga0207646_10332408 | Ga0207646_103324082 | 233 |
| 150 | 3300025928 | Ga0207700_10326187 | Ga0207700_103261872 | 233 |
| 151 | 3300025929 | Ga0207664_10136687 | Ga0207664_101366872 | 233 |
| 152 | 3300031090 | Ga0265760_10005650 | Ga0265760_100056503 | 233 |
| 153 | 3300031090 | Ga0265760_10042346 | Ga0265760_100423461 | 233 |
| 154 | 3300035083 | Ga0373926_0017249 | Ga0373926_0017249_514_1218 | 233 |
| 155 | 3300035086 | Ga0373934_0000830 | Ga0373934_0000830_7937_8638 | 233 |
| 156 | 3300035117 | Ga0373953_0004359 | Ga0373953_0004359_2491_3192 | 233 |
| 157 | 3300035118 | Ga0373954_0000402 | Ga0373954_0000402_7467_8168 | 233 |
| 158 | 3300035118 | Ga0373954_0163616 | Ga0373954_0163616_206_907 | 233 |
| 159 | 3300035119 | Ga0373956_0035799 | Ga0373956_0035799_395_1096 | 233 |
| 160 | 3300035119 | Ga0373956_0047938 | Ga0373956_0047938_192_893 | 233 |
| 161 | 3300035120 | Ga0373957_0055850 | Ga0373957_0055850_376_1077 | 233 |
| 162 | 3300035171 | Ga0373946_0040162 | Ga0373946_0040162_759_1460 | 233 |
| 163 | 3300035172 | Ga0373955_0142455 | Ga0373955_0142455_296_997 | 233 |
| 164 | 3300035207 | Ga0373942_0034388 | Ga0373942_0034388_229_930 | 233 |
| 165 | 3300035410 | Ga0373924_0023109 | Ga0373924_0023109_816_1517 | 233 |
| 166 | 3300035695 | Ga0373927_0009237 | Ga0373927_0009237_2826_3530 | 233 |
| 167 | 3300035724 | Ga0373933_0000375 | Ga0373933_0000375_1536_2237 | 233 |
| 168 | 3300035724 | Ga0373933_0010901 | Ga0373933_0010901_1240_1941 | 233 |
| 169 | 3300036401 | Ga0373937_0000082 | Ga0373937_0000082_42176_42877 | 233 |
| 170 | 3300036401 | Ga0373937_0003011 | Ga0373937_0003011_13019_13720 | 233 |
| 171 | 3300036401 | Ga0373937_0009898 | Ga0373937_0009898_5266_5967 | 233 |
| 172 | 3300036401 | Ga0373937_0078351 | Ga0373937_0078351_699_1400 | 233 |
| 173 | 3300039447 | Ga0436361_0169123 | Ga0436361_0169123_1962_2663 | 233 |
| 174 | 3300039447 | Ga0436361_0775789 | Ga0436361_0775789_924_1625 | 233 |
| 175 | 3300039447 | Ga0436361_0875242 | Ga0436361_0875242_244_945 | 233 |
| 176 | 3300039450 | Ga0436363_1630748 | Ga0436363_1630748_455_1156 | 233 |
| 177 | 3300044706 | Ga0466964_0211108 | Ga0466964_0211108_164_865 | 233 |
| 178 | 3300045051 | Ga0451576_0112174 | Ga0451576_0112174_350_1051 | 233 |
| 179 | 3300045051 | Ga0451576_0591900 | Ga0451576_0591900_240_950 | 233 |
| 180 | 3300045976 | Ga0466967_0009451 | Ga0466967_0009451_3059_3766 | 233 |
| 181 | 3300045976 | Ga0466967_0127475 | Ga0466967_0127475_300_1001 | 233 |
| 182 | 3300046454 | Ga0495592_0046432 | Ga0495592_0046432_2082_2783 | 233 |
| 183 | 3300046462 | Ga0495651_0239363 | Ga0495651_0239363_227_928 | 233 |
| 184 | 3300046472 | Ga0495580_0006097 | Ga0495580_0006097_5320_6030 | 233 |
| 185 | 3300046472 | Ga0495580_0051162 | Ga0495580_0051162_755_1456 | 233 |
| 186 | 3300046499 | Ga0495594_0041072 | Ga0495594_0041072_1434_2135 | 233 |
| 187 | 3300046511 | Ga0495608_0015490 | Ga0495608_0015490_2311_3012 | 233 |
| 188 | 3300046529 | Ga0495652_0293184 | Ga0495652_0293184_169_870 | 233 |
| 189 | 3300046531 | Ga0495665_0043956 | Ga0495665_0043956_148_849 | 233 |
| 190 | 3300046536 | Ga0495587_0003381 | Ga0495587_0003381_7517_8218 | 233 |
| 191 | 3300046536 | Ga0495587_0219283 | Ga0495587_0219283_106_879 | 233 |
| 192 | 3300046663 | Ga0495635_0042731 | Ga0495635_0042731_1930_2631 | 233 |
| 193 | 3300046679 | Ga0495623_0256534 | Ga0495623_0256534_135_836 | 233 |
| 194 | 3300046691 | Ga0495670_0174275 | Ga0495670_0174275_184_885 | 233 |
| 195 | 3300047317 | Ga0495604_0000235 | Ga0495604_0000235_7188_7889 | 233 |
| 196 | 3300047471 | Ga0495684_0023950 | Ga0495684_0023950_1276_1977 | 233 |
| 197 | 3300048088 | Ga0495602_0055071 | Ga0495602_0055071_854_1555 | 233 |
| 198 | 3300048903 | Ga0496100_0599525 | Ga0496100_0599525_112_813 | 233 |
| 199 | 3300048904 | Ga0496101_0081636 | Ga0496101_0081636_1555_2256 | 233 |
| 200 | 3300048905 | Ga0496102_0003254 | Ga0496102_0003254_7993_8694 | 233 |
| 201 | 3300048905 | Ga0496102_0073061 | Ga0496102_0073061_788_1489 | 233 |
| 202 | 3300048907 | Ga0496104_0021762 | Ga0496104_0021762_2305_3006 | 233 |
| 203 | 3300048908 | Ga0496105_0722410 | Ga0496105_0722410_35_736 | 233 |
| 204 | 3300048909 | Ga0496106_0354205 | Ga0496106_0354205_355_1056 | 233 |
| 205 | 3300048912 | Ga0496109_0038109 | Ga0496109_0038109_1202_1903 | 233 |
| 206 | 3300048915 | Ga0496112_0001829 | Ga0496112_0001829_15849_16550 | 233 |
| 207 | 3300048918 | Ga0496115_0482676 | Ga0496115_0482676_56_757 | 233 |
| 208 | 3300050512 | nmdc:mga0n895_17170_c1 | nmdc:mga0n895_17170_c1_4656_5357 | 233 |
| 209 | 3300050512 | nmdc:mga0n895_696767_c1 | nmdc:mga0n895_696767_c1_70_777 | 233 |
| 210 | 3300050513 | nmdc:mga0rr50_19118_c1 | nmdc:mga0rr50_19118_c1_2958_3659 | 233 |
| 211 | 3300050514 | nmdc:mga08x19_115419_c1 | nmdc:mga08x19_115419_c1_812_1522 | 233 |
| 212 | 3300050514 | nmdc:mga08x19_22938_c1 | nmdc:mga08x19_22938_c1_3075_3776 | 233 |
| 213 | 3300050515 | nmdc:mga0a205_449_c1 | nmdc:mga0a205_449_c1_25029_25730 | 233 |
| 214 | 3300000546 | LJNas_1009783 | LJNas_10097831 | 234 |
| 215 | 3300005329 | Ga0070683_100194454 | Ga0070683_1001944542 | 234 |
| 216 | 3300005334 | Ga0068869_100131910 | Ga0068869_1001319103 | 234 |
| 217 | 3300005434 | Ga0070709_10101062 | Ga0070709_101010622 | 234 |
| 218 | 3300005435 | Ga0070714_100016881 | Ga0070714_1000168814 | 234 |
| 219 | 3300005467 | Ga0070706_100002718 | Ga0070706_1000027182 | 234 |
| 220 | 3300005468 | Ga0070707_100043153 | Ga0070707_1000431532 | 234 |
| 221 | 3300005468 | Ga0070707_100511377 | Ga0070707_1005113772 | 234 |
| 222 | 3300005536 | Ga0070697_100000326 | Ga0070697_10000032632 | 234 |
| 223 | 3300005536 | Ga0070697_100169918 | Ga0070697_1001699184 | 234 |
| 224 | 3300006028 | Ga0070717_10001232 | Ga0070717_100012323 | 234 |
| 225 | 3300006028 | Ga0070717_10091757 | Ga0070717_100917573 | 234 |
| 226 | 3300006173 | Ga0070716_100069700 | Ga0070716_1000697003 | 234 |
| 227 | 3300006852 | Ga0075433_10004547 | Ga0075433_100045476 | 234 |
| 228 | 3300006852 | Ga0075433_10498326 | Ga0075433_104983262 | 234 |
| 229 | 3300006871 | Ga0075434_100033552 | Ga0075434_1000335526 | 234 |
| 230 | 3300007076 | Ga0075435_100091169 | Ga0075435_1000911693 | 234 |
| 231 | 3300007076 | Ga0075435_100185332 | Ga0075435_1001853322 | 234 |
| 232 | 3300009147 | Ga0114129_10006148 | Ga0114129_1000614815 | 234 |
| 233 | 3300025906 | Ga0207699_10117445 | Ga0207699_101174452 | 234 |
| 234 | 3300025910 | Ga0207684_10002906 | Ga0207684_1000290616 | 234 |
| 235 | 3300025939 | Ga0207665_10315896 | Ga0207665_103158961 | 234 |
| 236 | 3300030760 | Ga0265762_1016240 | Ga0265762_10162402 | 234 |
| 237 | 3300039437 | Ga0436365_0031849 | Ga0436365_0031849_8863_9579 | 234 |
| 238 | 3300039450 | Ga0436363_0436454 | Ga0436363_0436454_137_853 | 234 |
| 239 | 3300044673 | Ga0453683_0218324 | Ga0453683_0218324_406_1134 | 234 |
| 240 | 3300046459 | Ga0495629_0054939 | Ga0495629_0054939_750_1454 | 234 |
| 241 | 3300046473 | Ga0495582_0010407 | Ga0495582_0010407_3740_4444 | 234 |
| 242 | 3300046475 | Ga0495639_0037357 | Ga0495639_0037357_1353_2114 | 234 |
| 243 | 3300046526 | Ga0495666_0038176 | Ga0495666_0038176_1550_2311 | 234 |
| 244 | 3300046531 | Ga0495665_0005685 | Ga0495665_0005685_5639_6400 | 234 |
| 245 | 3300046533 | Ga0495640_0010896 | Ga0495640_0010896_486_1247 | 234 |
| 246 | 3300046535 | Ga0495586_0055264 | Ga0495586_0055264_31_735 | 234 |
| 247 | 3300046557 | Ga0495622_0169289 | Ga0495622_0169289_158_919 | 234 |
| 248 | 3300046681 | Ga0495647_0004251 | Ga0495647_0004251_3464_4225 | 234 |
| 249 | 3300046683 | Ga0495658_0008227 | Ga0495658_0008227_1513_2217 | 234 |
| 250 | 3300046689 | Ga0495613_0068203 | Ga0495613_0068203_340_1101 | 234 |
| 251 | 3300047319 | Ga0495674_0060600 | Ga0495674_0060600_956_1717 | 234 |
| 252 | 3300047321 | Ga0495676_0024901 | Ga0495676_0024901_4395_5156 | 234 |
| 253 | 3300048089 | Ga0495614_0026234 | Ga0495614_0026234_969_1730 | 234 |
| 254 | 3300048903 | Ga0496100_0395855 | Ga0496100_0395855_74_835 | 234 |
| 255 | 3300048904 | Ga0496101_0024720 | Ga0496101_0024720_2028_2789 | 234 |
| 256 | 3300048918 | Ga0496115_0042209 | Ga0496115_0042209_2509_3270 | 234 |
| 257 | 3300050512 | nmdc:mga0n895_129088_c1 | nmdc:mga0n895_129088_c1_1581_2288 | 234 |
| 258 | 3300050513 | nmdc:mga0rr50_172327_c1 | nmdc:mga0rr50_172327_c1_616_1320 | 234 |
| 259 | 3300050513 | nmdc:mga0rr50_74004_c1 | nmdc:mga0rr50_74004_c1_1179_1886 | 234 |
| 260 | 3300050515 | nmdc:mga0a205_40577_c1 | nmdc:mga0a205_40577_c1_1135_1848 | 234 |
| 261 | 3300000546 | LJNas_1000349 | LJNas_10003495 | 235 |
| 262 | 3300005290 | Ga0065712_10010322 | Ga0065712_100103222 | 235 |
| 263 | 3300005327 | Ga0070658_10214408 | Ga0070658_102144082 | 235 |
| 264 | 3300005328 | Ga0070676_10004271 | Ga0070676_100042717 | 235 |
| 265 | 3300005329 | Ga0070683_100009472 | Ga0070683_1000094723 | 235 |
| 266 | 3300005329 | Ga0070683_100631946 | Ga0070683_1006319462 | 235 |
| 267 | 3300005330 | Ga0070690_100109004 | Ga0070690_1001090042 | 235 |
| 268 | 3300005331 | Ga0070670_100012988 | Ga0070670_1000129883 | 235 |
| 269 | 3300005331 | Ga0070670_100202703 | Ga0070670_1002027032 | 235 |
| 270 | 3300005334 | Ga0068869_100042663 | Ga0068869_1000426632 | 235 |
| 271 | 3300005334 | Ga0068869_100158088 | Ga0068869_1001580881 | 235 |
| 272 | 3300005335 | Ga0070666_10007921 | Ga0070666_100079217 | 235 |
| 273 | 3300005335 | Ga0070666_10227042 | Ga0070666_102270421 | 235 |
| 274 | 3300005336 | Ga0070680_100040194 | Ga0070680_1000401943 | 235 |
| 275 | 3300005336 | Ga0070680_100199043 | Ga0070680_1001990432 | 235 |
| 276 | 3300005336 | Ga0070680_100408162 | Ga0070680_1004081622 | 235 |
| 277 | 3300005338 | Ga0068868_100094805 | Ga0068868_1000948052 | 235 |
| 278 | 3300005339 | Ga0070660_100009894 | Ga0070660_1000098944 | 235 |
| 279 | 3300005339 | Ga0070660_100141774 | Ga0070660_1001417742 | 235 |
| 280 | 3300005344 | Ga0070661_100078921 | Ga0070661_1000789212 | 235 |
| 281 | 3300005344 | Ga0070661_100612181 | Ga0070661_1006121811 | 235 |
| 282 | 3300005347 | Ga0070668_100265344 | Ga0070668_1002653442 | 235 |
| 283 | 3300005353 | Ga0070669_100027856 | Ga0070669_1000278563 | 235 |
| 284 | 3300005354 | Ga0070675_100252454 | Ga0070675_1002524542 | 235 |
| 285 | 3300005355 | Ga0070671_100018649 | Ga0070671_1000186495 | 235 |
| 286 | 3300005355 | Ga0070671_100026671 | Ga0070671_1000266712 | 235 |
| 287 | 3300005355 | Ga0070671_100240237 | Ga0070671_1002402371 | 235 |
| 288 | 3300005364 | Ga0070673_100275847 | Ga0070673_1002758472 | 235 |
| 289 | 3300005366 | Ga0070659_100022184 | Ga0070659_1000221842 | 235 |
| 290 | 3300005366 | Ga0070659_100148454 | Ga0070659_1001484542 | 235 |
| 291 | 3300005367 | Ga0070667_100008621 | Ga0070667_1000086212 | 235 |
| 292 | 3300005434 | Ga0070709_10015593 | Ga0070709_100155934 | 235 |
| 293 | 3300005434 | Ga0070709_10047348 | Ga0070709_100473483 | 235 |
| 294 | 3300005434 | Ga0070709_10070357 | Ga0070709_100703574 | 235 |
| 295 | 3300005434 | Ga0070709_10224941 | Ga0070709_102249412 | 235 |
| 296 | 3300005434 | Ga0070709_10572290 | Ga0070709_105722902 | 235 |
| 297 | 3300005435 | Ga0070714_100000231 | Ga0070714_10000023110 | 235 |
| 298 | 3300005435 | Ga0070714_100002825 | Ga0070714_1000028253 | 235 |
| 299 | 3300005435 | Ga0070714_100077770 | Ga0070714_1000777702 | 235 |
| 300 | 3300005435 | Ga0070714_100080724 | Ga0070714_1000807242 | 235 |
| 301 | 3300005435 | Ga0070714_100131459 | Ga0070714_1001314593 | 235 |
| 302 | 3300005435 | Ga0070714_100642992 | Ga0070714_1006429921 | 235 |
| 303 | 3300005436 | Ga0070713_100044039 | Ga0070713_1000440394 | 235 |
| 304 | 3300005436 | Ga0070713_100067106 | Ga0070713_1000671062 | 235 |
| 305 | 3300005436 | Ga0070713_100079724 | Ga0070713_1000797243 | 235 |
| 306 | 3300005436 | Ga0070713_100183904 | Ga0070713_1001839042 | 235 |
| 307 | 3300005436 | Ga0070713_100834149 | Ga0070713_1008341492 | 235 |
| 308 | 3300005439 | Ga0070711_100036059 | Ga0070711_1000360593 | 235 |
| 309 | 3300005439 | Ga0070711_100219153 | Ga0070711_1002191532 | 235 |
| 310 | 3300005440 | Ga0070705_100090729 | Ga0070705_1000907291 | 235 |
| 311 | 3300005445 | Ga0070708_100022662 | Ga0070708_1000226622 | 235 |
| 312 | 3300005445 | Ga0070708_100147272 | Ga0070708_1001472722 | 235 |
| 313 | 3300005445 | Ga0070708_100210712 | Ga0070708_1002107122 | 235 |
| 314 | 3300005445 | Ga0070708_100514080 | Ga0070708_1005140801 | 235 |
| 315 | 3300005455 | Ga0070663_100001583 | Ga0070663_1000015834 | 235 |
| 316 | 3300005455 | Ga0070663_100058233 | Ga0070663_1000582333 | 235 |
| 317 | 3300005455 | Ga0070663_100202162 | Ga0070663_1002021621 | 235 |
| 318 | 3300005456 | Ga0070678_100014781 | Ga0070678_1000147815 | 235 |
| 319 | 3300005457 | Ga0070662_100007366 | Ga0070662_1000073667 | 235 |
| 320 | 3300005458 | Ga0070681_10013120 | Ga0070681_1001312010 | 235 |
| 321 | 3300005458 | Ga0070681_10196413 | Ga0070681_101964132 | 235 |
| 322 | 3300005458 | Ga0070681_10708545 | Ga0070681_107085451 | 235 |
| 323 | 3300005468 | Ga0070707_100217838 | Ga0070707_1002178382 | 235 |
| 324 | 3300005468 | Ga0070707_100580287 | Ga0070707_1005802872 | 235 |
| 325 | 3300005471 | Ga0070698_100169559 | Ga0070698_1001695593 | 235 |
| 326 | 3300005518 | Ga0070699_100255190 | Ga0070699_1002551902 | 235 |
| 327 | 3300005530 | Ga0070679_100057638 | Ga0070679_1000576383 | 235 |
| 328 | 3300005530 | Ga0070679_100107684 | Ga0070679_1001076843 | 235 |
| 329 | 3300005535 | Ga0070684_100100654 | Ga0070684_1001006543 | 235 |
| 330 | 3300005535 | Ga0070684_100114557 | Ga0070684_1001145573 | 235 |
| 331 | 3300005536 | Ga0070697_100011012 | Ga0070697_1000110127 | 235 |
| 332 | 3300005536 | Ga0070697_100011538 | Ga0070697_1000115383 | 235 |
| 333 | 3300005536 | Ga0070697_100145934 | Ga0070697_1001459343 | 235 |
| 334 | 3300005536 | Ga0070697_100163468 | Ga0070697_1001634683 | 235 |
| 335 | 3300005539 | Ga0068853_100000041 | Ga0068853_10000004165 | 235 |
| 336 | 3300005539 | Ga0068853_100074178 | Ga0068853_1000741782 | 235 |
| 337 | 3300005539 | Ga0068853_100128518 | Ga0068853_1001285183 | 235 |
| 338 | 3300005539 | Ga0068853_100161418 | Ga0068853_1001614182 | 235 |
| 339 | 3300005545 | Ga0070695_100065390 | Ga0070695_1000653903 | 235 |
| 340 | 3300005545 | Ga0070695_100122838 | Ga0070695_1001228383 | 235 |
| 341 | 3300005546 | Ga0070696_100242520 | Ga0070696_1002425201 | 235 |
| 342 | 3300005547 | Ga0070693_100017058 | Ga0070693_1000170583 | 235 |
| 343 | 3300005548 | Ga0070665_100002740 | Ga0070665_1000027405 | 235 |
| 344 | 3300005548 | Ga0070665_100202526 | Ga0070665_1002025262 | 235 |
| 345 | 3300005563 | Ga0068855_100001421 | Ga0068855_10000142117 | 235 |
| 346 | 3300005563 | Ga0068855_100007086 | Ga0068855_1000070868 | 235 |
| 347 | 3300005563 | Ga0068855_100103090 | Ga0068855_1001030902 | 235 |
| 348 | 3300005563 | Ga0068855_100182725 | Ga0068855_1001827253 | 235 |
| 349 | 3300005564 | Ga0070664_100028967 | Ga0070664_1000289675 | 235 |
| 350 | 3300005577 | Ga0068857_100040374 | Ga0068857_1000403745 | 235 |
| 351 | 3300005577 | Ga0068857_100199467 | Ga0068857_1001994672 | 235 |
| 352 | 3300005578 | Ga0068854_100000122 | Ga0068854_10000012236 | 235 |
| 353 | 3300005578 | Ga0068854_100004655 | Ga0068854_1000046553 | 235 |
| 354 | 3300005578 | Ga0068854_100012486 | Ga0068854_1000124862 | 235 |
| 355 | 3300005614 | Ga0068856_100001724 | Ga0068856_10000172423 | 235 |
| 356 | 3300005614 | Ga0068856_100084818 | Ga0068856_1000848182 | 235 |
| 357 | 3300005616 | Ga0068852_100006220 | Ga0068852_10000622010 | 235 |
| 358 | 3300005617 | Ga0068859_100661688 | Ga0068859_1006616882 | 235 |
| 359 | 3300005618 | Ga0068864_100002560 | Ga0068864_10000256018 | 235 |
| 360 | 3300005618 | Ga0068864_100166538 | Ga0068864_1001665382 | 235 |
| 361 | 3300005718 | Ga0068866_10007100 | Ga0068866_100071003 | 235 |
| 362 | 3300005718 | Ga0068866_10188617 | Ga0068866_101886172 | 235 |
| 363 | 3300005834 | Ga0068851_10022899 | Ga0068851_100228992 | 235 |
| 364 | 3300005834 | Ga0068851_10162447 | Ga0068851_101624471 | 235 |
| 365 | 3300005840 | Ga0068870_10099249 | Ga0068870_100992491 | 235 |
| 366 | 3300005841 | Ga0068863_100246309 | Ga0068863_1002463093 | 235 |
| 367 | 3300005841 | Ga0068863_100312803 | Ga0068863_1003128032 | 235 |
| 368 | 3300005842 | Ga0068858_100012338 | Ga0068858_1000123384 | 235 |
| 369 | 3300005842 | Ga0068858_100051663 | Ga0068858_1000516634 | 235 |
| 370 | 3300005843 | Ga0068860_100014915 | Ga0068860_1000149152 | 235 |
| 371 | 3300005843 | Ga0068860_100017349 | Ga0068860_1000173495 | 235 |
| 372 | 3300005844 | Ga0068862_101143201 | Ga0068862_1011432011 | 235 |
| 373 | 3300005937 | Ga0081455_10187249 | Ga0081455_101872492 | 235 |
| 374 | 3300006028 | Ga0070717_10020392 | Ga0070717_100203922 | 235 |
| 375 | 3300006028 | Ga0070717_10022002 | Ga0070717_100220029 | 235 |
| 376 | 3300006028 | Ga0070717_10100743 | Ga0070717_101007433 | 235 |
| 377 | 3300006028 | Ga0070717_10165414 | Ga0070717_101654142 | 235 |
| 378 | 3300006028 | Ga0070717_10239227 | Ga0070717_102392272 | 235 |
| 379 | 3300006028 | Ga0070717_10325563 | Ga0070717_103255632 | 235 |
| 380 | 3300006028 | Ga0070717_10583582 | Ga0070717_105835821 | 235 |
| 381 | 3300006163 | Ga0070715_10009792 | Ga0070715_100097924 | 235 |
| 382 | 3300006163 | Ga0070715_10033649 | Ga0070715_100336492 | 235 |
| 383 | 3300006163 | Ga0070715_10086850 | Ga0070715_100868502 | 235 |
| 384 | 3300006173 | Ga0070716_100000354 | Ga0070716_1000003543 | 235 |
| 385 | 3300006173 | Ga0070716_100013004 | Ga0070716_1000130045 | 235 |
| 386 | 3300006173 | Ga0070716_100037906 | Ga0070716_1000379063 | 235 |
| 387 | 3300006173 | Ga0070716_100087231 | Ga0070716_1000872312 | 235 |
| 388 | 3300006173 | Ga0070716_100135372 | Ga0070716_1001353722 | 235 |
| 389 | 3300006173 | Ga0070716_100273149 | Ga0070716_1002731491 | 235 |
| 390 | 3300006173 | Ga0070716_100327496 | Ga0070716_1003274961 | 235 |
| 391 | 3300006173 | Ga0070716_100464490 | Ga0070716_1004644902 | 235 |
| 392 | 3300006175 | Ga0070712_100023999 | Ga0070712_1000239993 | 235 |
| 393 | 3300006175 | Ga0070712_100034649 | Ga0070712_1000346493 | 235 |
| 394 | 3300006175 | Ga0070712_100063059 | Ga0070712_1000630593 | 235 |
| 395 | 3300006175 | Ga0070712_100127114 | Ga0070712_1001271143 | 235 |
| 396 | 3300006175 | Ga0070712_100135417 | Ga0070712_1001354172 | 235 |
| 397 | 3300006175 | Ga0070712_100291568 | Ga0070712_1002915682 | 235 |
| 398 | 3300006237 | Ga0097621_100000034 | Ga0097621_1000000348 | 235 |
| 399 | 3300006237 | Ga0097621_100019759 | Ga0097621_1000197595 | 235 |
| 400 | 3300006237 | Ga0097621_100026888 | Ga0097621_1000268885 | 235 |
| 401 | 3300006237 | Ga0097621_100067291 | Ga0097621_1000672914 | 235 |
| 402 | 3300006358 | Ga0068871_100000819 | Ga0068871_1000008198 | 235 |
| 403 | 3300006358 | Ga0068871_100008170 | Ga0068871_1000081708 | 235 |
| 404 | 3300006358 | Ga0068871_100213398 | Ga0068871_1002133982 | 235 |
| 405 | 3300006846 | Ga0075430_100190189 | Ga0075430_1001901892 | 235 |
| 406 | 3300006847 | Ga0075431_100140971 | Ga0075431_1001409714 | 235 |
| 407 | 3300006871 | Ga0075434_100004271 | Ga0075434_10000427113 | 235 |
| 408 | 3300006871 | Ga0075434_100020351 | Ga0075434_1000203516 | 235 |
| 409 | 3300006871 | Ga0075434_100232600 | Ga0075434_1002326002 | 235 |
| 410 | 3300006880 | Ga0075429_100029806 | Ga0075429_1000298062 | 235 |
| 411 | 3300006881 | Ga0068865_100299098 | Ga0068865_1002990982 | 235 |
| 412 | 3300006881 | Ga0068865_100531565 | Ga0068865_1005315652 | 235 |
| 413 | 3300006914 | Ga0075436_100002580 | Ga0075436_1000025807 | 235 |
| 414 | 3300006914 | Ga0075436_100005980 | Ga0075436_1000059806 | 235 |
| 415 | 3300006914 | Ga0075436_100090790 | Ga0075436_1000907902 | 235 |
| 416 | 3300006914 | Ga0075436_100100340 | Ga0075436_1001003403 | 235 |
| 417 | 3300006931 | Ga0097620_100661662 | Ga0097620_1006616621 | 235 |
| 418 | 3300007076 | Ga0075435_100007962 | Ga0075435_1000079623 | 235 |
| 419 | 3300007076 | Ga0075435_100299519 | Ga0075435_1002995192 | 235 |
| 420 | 3300009093 | Ga0105240_10004264 | Ga0105240_1000426411 | 235 |
| 421 | 3300009093 | Ga0105240_10040354 | Ga0105240_100403542 | 235 |
| 422 | 3300009093 | Ga0105240_10047360 | Ga0105240_100473605 | 235 |
| 423 | 3300009093 | Ga0105240_10227221 | Ga0105240_102272212 | 235 |
| 424 | 3300009093 | Ga0105240_10377040 | Ga0105240_103770402 | 235 |
| 425 | 3300009098 | Ga0105245_10000411 | Ga0105245_100004112 | 235 |
| 426 | 3300009098 | Ga0105245_10247513 | Ga0105245_102475132 | 235 |
| 427 | 3300009098 | Ga0105245_10273445 | Ga0105245_102734452 | 235 |
| 428 | 3300009147 | Ga0114129_10074350 | Ga0114129_100743504 | 235 |
| 429 | 3300009147 | Ga0114129_10098137 | Ga0114129_100981377 | 235 |
| 430 | 3300009174 | Ga0105241_10008117 | Ga0105241_1000811712 | 235 |
| 431 | 3300009174 | Ga0105241_10335533 | Ga0105241_103355332 | 235 |
| 432 | 3300009176 | Ga0105242_10076575 | Ga0105242_100765753 | 235 |
| 433 | 3300009177 | Ga0105248_10011027 | Ga0105248_100110275 | 235 |
| 434 | 3300009177 | Ga0105248_10069980 | Ga0105248_100699804 | 235 |
| 435 | 3300009177 | Ga0105248_10161420 | Ga0105248_101614203 | 235 |
| 436 | 3300009177 | Ga0105248_10571794 | Ga0105248_105717942 | 235 |
| 437 | 3300009545 | Ga0105237_10038741 | Ga0105237_100387414 | 235 |
| 438 | 3300009545 | Ga0105237_10244648 | Ga0105237_102446483 | 235 |
| 439 | 3300009545 | Ga0105237_10484699 | Ga0105237_104846991 | 235 |
| 440 | 3300009551 | Ga0105238_10034553 | Ga0105238_100345532 | 235 |
| 441 | 3300009551 | Ga0105238_10036544 | Ga0105238_100365442 | 235 |
| 442 | 3300009553 | Ga0105249_10525858 | Ga0105249_105258582 | 235 |
| 443 | 3300010375 | Ga0105239_10021480 | Ga0105239_100214808 | 235 |
| 444 | 3300010375 | Ga0105239_10095242 | Ga0105239_100952423 | 235 |
| 445 | 3300010375 | Ga0105239_10204751 | Ga0105239_102047513 | 235 |
| 446 | 3300010375 | Ga0105239_10270453 | Ga0105239_102704532 | 235 |
| 447 | 3300011119 | Ga0105246_10020182 | Ga0105246_100201826 | 235 |
| 448 | 3300013102 | Ga0157371_10138302 | Ga0157371_101383023 | 235 |
| 449 | 3300013104 | Ga0157370_10002484 | Ga0157370_100024848 | 235 |
| 450 | 3300013104 | Ga0157370_10582087 | Ga0157370_105820872 | 235 |
| 451 | 3300013105 | Ga0157369_10010669 | Ga0157369_1001066911 | 235 |
| 452 | 3300013105 | Ga0157369_10399861 | Ga0157369_103998612 | 235 |
| 453 | 3300013296 | Ga0157374_10000249 | Ga0157374_100002497 | 235 |
| 454 | 3300013296 | Ga0157374_10000787 | Ga0157374_100007877 | 235 |
| 455 | 3300013296 | Ga0157374_10128064 | Ga0157374_101280642 | 235 |
| 456 | 3300013297 | Ga0157378_10000008 | Ga0157378_1000000818 | 235 |
| 457 | 3300013297 | Ga0157378_10001217 | Ga0157378_100012179 | 235 |
| 458 | 3300013307 | Ga0157372_10000436 | Ga0157372_100004367 | 235 |
| 459 | 3300013307 | Ga0157372_10030521 | Ga0157372_100305214 | 235 |
| 460 | 3300013307 | Ga0157372_10141022 | Ga0157372_101410222 | 235 |
| 461 | 3300014325 | Ga0163163_10239781 | Ga0163163_102397811 | 235 |
| 462 | 3300014497 | Ga0182008_10021637 | Ga0182008_100216372 | 235 |
| 463 | 3300014968 | Ga0157379_10003566 | Ga0157379_100035667 | 235 |
| 464 | 3300014969 | Ga0157376_10001493 | Ga0157376_100014932 | 235 |
| 465 | 3300015261 | Ga0182006_1046599 | Ga0182006_10465992 | 235 |
| 466 | 3300015262 | Ga0182007_10028080 | Ga0182007_100280801 | 235 |
| 467 | 3300015265 | Ga0182005_1011524 | Ga0182005_10115242 | 235 |
| 468 | 3300021358 | Ga0213873_10074341 | Ga0213873_100743411 | 235 |
| 469 | 3300021361 | Ga0213872_10001338 | Ga0213872_1000133815 | 235 |
| 470 | 3300021361 | Ga0213872_10001709 | Ga0213872_100017096 | 235 |
| 471 | 3300021361 | Ga0213872_10002491 | Ga0213872_100024913 | 235 |
| 472 | 3300021361 | Ga0213872_10031819 | Ga0213872_100318192 | 235 |
| 473 | 3300021361 | Ga0213872_10045545 | Ga0213872_100455453 | 235 |
| 474 | 3300021361 | Ga0213872_10094590 | Ga0213872_100945902 | 235 |
| 475 | 3300021361 | Ga0213872_10104727 | Ga0213872_101047272 | 235 |
| 476 | 3300021384 | Ga0213876_10056935 | Ga0213876_100569352 | 235 |
| 477 | 3300021388 | Ga0213875_10080460 | Ga0213875_100804602 | 235 |
| 478 | 3300021388 | Ga0213875_10223533 | Ga0213875_102235331 | 235 |
| 479 | 3300021441 | Ga0213871_10008210 | Ga0213871_100082102 | 235 |
| 480 | 3300024227 | Ga0228598_1001283 | Ga0228598_10012836 | 235 |
| 481 | 3300025321 | Ga0207656_10072300 | Ga0207656_100723002 | 235 |
| 482 | 3300025321 | Ga0207656_10091279 | Ga0207656_100912791 | 235 |
| 483 | 3300025898 | Ga0207692_10086083 | Ga0207692_100860832 | 235 |
| 484 | 3300025898 | Ga0207692_10106975 | Ga0207692_101069752 | 235 |
| 485 | 3300025899 | Ga0207642_10167351 | Ga0207642_101673512 | 235 |
| 486 | 3300025903 | Ga0207680_10112310 | Ga0207680_101123102 | 235 |
| 487 | 3300025904 | Ga0207647_10006284 | Ga0207647_100062847 | 235 |
| 488 | 3300025905 | Ga0207685_10006465 | Ga0207685_100064653 | 235 |
| 489 | 3300025905 | Ga0207685_10020451 | Ga0207685_100204512 | 235 |
| 490 | 3300025906 | Ga0207699_10011334 | Ga0207699_100113343 | 235 |
| 491 | 3300025906 | Ga0207699_10015299 | Ga0207699_100152994 | 235 |
| 492 | 3300025906 | Ga0207699_10213385 | Ga0207699_102133852 | 235 |
| 493 | 3300025906 | Ga0207699_10471827 | Ga0207699_104718271 | 235 |
| 494 | 3300025907 | Ga0207645_10096239 | Ga0207645_100962393 | 235 |
| 495 | 3300025909 | Ga0207705_10190255 | Ga0207705_101902552 | 235 |
| 496 | 3300025912 | Ga0207707_10015200 | Ga0207707_100152003 | 235 |
| 497 | 3300025912 | Ga0207707_10029186 | Ga0207707_100291862 | 235 |
| 498 | 3300025912 | Ga0207707_10150117 | Ga0207707_101501172 | 235 |
| 499 | 3300025913 | Ga0207695_10005455 | Ga0207695_1000545511 | 235 |
| 500 | 3300025913 | Ga0207695_10009167 | Ga0207695_100091674 | 235 |
| 501 | 3300025913 | Ga0207695_10025939 | Ga0207695_100259396 | 235 |
| 502 | 3300025914 | Ga0207671_10096036 | Ga0207671_100960361 | 235 |
| 503 | 3300025915 | Ga0207693_10007800 | Ga0207693_100078005 | 235 |
| 504 | 3300025915 | Ga0207693_10015230 | Ga0207693_100152303 | 235 |
| 505 | 3300025915 | Ga0207693_10032918 | Ga0207693_100329182 | 235 |
| 506 | 3300025915 | Ga0207693_10130900 | Ga0207693_101309002 | 235 |
| 507 | 3300025915 | Ga0207693_10434100 | Ga0207693_104341001 | 235 |
| 508 | 3300025916 | Ga0207663_10491865 | Ga0207663_104918652 | 235 |
| 509 | 3300025916 | Ga0207663_10669175 | Ga0207663_106691751 | 235 |
| 510 | 3300025917 | Ga0207660_10267115 | Ga0207660_102671152 | 235 |
| 511 | 3300025919 | Ga0207657_10001667 | Ga0207657_100016674 | 235 |
| 512 | 3300025919 | Ga0207657_10010205 | Ga0207657_100102054 | 235 |
| 513 | 3300025920 | Ga0207649_10065523 | Ga0207649_100655231 | 235 |
| 514 | 3300025920 | Ga0207649_10088524 | Ga0207649_100885242 | 235 |
| 515 | 3300025921 | Ga0207652_10123880 | Ga0207652_101238802 | 235 |
| 516 | 3300025921 | Ga0207652_10263798 | Ga0207652_102637982 | 235 |
| 517 | 3300025922 | Ga0207646_10007050 | Ga0207646_100070505 | 235 |
| 518 | 3300025922 | Ga0207646_10105087 | Ga0207646_101050873 | 235 |
| 519 | 3300025922 | Ga0207646_10171569 | Ga0207646_101715692 | 235 |
| 520 | 3300025923 | Ga0207681_10303896 | Ga0207681_103038961 | 235 |
| 521 | 3300025924 | Ga0207694_10063306 | Ga0207694_100633063 | 235 |
| 522 | 3300025924 | Ga0207694_10092037 | Ga0207694_100920372 | 235 |
| 523 | 3300025925 | Ga0207650_10672896 | Ga0207650_106728962 | 235 |
| 524 | 3300025926 | Ga0207659_10433059 | Ga0207659_104330592 | 235 |
| 525 | 3300025927 | Ga0207687_10000141 | Ga0207687_1000014110 | 235 |
| 526 | 3300025928 | Ga0207700_10028873 | Ga0207700_100288732 | 235 |
| 527 | 3300025928 | Ga0207700_10028932 | Ga0207700_100289323 | 235 |
| 528 | 3300025928 | Ga0207700_10112223 | Ga0207700_101122232 | 235 |
| 529 | 3300025928 | Ga0207700_10185866 | Ga0207700_101858661 | 235 |
| 530 | 3300025928 | Ga0207700_10247750 | Ga0207700_102477503 | 235 |
| 531 | 3300025928 | Ga0207700_10468180 | Ga0207700_104681801 | 235 |
| 532 | 3300025928 | Ga0207700_10586354 | Ga0207700_105863542 | 235 |
| 533 | 3300025929 | Ga0207664_10000033 | Ga0207664_10000033152 | 235 |
| 534 | 3300025929 | Ga0207664_10050872 | Ga0207664_100508723 | 235 |
| 535 | 3300025929 | Ga0207664_10142917 | Ga0207664_101429172 | 235 |
| 536 | 3300025929 | Ga0207664_10388694 | Ga0207664_103886942 | 235 |
| 537 | 3300025929 | Ga0207664_10466259 | Ga0207664_104662591 | 235 |
| 538 | 3300025929 | Ga0207664_10646445 | Ga0207664_106464452 | 235 |
| 539 | 3300025929 | Ga0207664_10740070 | Ga0207664_107400702 | 235 |
| 540 | 3300025931 | Ga0207644_10017386 | Ga0207644_100173863 | 235 |
| 541 | 3300025931 | Ga0207644_10127442 | Ga0207644_101274422 | 235 |
| 542 | 3300025931 | Ga0207644_10175159 | Ga0207644_101751592 | 235 |
| 543 | 3300025932 | Ga0207690_10006731 | Ga0207690_100067317 | 235 |
| 544 | 3300025932 | Ga0207690_10118299 | Ga0207690_101182992 | 235 |
| 545 | 3300025933 | Ga0207706_10009258 | Ga0207706_100092586 | 235 |
| 546 | 3300025933 | Ga0207706_10016470 | Ga0207706_100164704 | 235 |
| 547 | 3300025934 | Ga0207686_10624807 | Ga0207686_106248071 | 235 |
| 548 | 3300025935 | Ga0207709_10354244 | Ga0207709_103542442 | 235 |
| 549 | 3300025938 | Ga0207704_10069593 | Ga0207704_100695934 | 235 |
| 550 | 3300025938 | Ga0207704_10109315 | Ga0207704_101093153 | 235 |
| 551 | 3300025939 | Ga0207665_10000596 | Ga0207665_100005969 | 235 |
| 552 | 3300025939 | Ga0207665_10008819 | Ga0207665_100088195 | 235 |
| 553 | 3300025939 | Ga0207665_10014915 | Ga0207665_100149155 | 235 |
| 554 | 3300025939 | Ga0207665_10021588 | Ga0207665_100215885 | 235 |
| 555 | 3300025939 | Ga0207665_10084007 | Ga0207665_100840071 | 235 |
| 556 | 3300025939 | Ga0207665_10095860 | Ga0207665_100958602 | 235 |
| 557 | 3300025939 | Ga0207665_10184528 | Ga0207665_101845281 | 235 |
| 558 | 3300025941 | Ga0207711_10062942 | Ga0207711_100629424 | 235 |
| 559 | 3300025941 | Ga0207711_10779816 | Ga0207711_107798162 | 235 |
| 560 | 3300025942 | Ga0207689_10095246 | Ga0207689_100952462 | 235 |
| 561 | 3300025944 | Ga0207661_10001952 | Ga0207661_1000195216 | 235 |
| 562 | 3300025944 | Ga0207661_10005239 | Ga0207661_100052393 | 235 |
| 563 | 3300025944 | Ga0207661_10147408 | Ga0207661_101474081 | 235 |
| 564 | 3300025944 | Ga0207661_10430664 | Ga0207661_104306642 | 235 |
| 565 | 3300025945 | Ga0207679_10011893 | Ga0207679_100118932 | 235 |
| 566 | 3300025945 | Ga0207679_10191162 | Ga0207679_101911622 | 235 |
| 567 | 3300025949 | Ga0207667_10001192 | Ga0207667_1000119215 | 235 |
| 568 | 3300025949 | Ga0207667_10001239 | Ga0207667_1000123913 | 235 |
| 569 | 3300025949 | Ga0207667_10187553 | Ga0207667_101875532 | 235 |
| 570 | 3300025949 | Ga0207667_10210046 | Ga0207667_102100461 | 235 |
| 571 | 3300025949 | Ga0207667_10219774 | Ga0207667_102197742 | 235 |
| 572 | 3300025949 | Ga0207667_10262487 | Ga0207667_102624872 | 235 |
| 573 | 3300025981 | Ga0207640_10000057 | Ga0207640_1000005717 | 235 |
| 574 | 3300025981 | Ga0207640_10000158 | Ga0207640_1000015837 | 235 |
| 575 | 3300025981 | Ga0207640_10004462 | Ga0207640_100044624 | 235 |
| 576 | 3300025981 | Ga0207640_10068667 | Ga0207640_100686673 | 235 |
| 577 | 3300025986 | Ga0207658_10009142 | Ga0207658_100091427 | 235 |
| 578 | 3300026023 | Ga0207677_10068958 | Ga0207677_100689582 | 235 |
| 579 | 3300026035 | Ga0207703_10110369 | Ga0207703_101103692 | 235 |
| 580 | 3300026041 | Ga0207639_10000016 | Ga0207639_1000001653 | 235 |
| 581 | 3300026041 | Ga0207639_10225636 | Ga0207639_102256362 | 235 |
| 582 | 3300026067 | Ga0207678_10000903 | Ga0207678_1000090314 | 235 |
| 583 | 3300026067 | Ga0207678_10081936 | Ga0207678_100819363 | 235 |
| 584 | 3300026067 | Ga0207678_10221465 | Ga0207678_102214652 | 235 |
| 585 | 3300026078 | Ga0207702_10002159 | Ga0207702_1000215912 | 235 |
| 586 | 3300026078 | Ga0207702_10172398 | Ga0207702_101723983 | 235 |
| 587 | 3300026078 | Ga0207702_10224439 | Ga0207702_102244392 | 235 |
| 588 | 3300026078 | Ga0207702_10306028 | Ga0207702_103060282 | 235 |
| 589 | 3300026078 | Ga0207702_10384566 | Ga0207702_103845662 | 235 |
| 590 | 3300026088 | Ga0207641_10088629 | Ga0207641_100886294 | 235 |
| 591 | 3300026088 | Ga0207641_10176111 | Ga0207641_101761112 | 235 |
| 592 | 3300026088 | Ga0207641_10382407 | Ga0207641_103824072 | 235 |
| 593 | 3300026088 | Ga0207641_11084520 | Ga0207641_110845201 | 235 |
| 594 | 3300026089 | Ga0207648_10005015 | Ga0207648_100050151 | 235 |
| 595 | 3300026089 | Ga0207648_10010627 | Ga0207648_100106278 | 235 |
| 596 | 3300026116 | Ga0207674_10044672 | Ga0207674_100446724 | 235 |
| 597 | 3300026116 | Ga0207674_10047118 | Ga0207674_100471182 | 235 |
| 598 | 3300026121 | Ga0207683_10015510 | Ga0207683_100155102 | 235 |
| 599 | 3300026142 | Ga0207698_10053084 | Ga0207698_100530843 | 235 |
| 600 | 3300027671 | Ga0209588_1009128 | Ga0209588_10091283 | 235 |
| 601 | 3300027671 | Ga0209588_1010182 | Ga0209588_10101823 | 235 |
| 602 | 3300028379 | Ga0268266_10007114 | Ga0268266_100071146 | 235 |
| 603 | 3300028379 | Ga0268266_10120259 | Ga0268266_101202593 | 235 |
| 604 | 3300028380 | Ga0268265_10918769 | Ga0268265_109187691 | 235 |
| 605 | 3300028381 | Ga0268264_10010932 | Ga0268264_100109328 | 235 |
| 606 | 3300030760 | Ga0265762_1004191 | Ga0265762_10041913 | 235 |
| 607 | 3300030763 | Ga0265763_1009638 | Ga0265763_10096382 | 235 |
| 608 | 3300031090 | Ga0265760_10010730 | Ga0265760_100107303 | 235 |
| 609 | 3300031090 | Ga0265760_10015676 | Ga0265760_100156761 | 235 |
| 610 | 3300031090 | Ga0265760_10094101 | Ga0265760_100941011 | 235 |
| 611 | 3300031090 | Ga0265760_10132109 | Ga0265760_101321091 | 235 |
| 612 | 3300035083 | Ga0373926_0000619 | Ga0373926_0000619_6195_6902 | 235 |
| 613 | 3300035083 | Ga0373926_0001291 | Ga0373926_0001291_2370_3077 | 235 |
| 614 | 3300035086 | Ga0373934_0036650 | Ga0373934_0036650_554_1267 | 235 |
| 615 | 3300035089 | Ga0373944_0043642 | Ga0373944_0043642_598_1344 | 235 |
| 616 | 3300035111 | Ga0373923_0077297 | Ga0373923_0077297_128_841 | 235 |
| 617 | 3300035113 | Ga0373936_0009809 | Ga0373936_0009809_1623_2369 | 235 |
| 618 | 3300035118 | Ga0373954_0011555 | Ga0373954_0011555_2714_3427 | 235 |
| 619 | 3300035170 | Ga0373943_0000093 | Ga0373943_0000093_16900_17646 | 235 |
| 620 | 3300035170 | Ga0373943_0078696 | Ga0373943_0078696_676_1383 | 235 |
| 621 | 3300035171 | Ga0373946_0001175 | Ga0373946_0001175_2357_3064 | 235 |
| 622 | 3300035171 | Ga0373946_0218051 | Ga0373946_0218051_124_846 | 235 |
| 623 | 3300035172 | Ga0373955_0013271 | Ga0373955_0013271_956_1669 | 235 |
| 624 | 3300035692 | Ga0373935_0000406 | Ga0373935_0000406_15789_16535 | 235 |
| 625 | 3300035695 | Ga0373927_0000351 | Ga0373927_0000351_21601_22347 | 235 |
| 626 | 3300035695 | Ga0373927_0005076 | Ga0373927_0005076_2792_3499 | 235 |
| 627 | 3300035695 | Ga0373927_0038721 | Ga0373927_0038721_789_1502 | 235 |
| 628 | 3300035695 | Ga0373927_0057875 | Ga0373927_0057875_1753_2460 | 235 |
| 629 | 3300035725 | Ga0373947_0003946 | Ga0373947_0003946_6501_7247 | 235 |
| 630 | 3300035725 | Ga0373947_0022859 | Ga0373947_0022859_1187_1894 | 235 |
| 631 | 3300035725 | Ga0373947_0135446 | Ga0373947_0135446_327_1049 | 235 |
| 632 | 3300036401 | Ga0373937_0044675 | Ga0373937_0044675_1046_1759 | 235 |
| 633 | 3300036401 | Ga0373937_0258866 | Ga0373937_0258866_149_871 | 235 |
| 634 | 3300037068 | Ga0373925_0001716 | Ga0373925_0001716_12170_12877 | 235 |
| 635 | 3300037068 | Ga0373925_0007208 | Ga0373925_0007208_5602_6348 | 235 |
| 636 | 3300037418 | Ga0395900_0173907 | Ga0395900_0173907_122_829 | 235 |
| 637 | 3300037466 | Ga0395898_0247788 | Ga0395898_0247788_109_816 | 235 |
| 638 | 3300037853 | Ga0436364_0042355 | Ga0436364_0042355_3608_4315 | 235 |
| 639 | 3300037853 | Ga0436364_0524449 | Ga0436364_0524449_654_1361 | 235 |
| 640 | 3300037853 | Ga0436364_1479972 | Ga0436364_1479972_6867_7574 | 235 |
| 641 | 3300038443 | Ga0395901_0069456 | Ga0395901_0069456_1388_2125 | 235 |
| 642 | 3300038443 | Ga0395901_0667415 | Ga0395901_0667415_77_784 | 235 |
| 643 | 3300039437 | Ga0436365_1116478 | Ga0436365_1116478_5626_6333 | 235 |
| 644 | 3300039438 | Ga0436360_0680576 | Ga0436360_0680576_610_1317 | 235 |
| 645 | 3300039438 | Ga0436360_1228382 | Ga0436360_1228382_2772_3491 | 235 |
| 646 | 3300039447 | Ga0436361_0091471 | Ga0436361_0091471_3155_3874 | 235 |
| 647 | 3300039447 | Ga0436361_0400616 | Ga0436361_0400616_32697_33404 | 235 |
| 648 | 3300039447 | Ga0436361_0672781 | Ga0436361_0672781_451_1197 | 235 |
| 649 | 3300039447 | Ga0436361_0705926 | Ga0436361_0705926_2134_2853 | 235 |
| 650 | 3300039447 | Ga0436361_0797421 | Ga0436361_0797421_343_1062 | 235 |
| 651 | 3300039450 | Ga0436363_0493680 | Ga0436363_0493680_657_1364 | 235 |
| 652 | 3300039453 | Ga0436362_0405422 | Ga0436362_0405422_1515_2255 | 235 |
| 653 | 3300042876 | Ga0451577_0081585 | Ga0451577_0081585_1520_2233 | 235 |
| 654 | 3300042876 | Ga0451577_0330959 | Ga0451577_0330959_472_1209 | 235 |
| 655 | 3300044712 | Ga0453684_0062176 | Ga0453684_0062176_3239_3976 | 235 |
| 656 | 3300044712 | Ga0453684_0285831 | Ga0453684_0285831_393_1106 | 235 |
| 657 | 3300044712 | Ga0453684_0864965 | Ga0453684_0864965_233_940 | 235 |
| 658 | 3300045051 | Ga0451576_0413200 | Ga0451576_0413200_510_1223 | 235 |
| 659 | 3300045051 | Ga0451576_0631099 | Ga0451576_0631099_130_843 | 235 |
| 660 | 3300046463 | Ga0495653_0044063 | Ga0495653_0044063_724_1470 | 235 |
| 661 | 3300046472 | Ga0495580_0085653 | Ga0495580_0085653_298_1005 | 235 |
| 662 | 3300046477 | Ga0495664_0068823 | Ga0495664_0068823_1270_2016 | 235 |
| 663 | 3300046516 | Ga0495628_0161288 | Ga0495628_0161288_795_1541 | 235 |
| 664 | 3300046517 | Ga0495630_0005548 | Ga0495630_0005548_6564_7271 | 235 |
| 665 | 3300046517 | Ga0495630_0046166 | Ga0495630_0046166_2235_2942 | 235 |
| 666 | 3300046517 | Ga0495630_0269710 | Ga0495630_0269710_409_1155 | 235 |
| 667 | 3300046526 | Ga0495666_0102548 | Ga0495666_0102548_379_1086 | 235 |
| 668 | 3300046663 | Ga0495635_0080644 | Ga0495635_0080644_391_1137 | 235 |
| 669 | 3300046679 | Ga0495623_0106551 | Ga0495623_0106551_237_983 | 235 |
| 670 | 3300046690 | Ga0495624_0044011 | Ga0495624_0044011_16_762 | 235 |
| 671 | 3300047319 | Ga0495674_0031040 | Ga0495674_0031040_2967_3713 | 235 |
| 672 | 3300047319 | Ga0495674_0092937 | Ga0495674_0092937_922_1629 | 235 |
| 673 | 3300047321 | Ga0495676_0138852 | Ga0495676_0138852_121_867 | 235 |
| 674 | 3300047321 | Ga0495676_0146067 | Ga0495676_0146067_34_741 | 235 |
| 675 | 3300047444 | Ga0495675_0168846 | Ga0495675_0168846_263_970 | 235 |
| 676 | 3300047471 | Ga0495684_0082815 | Ga0495684_0082815_678_1424 | 235 |
| 677 | 3300048903 | Ga0496100_0018636 | Ga0496100_0018636_764_1471 | 235 |
| 678 | 3300048904 | Ga0496101_0120502 | Ga0496101_0120502_746_1453 | 235 |
| 679 | 3300048906 | Ga0496103_0027212 | Ga0496103_0027212_39_776 | 235 |
| 680 | 3300048906 | Ga0496103_0046043 | Ga0496103_0046043_1172_1879 | 235 |
| 681 | 3300048908 | Ga0496105_0040427 | Ga0496105_0040427_525_1256 | 235 |
| 682 | 3300048911 | Ga0496108_0169891 | Ga0496108_0169891_70_777 | 235 |
| 683 | 3300048912 | Ga0496109_0153116 | Ga0496109_0153116_648_1355 | 235 |
| 684 | 3300048914 | Ga0496111_0051037 | Ga0496111_0051037_1029_1736 | 235 |
| 685 | 3300048915 | Ga0496112_0021016 | Ga0496112_0021016_3567_4274 | 235 |
| 686 | 3300048915 | Ga0496112_0317599 | Ga0496112_0317599_105_836 | 235 |
| 687 | 3300050507 | nmdc:mga05p37_42655_c1 | nmdc:mga05p37_42655_c1_1987_2700 | 235 |
| 688 | 3300050510 | nmdc:mga06r32_214002_c1 | nmdc:mga06r32_214002_c1_683_1396 | 235 |
| 689 | 3300050512 | nmdc:mga0n895_4333_c1 | nmdc:mga0n895_4333_c1_7724_8437 | 235 |
| 690 | 3300050512 | nmdc:mga0n895_449647_c1 | nmdc:mga0n895_449647_c1_325_1038 | 235 |
| 691 | 3300050512 | nmdc:mga0n895_6406_c1 | nmdc:mga0n895_6406_c1_3046_3753 | 235 |
| 692 | 3300050512 | nmdc:mga0n895_679426_c1 | nmdc:mga0n895_679426_c1_160_867 | 235 |
| 693 | 3300050513 | nmdc:mga0rr50_140_c1 | nmdc:mga0rr50_140_c1_25784_26497 | 235 |
| 694 | 3300050513 | nmdc:mga0rr50_26280_c1 | nmdc:mga0rr50_26280_c1_164_871 | 235 |
| 695 | 3300050513 | nmdc:mga0rr50_65554_c1 | nmdc:mga0rr50_65554_c1_321_1034 | 235 |
| 696 | 3300050513 | nmdc:mga0rr50_707053_c1 | nmdc:mga0rr50_707053_c1_137_844 | 235 |
| 697 | 3300050514 | nmdc:mga08x19_11550_c1 | nmdc:mga08x19_11550_c1_1734_2441 | 235 |
| 698 | 3300050514 | nmdc:mga08x19_14044_c1 | nmdc:mga08x19_14044_c1_2977_3690 | 235 |
| 699 | 3300050514 | nmdc:mga08x19_177582_c1 | nmdc:mga08x19_177582_c1_722_1429 | 235 |
| 700 | 3300050514 | nmdc:mga08x19_243722_c1 | nmdc:mga08x19_243722_c1_209_916 | 235 |
| 701 | 3300050514 | nmdc:mga08x19_43093_c1 | nmdc:mga08x19_43093_c1_898_1605 | 235 |
| 702 | 3300050514 | nmdc:mga08x19_87945_c1 | nmdc:mga08x19_87945_c1_1081_1797 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.7961 | 2 | 229 |
| 4y6n-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 | 0.7839 | 2 | 223 |
| 5jqx-assembly1.cif.gz_A | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga | 0.7827 | 2 | 222 |
| 7msn-assembly1.cif.gz_B | suns glycosin s-glycosyltransferase | 0.7798 | 2 | 109 |
| 3ckq-assembly1.cif.gz_A-2 | crystal structure of a mycobacterial protein | 0.7784 | 2 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9463 | 3 | 215 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9206 | 3 | 215 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8541 | 3 | 215 | 3.90.550.10 |
| af_Q9VLQ1_42_326_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8286 | 1 | 222 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8266 | 5 | 220 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4VWC6-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9694 | 4 | 223 |
GO:0016757
|
| AF-A0A2D8SSQ6-F1-model_v4 | deleted | 0.9689 | 2 | 224 |
|
| AF-A0A2E8H4R4-F1-model_v4 | UDP-glucose--dolichyl-phosphate glucosyltransferase | 0.9681 | 2 | 223 |
GO:0016757
|
| AF-A0A7W0S4X3-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9672 | 2 | 224 |
GO:0016757
|
| AF-A0A537YDT4-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9667 | 3 | 219 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar