F476159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 367 | 1402 | 433 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10074365|Ga0207674_100743653 |
| Length | 437 |
| Sequence | MEGTRVTDTLTPVLTANWDQPDSFTLAGYSRTGGYEALPRALAMGPDDVIATVKNAVLRGRGGAGFPTGMKWSFIPQNDGKPHYLTVNADESEPGTCKDMPLMMANPHVLIEGIVITCYAIRANHAFIYVRGEVLHVIRRLQYAVAQAYEAGYLGKNILGSGFDLDLVVHAGAGAYICGEETALLTSLEGYRGLPRNRPPFPAVEGLYACPTVINNVESISSVXXIINHGPEWFAGLGTEKSKGFGIFSLSGHVKNPGQYEAPLGITLRELIDLAGGMLRPGHPLKFWTPGGSSTPLLTHEHLDIPLDFEGVGAAGSMLGTRALQIFDDTTCVLRAALRWTEFYQHESCGKCTPCREGTYWLVRAVQRLEDGEGTEEDLETILDVSDNIVGRAFCALGDAAPVPITSAMKYFKDEIILHQKNGGCPFDPAASTAWAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 205 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 324 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 325 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 326 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 327 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 328 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 329 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 330 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 331 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 332 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 333 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 334 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 335 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 336 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 337 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 338 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 339 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 340 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 341 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 342 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 343 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 344 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 345 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 346 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 347 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 348 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 349 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 350 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 351 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 352 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 353 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 354 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 355 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 356 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 357 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 358 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 359 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 360 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 361 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 362 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 363 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 364 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 365 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 366 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 367 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.3 |
| Metatranscriptomes | 1.28 |
| Isolates | 6.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.28 |
| Nodule | 0 |
| Rhizoplane | 6.56 |
| Rhizosphere | 82.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207674_10074365 | 3300026116 | Bacteria | 3410 |
| 2 | JGI25406J46586_10008582 | 3300003203 | Bacteria | 4617 |
| 3 | JGI25404J52841_10007710 | 3300003659 | Bacteria | 2282 |
| 4 | Ga0070658_10000319 | 3300005327 | Bacteria | 41203 |
| 5 | Ga0070658_10000776 | 3300005327 | Bacteria | 27421 |
| 6 | Ga0070658_10010607 | 3300005327 | Bacteria | 7382 |
| 7 | Ga0070658_10027567 | 3300005327 | Bacteria | 4557 |
| 8 | Ga0070683_100048881 | 3300005329 | Bacteria | 3911 |
| 9 | Ga0070683_100100892 | 3300005329 | Bacteria | 2717 |
| 10 | Ga0070690_100040735 | 3300005330 | Bacteria | 2939 |
| 11 | Ga0070670_100084364 | 3300005331 | Bacteria | 2729 |
| 12 | Ga0068869_100010535 | 3300005334 | Bacteria | 6032 |
| 13 | Ga0070680_100000061 | 3300005336 | Bacteria | 56357 |
| 14 | Ga0070680_100006109 | 3300005336 | Bacteria | 9127 |
| 15 | Ga0070680_100075208 | 3300005336 | Bacteria | 2780 |
| 16 | Ga0070682_100005796 | 3300005337 | Bacteria | 6897 |
| 17 | Ga0070682_100026958 | 3300005337 | Bacteria | 3444 |
| 18 | Ga0068868_100014461 | 3300005338 | Bacteria | 5816 |
| 19 | Ga0070660_100103571 | 3300005339 | Bacteria | 2257 |
| 20 | Ga0070691_10000321 | 3300005341 | Bacteria | 17002 |
| 21 | Ga0070661_100112153 | 3300005344 | Bacteria | 2037 |
| 22 | Ga0070692_10003150 | 3300005345 | Bacteria | 6619 |
| 23 | Ga0070669_100088389 | 3300005353 | Bacteria | 2319 |
| 24 | Ga0070675_100011931 | 3300005354 | Bacteria | 6809 |
| 25 | Ga0070671_100000753 | 3300005355 | Bacteria | 23224 |
| 26 | Ga0070671_100012429 | 3300005355 | Bacteria | 6855 |
| 27 | Ga0070688_100018384 | 3300005365 | Bacteria | 4033 |
| 28 | Ga0070659_100022340 | 3300005366 | Bacteria | 4829 |
| 29 | Ga0070659_100138193 | 3300005366 | Bacteria | 1982 |
| 30 | Ga0070667_100051698 | 3300005367 | Bacteria | 3465 |
| 31 | Ga0070709_10001204 | 3300005434 | Bacteria | 14216 |
| 32 | Ga0070709_10001732 | 3300005434 | Bacteria | 11863 |
| 33 | Ga0070709_10012907 | 3300005434 | Bacteria | 4683 |
| 34 | Ga0070714_100000467 | 3300005435 | Bacteria | 29373 |
| 35 | Ga0070714_100001268 | 3300005435 | Bacteria | 18229 |
| 36 | Ga0070714_100106817 | 3300005435 | Bacteria | 2473 |
| 37 | Ga0070714_100113297 | 3300005435 | Bacteria | 2405 |
| 38 | Ga0070713_100000369 | 3300005436 | Bacteria | 28941 |
| 39 | Ga0070713_100201556 | 3300005436 | Bacteria | 1797 |
| 40 | Ga0070710_10000355 | 3300005437 | Bacteria | 21656 |
| 41 | Ga0070710_10005713 | 3300005437 | Bacteria | 5922 |
| 42 | Ga0070710_10017712 | 3300005437 | Bacteria | 3652 |
| 43 | Ga0070710_10064199 | 3300005437 | Bacteria | 2099 |
| 44 | Ga0070711_100000365 | 3300005439 | Bacteria | 23404 |
| 45 | Ga0070711_100015248 | 3300005439 | Bacteria | 4862 |
| 46 | Ga0070705_100084950 | 3300005440 | Bacteria | 1955 |
| 47 | Ga0070705_100104706 | 3300005440 | Bacteria | 1795 |
| 48 | Ga0070700_100018383 | 3300005441 | Bacteria | 4018 |
| 49 | Ga0070663_100001319 | 3300005455 | Bacteria | 13567 |
| 50 | Ga0070678_100001410 | 3300005456 | Bacteria | 12813 |
| 51 | Ga0070678_100063244 | 3300005456 | Bacteria | 2737 |
| 52 | Ga0070681_10001025 | 3300005458 | Bacteria | 23693 |
| 53 | Ga0070681_10024594 | 3300005458 | Bacteria | 6059 |
| 54 | Ga0070681_10232714 | 3300005458 | Bacteria | 1757 |
| 55 | Ga0070685_10024510 | 3300005466 | Bacteria | 3315 |
| 56 | Ga0070707_100026292 | 3300005468 | Bacteria | 5525 |
| 57 | Ga0070707_100046868 | 3300005468 | Bacteria | 4137 |
| 58 | Ga0070707_100126192 | 3300005468 | Bacteria | 2486 |
| 59 | Ga0070698_100000073 | 3300005471 | Bacteria | 75512 |
| 60 | Ga0070698_100049793 | 3300005471 | Bacteria | 4275 |
| 61 | Ga0070698_100059542 | 3300005471 | Bacteria | 3857 |
| 62 | Ga0070698_100064635 | 3300005471 | Bacteria | 3685 |
| 63 | Ga0070699_100018160 | 3300005518 | Bacteria | 6043 |
| 64 | Ga0070679_100001551 | 3300005530 | Bacteria | 20538 |
| 65 | Ga0070679_100024000 | 3300005530 | Bacteria | 5973 |
| 66 | Ga0070679_100040221 | 3300005530 | Bacteria | 4651 |
| 67 | Ga0070679_100113220 | 3300005530 | Bacteria | 2699 |
| 68 | Ga0070679_100126330 | 3300005530 | Bacteria | 2540 |
| 69 | Ga0070679_100156061 | 3300005530 | Bacteria | 2257 |
| 70 | Ga0070684_100021433 | 3300005535 | Bacteria | 5378 |
| 71 | Ga0070697_100002048 | 3300005536 | Bacteria | 15439 |
| 72 | Ga0070697_100033436 | 3300005536 | Bacteria | 4142 |
| 73 | Ga0068853_100166571 | 3300005539 | Bacteria | 1992 |
| 74 | Ga0070672_100095979 | 3300005543 | Bacteria | 2398 |
| 75 | Ga0070696_100000187 | 3300005546 | Bacteria | 36190 |
| 76 | Ga0070693_100001241 | 3300005547 | Bacteria | 11524 |
| 77 | Ga0070693_100092344 | 3300005547 | Bacteria | 1827 |
| 78 | Ga0070665_100005680 | 3300005548 | Bacteria | 12821 |
| 79 | Ga0070665_100050565 | 3300005548 | Bacteria | 4171 |
| 80 | Ga0068855_100039253 | 3300005563 | Bacteria | 5620 |
| 81 | Ga0068857_100013348 | 3300005577 | Bacteria | 7154 |
| 82 | Ga0068854_100071847 | 3300005578 | Bacteria | 2532 |
| 83 | Ga0068856_100387371 | 3300005614 | Bacteria | 1417 |
| 84 | Ga0070702_100000194 | 3300005615 | Bacteria | 19769 |
| 85 | Ga0068852_100082041 | 3300005616 | Bacteria | 2864 |
| 86 | Ga0068864_100016036 | 3300005618 | Bacteria | 6234 |
| 87 | Ga0068851_10071890 | 3300005834 | Bacteria | 1791 |
| 88 | Ga0068870_10000026 | 3300005840 | Bacteria | 46246 |
| 89 | Ga0068863_100052669 | 3300005841 | Bacteria | 3857 |
| 90 | Ga0068863_100081806 | 3300005841 | Bacteria | 3059 |
| 91 | Ga0068858_100013833 | 3300005842 | Bacteria | 7616 |
| 92 | Ga0068860_100046432 | 3300005843 | Bacteria | 4141 |
| 93 | Ga0081540_1000522 | 3300005983 | Bacteria | 37453 |
| 94 | Ga0081540_1001953 | 3300005983 | Bacteria | 17241 |
| 95 | Ga0081540_1033080 | 3300005983 | Bacteria | 2813 |
| 96 | Ga0081539_10008707 | 3300005985 | Bacteria | 8723 |
| 97 | Ga0081539_10015008 | 3300005985 | Bacteria | 5676 |
| 98 | Ga0081539_10019912 | 3300005985 | Bacteria | 4568 |
| 99 | Ga0081539_10035811 | 3300005985 | Bacteria | 2978 |
| 100 | Ga0070717_10001423 | 3300006028 | Bacteria | 16490 |
| 101 | Ga0070717_10026289 | 3300006028 | Bacteria | 4642 |
| 102 | Ga0070717_10106294 | 3300006028 | Bacteria | 2389 |
| 103 | Ga0070717_10191134 | 3300006028 | Bacteria | 1789 |
| 104 | Ga0075365_10019544 | 3300006038 | Bacteria | 4183 |
| 105 | Ga0075363_100002816 | 3300006048 | Bacteria | 7228 |
| 106 | Ga0075363_100002835 | 3300006048 | Bacteria | 7212 |
| 107 | Ga0075363_100036911 | 3300006048 | Bacteria | 2564 |
| 108 | Ga0075364_10001293 | 3300006051 | Bacteria | 13488 |
| 109 | Ga0075364_10003691 | 3300006051 | Bacteria | 8739 |
| 110 | Ga0070716_100000220 | 3300006173 | Bacteria | 22807 |
| 111 | Ga0070712_100182365 | 3300006175 | Bacteria | 1637 |
| 112 | Ga0070712_100220107 | 3300006175 | Bacteria | 1502 |
| 113 | Ga0075362_10012217 | 3300006177 | Bacteria | 3405 |
| 114 | Ga0075369_10002562 | 3300006186 | Bacteria | 6505 |
| 115 | Ga0075369_10019184 | 3300006186 | Bacteria | 2790 |
| 116 | Ga0097621_100011771 | 3300006237 | Bacteria | 6461 |
| 117 | Ga0075370_10001448 | 3300006353 | Bacteria | 10304 |
| 118 | Ga0075370_10050298 | 3300006353 | Bacteria | 2364 |
| 119 | Ga0068871_100012333 | 3300006358 | Bacteria | 6295 |
| 120 | Ga0075428_100030689 | 3300006844 | Bacteria | 5943 |
| 121 | Ga0075428_100211642 | 3300006844 | Bacteria | 2095 |
| 122 | Ga0075430_100034036 | 3300006846 | Bacteria | 4324 |
| 123 | Ga0075433_10001597 | 3300006852 | Bacteria | 16787 |
| 124 | Ga0075434_100006004 | 3300006871 | Bacteria | 11113 |
| 125 | Ga0075436_100006291 | 3300006914 | Bacteria | 8133 |
| 126 | Ga0075436_100064244 | 3300006914 | Bacteria | 2537 |
| 127 | Ga0075435_100010141 | 3300007076 | Bacteria | 6880 |
| 128 | Ga0075435_100035958 | 3300007076 | Bacteria | 3933 |
| 129 | Ga0099795_10020220 | 3300007788 | Bacteria | 2165 |
| 130 | Ga0105251_10017455 | 3300009011 | Bacteria | 3845 |
| 131 | Ga0111539_10045581 | 3300009094 | Bacteria | 5248 |
| 132 | Ga0114129_10056964 | 3300009147 | Bacteria | 5471 |
| 133 | Ga0114129_10367981 | 3300009147 | Bacteria | 1901 |
| 134 | Ga0114129_10390766 | 3300009147 | Bacteria | 1835 |
| 135 | Ga0114129_10431550 | 3300009147 | Bacteria | 1731 |
| 136 | Ga0105241_10021355 | 3300009174 | Bacteria | 4786 |
| 137 | Ga0105242_10072318 | 3300009176 | Bacteria | 2864 |
| 138 | Ga0105248_10156136 | 3300009177 | Bacteria | 2575 |
| 139 | Ga0105237_10037928 | 3300009545 | Bacteria | 4868 |
| 140 | Ga0105238_10010962 | 3300009551 | Bacteria | 9115 |
| 141 | Ga0105238_10240234 | 3300009551 | Bacteria | 1789 |
| 142 | Ga0105249_10005021 | 3300009553 | Bacteria | 11409 |
| 143 | Ga0105249_10069927 | 3300009553 | Bacteria | 3240 |
| 144 | Ga0105249_10093102 | 3300009553 | Bacteria | 2822 |
| 145 | Ga0105239_10062210 | 3300010375 | Bacteria | 4097 |
| 146 | Ga0157373_10092702 | 3300013100 | Bacteria | 2127 |
| 147 | Ga0157371_10011136 | 3300013102 | Bacteria | 6960 |
| 148 | Ga0157371_10109997 | 3300013102 | Bacteria | 1956 |
| 149 | Ga0157370_10142065 | 3300013104 | Bacteria | 2237 |
| 150 | Ga0157369_10000890 | 3300013105 | Bacteria | 38122 |
| 151 | Ga0157369_10038920 | 3300013105 | Bacteria | 5198 |
| 152 | Ga0157369_10082310 | 3300013105 | Bacteria | 3444 |
| 153 | Ga0157369_10307047 | 3300013105 | Bacteria | 1650 |
| 154 | Ga0157374_10060944 | 3300013296 | Bacteria | 3532 |
| 155 | Ga0157372_10188381 | 3300013307 | Bacteria | 2389 |
| 156 | Ga0157372_10525306 | 3300013307 | Bacteria | 1380 |
| 157 | Ga0157375_10143866 | 3300013308 | Bacteria | 2514 |
| 158 | Ga0163163_10043199 | 3300014325 | Bacteria | 4418 |
| 159 | Ga0163163_10129194 | 3300014325 | Bacteria | 2566 |
| 160 | Ga0157380_10001844 | 3300014326 | Bacteria | 14014 |
| 161 | Ga0157380_10126490 | 3300014326 | Bacteria | 2173 |
| 162 | Ga0157376_10094830 | 3300014969 | Bacteria | 2594 |
| 163 | Ga0163161_10042344 | 3300017792 | Bacteria | 3275 |
| 164 | Ga0163161_10092813 | 3300017792 | Bacteria | 2236 |
| 165 | Ga0197907_10808444 | 3300020069 | Bacteria | 2951 |
| 166 | Ga0206351_10007999 | 3300020077 | Bacteria | 2232 |
| 167 | Ga0206350_10886524 | 3300020080 | Bacteria | 1702 |
| 168 | Ga0206354_10175752 | 3300020081 | Bacteria | 3815 |
| 169 | Ga0206353_11934209 | 3300020082 | Bacteria | 4499 |
| 170 | Ga0213876_10000793 | 3300021384 | Bacteria | 21431 |
| 171 | Ga0213875_10001511 | 3300021388 | Bacteria | 14975 |
| 172 | Ga0213875_10010278 | 3300021388 | Bacteria | 4690 |
| 173 | Ga0224712_10000868 | 3300022467 | Bacteria | 6453 |
| 174 | Ga0224712_10010524 | 3300022467 | Bacteria | 2833 |
| 175 | Ga0224712_10046956 | 3300022467 | Bacteria | 1660 |
| 176 | Ga0207656_10062823 | 3300025321 | Bacteria | 1633 |
| 177 | Ga0207692_10000079 | 3300025898 | Bacteria | 27914 |
| 178 | Ga0207692_10002371 | 3300025898 | Bacteria | 7229 |
| 179 | Ga0207692_10006984 | 3300025898 | Bacteria | 4607 |
| 180 | Ga0207692_10029282 | 3300025898 | Bacteria | 2615 |
| 181 | Ga0207692_10073474 | 3300025898 | Bacteria | 1809 |
| 182 | Ga0207710_10009415 | 3300025900 | Bacteria | 4111 |
| 183 | Ga0207688_10005541 | 3300025901 | Bacteria | 6866 |
| 184 | Ga0207647_10042708 | 3300025904 | Bacteria | 2842 |
| 185 | Ga0207699_10000297 | 3300025906 | Bacteria | 26655 |
| 186 | Ga0207699_10002064 | 3300025906 | Bacteria | 9489 |
| 187 | Ga0207699_10008897 | 3300025906 | Bacteria | 4977 |
| 188 | Ga0207699_10028695 | 3300025906 | Bacteria | 3095 |
| 189 | Ga0207699_10060008 | 3300025906 | Bacteria | 2282 |
| 190 | Ga0207643_10000062 | 3300025908 | Bacteria | 71074 |
| 191 | Ga0207705_10000676 | 3300025909 | Bacteria | 28263 |
| 192 | Ga0207684_10010070 | 3300025910 | Bacteria | 8326 |
| 193 | Ga0207684_10051241 | 3300025910 | Bacteria | 3502 |
| 194 | Ga0207707_10000277 | 3300025912 | Bacteria | 55264 |
| 195 | Ga0207707_10008067 | 3300025912 | Bacteria | 9144 |
| 196 | Ga0207707_10009801 | 3300025912 | Bacteria | 8308 |
| 197 | Ga0207707_10010633 | 3300025912 | Bacteria | 7993 |
| 198 | Ga0207693_10029887 | 3300025915 | Bacteria | 4300 |
| 199 | Ga0207663_10004529 | 3300025916 | Bacteria | 6920 |
| 200 | Ga0207660_10000115 | 3300025917 | Bacteria | 46447 |
| 201 | Ga0207660_10002198 | 3300025917 | Bacteria | 12907 |
| 202 | Ga0207657_10013589 | 3300025919 | Bacteria | 7985 |
| 203 | Ga0207657_10076976 | 3300025919 | Bacteria | 2813 |
| 204 | Ga0207657_10115856 | 3300025919 | Bacteria | 2208 |
| 205 | Ga0207657_10165060 | 3300025919 | Bacteria | 1797 |
| 206 | Ga0207649_10000906 | 3300025920 | Bacteria | 18685 |
| 207 | Ga0207652_10008957 | 3300025921 | Bacteria | 8066 |
| 208 | Ga0207652_10010364 | 3300025921 | Bacteria | 7504 |
| 209 | Ga0207652_10016837 | 3300025921 | Bacteria | 5974 |
| 210 | Ga0207652_10101707 | 3300025921 | Bacteria | 2539 |
| 211 | Ga0207652_10135819 | 3300025921 | Bacteria | 2196 |
| 212 | Ga0207652_10193250 | 3300025921 | Bacteria | 1830 |
| 213 | Ga0207646_10023054 | 3300025922 | Bacteria | 5723 |
| 214 | Ga0207646_10055127 | 3300025922 | Bacteria | 3555 |
| 215 | Ga0207694_10017076 | 3300025924 | Bacteria | 5482 |
| 216 | Ga0207650_10008170 | 3300025925 | Bacteria | 7136 |
| 217 | Ga0207659_10001919 | 3300025926 | Bacteria | 12327 |
| 218 | Ga0207687_10006354 | 3300025927 | Bacteria | 7809 |
| 219 | Ga0207700_10000270 | 3300025928 | Bacteria | 30934 |
| 220 | Ga0207700_10003858 | 3300025928 | Bacteria | 8757 |
| 221 | Ga0207700_10015247 | 3300025928 | Bacteria | 5060 |
| 222 | Ga0207700_10045111 | 3300025928 | Bacteria | 3250 |
| 223 | Ga0207700_10062508 | 3300025928 | Bacteria | 2829 |
| 224 | Ga0207700_10140263 | 3300025928 | Bacteria | 1985 |
| 225 | Ga0207700_10226550 | 3300025928 | Bacteria | 1587 |
| 226 | Ga0207664_10000430 | 3300025929 | Bacteria | 29958 |
| 227 | Ga0207664_10000729 | 3300025929 | Bacteria | 22368 |
| 228 | Ga0207664_10011587 | 3300025929 | Bacteria | 6277 |
| 229 | Ga0207664_10016341 | 3300025929 | Bacteria | 5413 |
| 230 | Ga0207664_10016390 | 3300025929 | Bacteria | 5406 |
| 231 | Ga0207664_10036319 | 3300025929 | Bacteria | 3808 |
| 232 | Ga0207664_10083002 | 3300025929 | Bacteria | 2611 |
| 233 | Ga0207664_10120614 | 3300025929 | Bacteria | 2194 |
| 234 | Ga0207644_10004647 | 3300025931 | Bacteria | 8925 |
| 235 | Ga0207644_10008658 | 3300025931 | Bacteria | 6656 |
| 236 | Ga0207690_10000171 | 3300025932 | Bacteria | 50511 |
| 237 | Ga0207665_10000611 | 3300025939 | Bacteria | 24040 |
| 238 | Ga0207665_10001386 | 3300025939 | Bacteria | 16319 |
| 239 | Ga0207665_10021920 | 3300025939 | Bacteria | 4201 |
| 240 | Ga0207691_10019406 | 3300025940 | Bacteria | 6434 |
| 241 | Ga0207691_10090667 | 3300025940 | Bacteria | 2740 |
| 242 | Ga0207711_10327572 | 3300025941 | Bacteria | 1416 |
| 243 | Ga0207689_10001383 | 3300025942 | Bacteria | 23240 |
| 244 | Ga0207661_10013928 | 3300025944 | Bacteria | 5878 |
| 245 | Ga0207661_10086006 | 3300025944 | Bacteria | 2608 |
| 246 | Ga0207661_10290431 | 3300025944 | Bacteria | 1463 |
| 247 | Ga0207679_10000828 | 3300025945 | Bacteria | 19903 |
| 248 | Ga0207667_10244285 | 3300025949 | Bacteria | 1837 |
| 249 | Ga0207651_10161614 | 3300025960 | Bacteria | 1756 |
| 250 | Ga0207712_10043986 | 3300025961 | Bacteria | 3084 |
| 251 | Ga0207640_10036130 | 3300025981 | Bacteria | 3099 |
| 252 | Ga0207677_10003805 | 3300026023 | Bacteria | 8017 |
| 253 | Ga0207678_10000105 | 3300026067 | Bacteria | 68804 |
| 254 | Ga0207708_10042151 | 3300026075 | Bacteria | 3480 |
| 255 | Ga0207702_10000662 | 3300026078 | Bacteria | 37468 |
| 256 | Ga0207702_10006045 | 3300026078 | Bacteria | 10503 |
| 257 | Ga0207641_10002000 | 3300026088 | Bacteria | 19446 |
| 258 | Ga0207641_10050658 | 3300026088 | Bacteria | 3513 |
| 259 | Ga0207676_10000596 | 3300026095 | Bacteria | 29670 |
| 260 | Ga0207674_10017071 | 3300026116 | Bacteria | 7922 |
| 261 | Ga0207674_10072722 | 3300026116 | Bacteria | 3453 |
| 262 | Ga0207675_100054587 | 3300026118 | Bacteria | 3728 |
| 263 | Ga0207675_100129117 | 3300026118 | Bacteria | 2396 |
| 264 | Ga0207683_10000092 | 3300026121 | Bacteria | 72389 |
| 265 | Ga0207683_10026749 | 3300026121 | Bacteria | 4982 |
| 266 | Ga0207698_10016868 | 3300026142 | Bacteria | 4937 |
| 267 | Ga0207428_10006417 | 3300027907 | Bacteria | 10862 |
| 268 | Ga0268266_10003190 | 3300028379 | Bacteria | 16606 |
| 269 | Ga0268266_10014301 | 3300028379 | Bacteria | 6825 |
| 270 | Ga0268266_10036756 | 3300028379 | Bacteria | 4171 |
| 271 | Ga0268266_10214456 | 3300028379 | Bacteria | 1767 |
| 272 | Ga0265337_1000389 | 3300028556 | Bacteria | 23661 |
| 273 | Ga0265326_10000357 | 3300028558 | Bacteria | 19299 |
| 274 | Ga0265319_1000939 | 3300028563 | Bacteria | 18253 |
| 275 | Ga0265334_10000792 | 3300028573 | Bacteria | 15812 |
| 276 | Ga0265323_10002259 | 3300028653 | Bacteria | 8950 |
| 277 | Ga0265322_10020698 | 3300028654 | Bacteria | 1884 |
| 278 | Ga0265336_10001444 | 3300028666 | Bacteria | 10832 |
| 279 | Ga0265338_10001255 | 3300028800 | Bacteria | 41829 |
| 280 | Ga0265324_10000773 | 3300029957 | Bacteria | 21095 |
| 281 | Ga0307511_10118667 | 3300030521 | Bacteria | 1647 |
| 282 | Ga0316177_1184759 | 3300030731 | Bacteria | 2315 |
| 283 | Ga0265332_10001478 | 3300031238 | Bacteria | 13116 |
| 284 | Ga0265320_10000980 | 3300031240 | Bacteria | 21245 |
| 285 | Ga0265325_10002776 | 3300031241 | Bacteria | 11694 |
| 286 | Ga0265340_10001509 | 3300031247 | Bacteria | 13356 |
| 287 | Ga0265340_10004198 | 3300031247 | Bacteria | 8082 |
| 288 | Ga0265339_10008767 | 3300031249 | Bacteria | 6409 |
| 289 | Ga0265339_10012226 | 3300031249 | Bacteria | 5249 |
| 290 | Ga0265327_10000021 | 3300031251 | Bacteria | 417788 |
| 291 | Ga0265327_10000071 | 3300031251 | Bacteria | 215502 |
| 292 | Ga0265327_10030444 | 3300031251 | Bacteria | 3052 |
| 293 | Ga0265316_10004740 | 3300031344 | Bacteria | 13456 |
| 294 | Ga0307513_10001302 | 3300031456 | Bacteria | 36100 |
| 295 | Ga0265313_10010756 | 3300031595 | Bacteria | 5751 |
| 296 | Ga0316579_10000030 | 3300031691 | Bacteria | 32158 |
| 297 | Ga0265314_10006663 | 3300031711 | Bacteria | 10148 |
| 298 | Ga0265314_10007781 | 3300031711 | Bacteria | 9260 |
| 299 | Ga0265342_10001351 | 3300031712 | Bacteria | 22957 |
| 300 | Ga0316576_10081962 | 3300031727 | Bacteria | 2394 |
| 301 | Ga0307405_10022837 | 3300031731 | Bacteria | 3544 |
| 302 | Ga0307405_10101594 | 3300031731 | Bacteria | 1930 |
| 303 | Ga0307405_10149266 | 3300031731 | Bacteria | 1641 |
| 304 | Ga0307410_10026915 | 3300031852 | Bacteria | 3627 |
| 305 | Ga0307406_10179281 | 3300031901 | Bacteria | 1541 |
| 306 | Ga0307409_100022479 | 3300031995 | Bacteria | 4350 |
| 307 | Ga0307409_100029871 | 3300031995 | Bacteria | 3907 |
| 308 | Ga0307409_100129522 | 3300031995 | Bacteria | 2153 |
| 309 | Ga0307409_100273098 | 3300031995 | Bacteria | 1558 |
| 310 | Ga0307409_100337170 | 3300031995 | Bacteria | 1417 |
| 311 | Ga0307416_100155902 | 3300032002 | Bacteria | 2102 |
| 312 | Ga0307414_10080970 | 3300032004 | Bacteria | 2376 |
| 313 | Ga0307414_10298932 | 3300032004 | Bacteria | 1361 |
| 314 | Ga0373926_0009309 | 3300035083 | Bacteria | 3280 |
| 315 | Ga0373934_0000169 | 3300035086 | Bacteria | 23878 |
| 316 | Ga0373934_0003190 | 3300035086 | Bacteria | 5994 |
| 317 | Ga0373934_0022810 | 3300035086 | Bacteria | 2415 |
| 318 | Ga0373923_0018883 | 3300035111 | Bacteria | 2661 |
| 319 | Ga0373923_0052334 | 3300035111 | Bacteria | 1715 |
| 320 | Ga0373936_0011330 | 3300035113 | Bacteria | 3375 |
| 321 | Ga0373941_0015611 | 3300035115 | Bacteria | 2052 |
| 322 | Ga0373945_0005546 | 3300035116 | Bacteria | 4043 |
| 323 | Ga0373945_0023475 | 3300035116 | Bacteria | 2131 |
| 324 | Ga0373953_0000574 | 3300035117 | Bacteria | 10228 |
| 325 | Ga0373953_0010793 | 3300035117 | Bacteria | 3189 |
| 326 | Ga0373954_0000115 | 3300035118 | Bacteria | 27323 |
| 327 | Ga0373954_0020972 | 3300035118 | Bacteria | 2957 |
| 328 | Ga0373954_0081750 | 3300035118 | Bacteria | 1544 |
| 329 | Ga0373956_0000283 | 3300035119 | Bacteria | 20458 |
| 330 | Ga0373957_0000047 | 3300035120 | Bacteria | 31450 |
| 331 | Ga0373957_0000330 | 3300035120 | Bacteria | 11918 |
| 332 | Ga0373957_0008086 | 3300035120 | Bacteria | 3394 |
| 333 | Ga0373957_0016566 | 3300035120 | Bacteria | 2552 |
| 334 | Ga0373943_0001264 | 3300035170 | Bacteria | 11318 |
| 335 | Ga0373955_0000020 | 3300035172 | Bacteria | 63100 |
| 336 | Ga0373955_0023105 | 3300035172 | Bacteria | 3163 |
| 337 | Ga0373924_0053212 | 3300035410 | Bacteria | 1681 |
| 338 | Ga0373935_0001783 | 3300035692 | Bacteria | 12111 |
| 339 | Ga0373935_0002440 | 3300035692 | Bacteria | 10639 |
| 340 | Ga0373935_0003356 | 3300035692 | Bacteria | 9277 |
| 341 | Ga0373935_0125318 | 3300035692 | Bacteria | 1720 |
| 342 | Ga0373927_0002894 | 3300035695 | Bacteria | 12485 |
| 343 | Ga0373933_0000192 | 3300035724 | Bacteria | 40573 |
| 344 | Ga0373933_0004542 | 3300035724 | Bacteria | 7612 |
| 345 | Ga0373933_0009726 | 3300035724 | Bacteria | 5261 |
| 346 | Ga0373933_0013288 | 3300035724 | Bacteria | 4561 |
| 347 | Ga0373933_0067971 | 3300035724 | Bacteria | 2163 |
| 348 | Ga0373947_0000009 | 3300035725 | Bacteria | 172751 |
| 349 | Ga0373947_0023195 | 3300035725 | Bacteria | 3608 |
| 350 | Ga0373937_0000067 | 3300036401 | Bacteria | 94291 |
| 351 | Ga0373937_0048534 | 3300036401 | Bacteria | 3886 |
| 352 | Ga0373937_0099769 | 3300036401 | Bacteria | 2693 |
| 353 | Ga0373937_0155586 | 3300036401 | Bacteria | 2142 |
| 354 | Ga0372808_000433 | 3300036459 | Bacteria | 3250 |
| 355 | Ga0373925_0000006 | 3300037068 | Bacteria | 278942 |
| 356 | Ga0373925_0054670 | 3300037068 | Bacteria | 2986 |
| 357 | Ga0373925_0152704 | 3300037068 | Bacteria | 1814 |
| 358 | Ga0373925_0221428 | 3300037068 | Bacteria | 1510 |
| 359 | Ga0395900_0003901 | 3300037418 | Bacteria | 15934 |
| 360 | Ga0395900_0074645 | 3300037418 | Bacteria | 3486 |
| 361 | Ga0395898_0040878 | 3300037466 | Bacteria | 4583 |
| 362 | Ga0395898_0114918 | 3300037466 | Bacteria | 2579 |
| 363 | Ga0436364_0411147 | 3300037853 | Bacteria | 1824 |
| 364 | Ga0436364_0724530 | 3300037853 | Bacteria | 21942 |
| 365 | Ga0436364_0735260 | 3300037853 | Bacteria | 16919 |
| 366 | Ga0436364_1004318 | 3300037853 | Bacteria | 7937 |
| 367 | Ga0436364_1469180 | 3300037853 | Bacteria | 1974 |
| 368 | Ga0400485_14323 | 3300038735 | Bacteria | 58881 |
| 369 | Ga0400486_16675 | 3300038742 | Bacteria | 25458 |
| 370 | Ga0436365_0567091 | 3300039437 | Bacteria | 46375 |
| 371 | Ga0436363_0152383 | 3300039450 | Bacteria | 2983 |
| 372 | Ga0436363_1296994 | 3300039450 | Bacteria | 1566 |
| 373 | Ga0439442_003290 | 3300042002 | Bacteria | 3194 |
| 374 | Ga0439460_0022389 | 3300042461 | Bacteria | 1733 |
| 375 | Ga0466972_0011562 | 3300044658 | Bacteria | 4432 |
| 376 | Ga0466965_0034461 | 3300044683 | Bacteria | 2477 |
| 377 | Ga0466965_0037007 | 3300044683 | Bacteria | 2396 |
| 378 | Ga0466966_0005406 | 3300044684 | Bacteria | 8394 |
| 379 | Ga0466966_0033562 | 3300044684 | Bacteria | 3323 |
| 380 | Ga0466966_0042033 | 3300044684 | Bacteria | 2936 |
| 381 | Ga0466961_0016926 | 3300044693 | Bacteria | 4685 |
| 382 | Ga0466961_0021195 | 3300044693 | Bacteria | 4183 |
| 383 | Ga0466961_0108726 | 3300044693 | Bacteria | 1745 |
| 384 | Ga0466963_0001501 | 3300044694 | Bacteria | 12624 |
| 385 | Ga0466963_0104802 | 3300044694 | Bacteria | 1938 |
| 386 | Ga0466964_0011072 | 3300044706 | Bacteria | 3408 |
| 387 | Ga0466964_0021022 | 3300044706 | Bacteria | 2520 |
| 388 | Ga0466970_0041705 | 3300044765 | Bacteria | 2439 |
| 389 | Ga0466957_0001084 | 3300044842 | Bacteria | 14046 |
| 390 | Ga0466957_0007517 | 3300044842 | Bacteria | 6157 |
| 391 | Ga0466957_0008284 | 3300044842 | Bacteria | 5910 |
| 392 | Ga0466957_0023207 | 3300044842 | Bacteria | 3666 |
| 393 | Ga0466960_0005774 | 3300044901 | Bacteria | 4926 |
| 394 | Ga0466960_0016391 | 3300044901 | Bacteria | 3213 |
| 395 | Ga0466960_0025185 | 3300044901 | Bacteria | 2690 |
| 396 | Ga0466959_0026506 | 3300045049 | Bacteria | 4296 |
| 397 | Ga0466958_0012247 | 3300045836 | Bacteria | 4855 |
| 398 | Ga0466958_0027717 | 3300045836 | Bacteria | 3353 |
| 399 | Ga0466958_0030764 | 3300045836 | Bacteria | 3190 |
| 400 | Ga0466958_0032180 | 3300045836 | Bacteria | 3119 |
| 401 | Ga0466958_0064424 | 3300045836 | Bacteria | 2235 |
| 402 | Ga0466967_0006860 | 3300045976 | Bacteria | 8128 |
| 403 | Ga0466967_0009250 | 3300045976 | Bacteria | 7297 |
| 404 | Ga0466967_0009645 | 3300045976 | Bacteria | 7179 |
| 405 | Ga0466967_0010064 | 3300045976 | Bacteria | 7067 |
| 406 | Ga0466967_0010481 | 3300045976 | Bacteria | 6957 |
| 407 | Ga0466967_0017591 | 3300045976 | Bacteria | 5682 |
| 408 | Ga0466967_0059894 | 3300045976 | Bacteria | 3372 |
| 409 | Ga0466967_0352801 | 3300045976 | Bacteria | 1424 |
| 410 | Ga0495627_007742 | 3300046453 | Bacteria | 4094 |
| 411 | Ga0495592_0000069 | 3300046454 | Bacteria | 94288 |
| 412 | Ga0495592_0048705 | 3300046454 | Bacteria | 3151 |
| 413 | Ga0495592_0139114 | 3300046454 | Bacteria | 1690 |
| 414 | Ga0495629_0064814 | 3300046459 | Bacteria | 2550 |
| 415 | Ga0495651_0000016 | 3300046462 | Bacteria | 125612 |
| 416 | Ga0495651_0009105 | 3300046462 | Bacteria | 7620 |
| 417 | Ga0495651_0010707 | 3300046462 | Bacteria | 7053 |
| 418 | Ga0495651_0017471 | 3300046462 | Bacteria | 5555 |
| 419 | Ga0495651_0088199 | 3300046462 | Bacteria | 2331 |
| 420 | Ga0495653_0000381 | 3300046463 | Bacteria | 35673 |
| 421 | Ga0495653_0050107 | 3300046463 | Bacteria | 3212 |
| 422 | Ga0495653_0075984 | 3300046463 | Bacteria | 2498 |
| 423 | Ga0495653_0128304 | 3300046463 | Bacteria | 1798 |
| 424 | Ga0495580_0160330 | 3300046472 | Bacteria | 1557 |
| 425 | Ga0495582_0010542 | 3300046473 | Bacteria | 5084 |
| 426 | Ga0495582_0039979 | 3300046473 | Bacteria | 2582 |
| 427 | Ga0495639_0013444 | 3300046475 | Bacteria | 3535 |
| 428 | Ga0495639_0019615 | 3300046475 | Bacteria | 2952 |
| 429 | Ga0495662_0001777 | 3300046476 | Bacteria | 10788 |
| 430 | Ga0495662_0030379 | 3300046476 | Bacteria | 2608 |
| 431 | Ga0495662_0047183 | 3300046476 | Bacteria | 2080 |
| 432 | Ga0495664_0003802 | 3300046477 | Bacteria | 8236 |
| 433 | Ga0495664_0011084 | 3300046477 | Bacteria | 5071 |
| 434 | Ga0495664_0047656 | 3300046477 | Bacteria | 2543 |
| 435 | Ga0495664_0084815 | 3300046477 | Bacteria | 1901 |
| 436 | Ga0495607_0053419 | 3300046501 | Bacteria | 2335 |
| 437 | Ga0495608_0000051 | 3300046511 | Bacteria | 94719 |
| 438 | Ga0495608_0063559 | 3300046511 | Bacteria | 2421 |
| 439 | Ga0495618_0014794 | 3300046514 | Bacteria | 4759 |
| 440 | Ga0495618_0123310 | 3300046514 | Bacteria | 1659 |
| 441 | Ga0495628_0000126 | 3300046516 | Bacteria | 63839 |
| 442 | Ga0495628_0014290 | 3300046516 | Bacteria | 6660 |
| 443 | Ga0495628_0042115 | 3300046516 | Bacteria | 3643 |
| 444 | Ga0495628_0046900 | 3300046516 | Bacteria | 3430 |
| 445 | Ga0495630_0019309 | 3300046517 | Bacteria | 5009 |
| 446 | Ga0495630_0044091 | 3300046517 | Bacteria | 3333 |
| 447 | Ga0495630_0136953 | 3300046517 | Bacteria | 1860 |
| 448 | Ga0495630_0145452 | 3300046517 | Bacteria | 1802 |
| 449 | Ga0495652_0000831 | 3300046529 | Bacteria | 35576 |
| 450 | Ga0495652_0062714 | 3300046529 | Bacteria | 3133 |
| 451 | Ga0495665_0007121 | 3300046531 | Bacteria | 6036 |
| 452 | Ga0495665_0010808 | 3300046531 | Bacteria | 4941 |
| 453 | Ga0495640_0010451 | 3300046533 | Bacteria | 7169 |
| 454 | Ga0495640_0021758 | 3300046533 | Bacteria | 4698 |
| 455 | Ga0495640_0022598 | 3300046533 | Bacteria | 4593 |
| 456 | Ga0495587_0000058 | 3300046536 | Bacteria | 94307 |
| 457 | Ga0495587_0007728 | 3300046536 | Bacteria | 6952 |
| 458 | Ga0495587_0008381 | 3300046536 | Bacteria | 6651 |
| 459 | Ga0495587_0016591 | 3300046536 | Bacteria | 4582 |
| 460 | Ga0495587_0021679 | 3300046536 | Bacteria | 3963 |
| 461 | Ga0495645_0058993 | 3300046543 | Bacteria | 2783 |
| 462 | Ga0495667_0000062 | 3300046559 | Bacteria | 94307 |
| 463 | Ga0495667_0015798 | 3300046559 | Bacteria | 5104 |
| 464 | Ga0495667_0035985 | 3300046559 | Bacteria | 3306 |
| 465 | Ga0495667_0075135 | 3300046559 | Bacteria | 2199 |
| 466 | Ga0495667_0172284 | 3300046559 | Bacteria | 1390 |
| 467 | Ga0495634_0005403 | 3300046642 | Bacteria | 9842 |
| 468 | Ga0495634_0031381 | 3300046642 | Bacteria | 3660 |
| 469 | Ga0495634_0113937 | 3300046642 | Bacteria | 1736 |
| 470 | Ga0495635_0045886 | 3300046663 | Bacteria | 3014 |
| 471 | Ga0495588_0101906 | 3300046674 | Bacteria | 1509 |
| 472 | Ga0495657_0000065 | 3300046675 | Bacteria | 94307 |
| 473 | Ga0495657_0004954 | 3300046675 | Bacteria | 10586 |
| 474 | Ga0495599_0000045 | 3300046678 | Bacteria | 86086 |
| 475 | Ga0495599_0031083 | 3300046678 | Bacteria | 3351 |
| 476 | Ga0495599_0078591 | 3300046678 | Bacteria | 2060 |
| 477 | Ga0495623_0000051 | 3300046679 | Bacteria | 72814 |
| 478 | Ga0495623_0013751 | 3300046679 | Bacteria | 5246 |
| 479 | Ga0495623_0019760 | 3300046679 | Bacteria | 4355 |
| 480 | Ga0495646_0021582 | 3300046680 | Bacteria | 4067 |
| 481 | Ga0495646_0039263 | 3300046680 | Bacteria | 2919 |
| 482 | Ga0495646_0056938 | 3300046680 | Bacteria | 2342 |
| 483 | Ga0495613_0008898 | 3300046689 | Bacteria | 7449 |
| 484 | Ga0495613_0056674 | 3300046689 | Bacteria | 2877 |
| 485 | Ga0495624_0006149 | 3300046690 | Bacteria | 8549 |
| 486 | Ga0495624_0114142 | 3300046690 | Bacteria | 1660 |
| 487 | Ga0495600_0012030 | 3300046809 | Bacteria | 5404 |
| 488 | Ga0495600_0015392 | 3300046809 | Bacteria | 4835 |
| 489 | Ga0495600_0051991 | 3300046809 | Bacteria | 2674 |
| 490 | Ga0495581_0001158 | 3300047315 | Bacteria | 14442 |
| 491 | Ga0495581_0023049 | 3300047315 | Bacteria | 3608 |
| 492 | Ga0495581_0065200 | 3300047315 | Bacteria | 2105 |
| 493 | Ga0495604_0000233 | 3300047317 | Bacteria | 49951 |
| 494 | Ga0495604_0025821 | 3300047317 | Bacteria | 4678 |
| 495 | Ga0495604_0037096 | 3300047317 | Bacteria | 3840 |
| 496 | Ga0495674_0029025 | 3300047319 | Bacteria | 5039 |
| 497 | Ga0495674_0057173 | 3300047319 | Bacteria | 3414 |
| 498 | Ga0495676_0087330 | 3300047321 | Bacteria | 2344 |
| 499 | Ga0495680_0000678 | 3300047322 | Bacteria | 38049 |
| 500 | Ga0495680_0037000 | 3300047322 | Bacteria | 3911 |
| 501 | Ga0495680_0065874 | 3300047322 | Bacteria | 2773 |
| 502 | Ga0495683_0000766 | 3300047323 | Bacteria | 23099 |
| 503 | Ga0495675_0000325 | 3300047444 | Bacteria | 33817 |
| 504 | Ga0495675_0008260 | 3300047444 | Bacteria | 6441 |
| 505 | Ga0495684_0056389 | 3300047471 | Bacteria | 2995 |
| 506 | Ga0495684_0182173 | 3300047471 | Bacteria | 1556 |
| 507 | Ga0495593_0000429 | 3300047673 | Bacteria | 23434 |
| 508 | Ga0495593_0004828 | 3300047673 | Bacteria | 7996 |
| 509 | Ga0495593_0087486 | 3300047673 | Bacteria | 1606 |
| 510 | Ga0495602_0000079 | 3300048088 | Bacteria | 94307 |
| 511 | Ga0495602_0037927 | 3300048088 | Bacteria | 4462 |
| 512 | Ga0495602_0047650 | 3300048088 | Bacteria | 3859 |
| 513 | Ga0495602_0103494 | 3300048088 | Bacteria | 2331 |
| 514 | Ga0496100_0015308 | 3300048903 | Bacteria | 4477 |
| 515 | Ga0496101_0010709 | 3300048904 | Bacteria | 6062 |
| 516 | Ga0496101_0043399 | 3300048904 | Bacteria | 3215 |
| 517 | Ga0496101_0079065 | 3300048904 | Bacteria | 2427 |
| 518 | Ga0496102_0003939 | 3300048905 | Bacteria | 12577 |
| 519 | Ga0496102_0006978 | 3300048905 | Bacteria | 9635 |
| 520 | Ga0496102_0041912 | 3300048905 | Bacteria | 4147 |
| 521 | Ga0496102_0054275 | 3300048905 | Bacteria | 3654 |
| 522 | Ga0496103_0029451 | 3300048906 | Bacteria | 3337 |
| 523 | Ga0496103_0037480 | 3300048906 | Bacteria | 2971 |
| 524 | Ga0496104_0001831 | 3300048907 | Bacteria | 18382 |
| 525 | Ga0496104_0007517 | 3300048907 | Bacteria | 9631 |
| 526 | Ga0496105_0001640 | 3300048908 | Bacteria | 15925 |
| 527 | Ga0496105_0012381 | 3300048908 | Bacteria | 6753 |
| 528 | Ga0496105_0016909 | 3300048908 | Bacteria | 5837 |
| 529 | Ga0496106_0006573 | 3300048909 | Bacteria | 8608 |
| 530 | Ga0496106_0024633 | 3300048909 | Bacteria | 4474 |
| 531 | Ga0496106_0164875 | 3300048909 | Bacteria | 1754 |
| 532 | Ga0496107_0012322 | 3300048910 | Bacteria | 5969 |
| 533 | Ga0496107_0058015 | 3300048910 | Bacteria | 2799 |
| 534 | Ga0496108_0002276 | 3300048911 | Bacteria | 15379 |
| 535 | Ga0496108_0013268 | 3300048911 | Bacteria | 6716 |
| 536 | Ga0496108_0017769 | 3300048911 | Bacteria | 5817 |
| 537 | Ga0496108_0114894 | 3300048911 | Bacteria | 2305 |
| 538 | Ga0496109_0026156 | 3300048912 | Bacteria | 5202 |
| 539 | Ga0496109_0052275 | 3300048912 | Bacteria | 3723 |
| 540 | Ga0496109_0107219 | 3300048912 | Bacteria | 2595 |
| 541 | Ga0496109_0324763 | 3300048912 | Bacteria | 1452 |
| 542 | Ga0496110_0033104 | 3300048913 | Bacteria | 4469 |
| 543 | Ga0496111_0002607 | 3300048914 | Bacteria | 10915 |
| 544 | Ga0496111_0032008 | 3300048914 | Bacteria | 3748 |
| 545 | Ga0496111_0032687 | 3300048914 | Bacteria | 3710 |
| 546 | Ga0496111_0060874 | 3300048914 | Bacteria | 2737 |
| 547 | Ga0496112_0004865 | 3300048915 | Bacteria | 11480 |
| 548 | Ga0496112_0012658 | 3300048915 | Bacteria | 7756 |
| 549 | Ga0496112_0048294 | 3300048915 | Bacteria | 4173 |
| 550 | Ga0496112_0090894 | 3300048915 | Bacteria | 3022 |
| 551 | Ga0496112_0166311 | 3300048915 | Bacteria | 2171 |
| 552 | Ga0496112_0362527 | 3300048915 | Bacteria | 1391 |
| 553 | Ga0496113_0016538 | 3300048916 | Bacteria | 5098 |
| 554 | Ga0496113_0021834 | 3300048916 | Bacteria | 4519 |
| 555 | Ga0496113_0087695 | 3300048916 | Bacteria | 2393 |
| 556 | Ga0496113_0261783 | 3300048916 | Bacteria | 1382 |
| 557 | Ga0496114_0006040 | 3300048917 | Bacteria | 9531 |
| 558 | Ga0496114_0060716 | 3300048917 | Bacteria | 3160 |
| 559 | Ga0496114_0113863 | 3300048917 | Bacteria | 2319 |
| 560 | Ga0496125_0032453 | 3300048928 | Bacteria | 4638 |
| 561 | Ga0496126_0048164 | 3300048929 | Bacteria | 3897 |
| 562 | Ga0501031_0084813 | 3300049568 | Bacteria | 2065 |
| 563 | Ga0501032_0028699 | 3300049569 | Bacteria | 3822 |
| 564 | Ga0501034_0008726 | 3300049571 | Bacteria | 10668 |
| 565 | Ga0501034_0012561 | 3300049571 | Bacteria | 8742 |
| 566 | Ga0501034_0232054 | 3300049571 | Bacteria | 1794 |
| 567 | Ga0501036_0014281 | 3300049572 | Bacteria | 6608 |
| 568 | Ga0501037_0014849 | 3300049573 | Bacteria | 5729 |
| 569 | Ga0501037_0024195 | 3300049573 | Bacteria | 4491 |
| 570 | Ga0501037_0109103 | 3300049573 | Bacteria | 1994 |
| 571 | Ga0501038_0002500 | 3300049574 | Bacteria | 17111 |
| 572 | Ga0501042_0013116 | 3300049578 | Bacteria | 5637 |
| 573 | Ga0501042_0094584 | 3300049578 | Bacteria | 2146 |
| 574 | Ga0501042_0130583 | 3300049578 | Bacteria | 1810 |
| 575 | Ga0501043_0000940 | 3300049579 | Bacteria | 25841 |
| 576 | Ga0501043_0005179 | 3300049579 | Bacteria | 10551 |
| 577 | Ga0501047_0000112 | 3300049581 | Bacteria | 98939 |
| 578 | Ga0501047_0003079 | 3300049581 | Bacteria | 15814 |
| 579 | Ga0501047_0013998 | 3300049581 | Bacteria | 7623 |
| 580 | Ga0501047_0142066 | 3300049581 | Bacteria | 2278 |
| 581 | Ga0501047_0162706 | 3300049581 | Bacteria | 2103 |
| 582 | Ga0501048_0000430 | 3300049582 | Bacteria | 29484 |
| 583 | Ga0501048_0005883 | 3300049582 | Bacteria | 9335 |
| 584 | Ga0501048_0136097 | 3300049582 | Bacteria | 1736 |
| 585 | Ga0501067_0017500 | 3300049583 | Bacteria | 3965 |
| 586 | Ga0501067_0021891 | 3300049583 | Bacteria | 3536 |
| 587 | Ga0501067_0031109 | 3300049583 | Bacteria | 2962 |
| 588 | Ga0501069_0000223 | 3300049585 | Bacteria | 25278 |
| 589 | Ga0501070_0001165 | 3300049586 | Bacteria | 23519 |
| 590 | Ga0501070_0001589 | 3300049586 | Bacteria | 20181 |
| 591 | Ga0501070_0003370 | 3300049586 | Bacteria | 13863 |
| 592 | Ga0501070_0004084 | 3300049586 | Bacteria | 12547 |
| 593 | Ga0501070_0160626 | 3300049586 | Bacteria | 1852 |
| 594 | Ga0501071_0006703 | 3300049587 | Bacteria | 7485 |
| 595 | Ga0501072_0004752 | 3300049588 | Bacteria | 10340 |
| 596 | Ga0501073_0003012 | 3300049589 | Bacteria | 12622 |
| 597 | Ga0501073_0015509 | 3300049589 | Bacteria | 5528 |
| 598 | Ga0501073_0035738 | 3300049589 | Bacteria | 3530 |
| 599 | Ga0501074_0002302 | 3300049590 | Bacteria | 13294 |
| 600 | Ga0501074_0014120 | 3300049590 | Bacteria | 5806 |
| 601 | Ga0501074_0016485 | 3300049590 | Bacteria | 5363 |
| 602 | Ga0501074_0033445 | 3300049590 | Bacteria | 3725 |
| 603 | Ga0501076_0088499 | 3300049592 | Bacteria | 2489 |
| 604 | Ga0501079_0000093 | 3300049741 | Bacteria | 43802 |
| 605 | Ga0501080_0000266 | 3300049742 | Bacteria | 39496 |
| 606 | Ga0501080_0002959 | 3300049742 | Bacteria | 14937 |
| 607 | Ga0501080_0003067 | 3300049742 | Bacteria | 14750 |
| 608 | Ga0501080_0016002 | 3300049742 | Bacteria | 6921 |
| 609 | Ga0501080_0016463 | 3300049742 | Bacteria | 6828 |
| 610 | Ga0501080_0159102 | 3300049742 | Bacteria | 2086 |
| 611 | Ga0501083_0012707 | 3300049744 | Bacteria | 5890 |
| 612 | Ga0501035_0004984 | 3300049822 | Bacteria | 12582 |
| 613 | Ga0501035_0054112 | 3300049822 | Bacteria | 3586 |
| 614 | Ga0501044_0006618 | 3300049823 | Bacteria | 12782 |
| 615 | Ga0501044_0010160 | 3300049823 | Bacteria | 10228 |
| 616 | Ga0501044_0028412 | 3300049823 | Bacteria | 5904 |
| 617 | nmdc:mga03n38_19585_c1 | 3300050490 | Bacteria | 2692 |
| 618 | nmdc:mga03n38_252_c1 | 3300050490 | Bacteria | 12593 |
| 619 | nmdc:mga03n38_25558_c1 | 3300050490 | Bacteria | 2427 |
| 620 | nmdc:mga03n38_43231_c1 | 3300050490 | Bacteria | 1974 |
| 621 | nmdc:mga00v17_1493_c1 | 3300050491 | Bacteria | 12233 |
| 622 | nmdc:mga00v17_20713_c1 | 3300050491 | Bacteria | 3771 |
| 623 | nmdc:mga00v17_25570_c1 | 3300050491 | Bacteria | 3432 |
| 624 | nmdc:mga00v17_58198_c1 | 3300050491 | Bacteria | 2367 |
| 625 | nmdc:mga00v17_5845_c1 | 3300050491 | Bacteria | 6496 |
| 626 | nmdc:mga0yw44_14407_c1 | 3300050492 | Bacteria | 4198 |
| 627 | nmdc:mga0yw44_59698_c1 | 3300050492 | Bacteria | 2334 |
| 628 | nmdc:mga06z11_5203_c1 | 3300050494 | Bacteria | 5199 |
| 629 | nmdc:mga07m45_22236_c1 | 3300050496 | Bacteria | 3461 |
| 630 | nmdc:mga07m45_5281_c1 | 3300050496 | Bacteria | 6422 |
| 631 | nmdc:mga05p37_126133_c1 | 3300050507 | Bacteria | 3143 |
| 632 | nmdc:mga05p37_95172_c1 | 3300050507 | Bacteria | 3669 |
| 633 | nmdc:mga06r32_95864_c1 | 3300050510 | Bacteria | 2904 |
| 634 | nmdc:mga08y16_8573_c1 | 3300050511 | Bacteria | 10713 |
| 635 | nmdc:mga0n895_1561_c1 | 3300050512 | Bacteria | 17213 |
| 636 | nmdc:mga0n895_66340_c1 | 3300050512 | Bacteria | 3574 |
| 637 | nmdc:mga0rr50_13786_c1 | 3300050513 | Bacteria | 5277 |
| 638 | nmdc:mga0rr50_2977_c1 | 3300050513 | Bacteria | 9684 |
| 639 | nmdc:mga08x19_10412_c1 | 3300050514 | Bacteria | 5583 |
| 640 | nmdc:mga08x19_116202_c1 | 3300050514 | Bacteria | 1789 |
| 641 | nmdc:mga08x19_41410_c1 | 3300050514 | Bacteria | 2934 |
| 642 | nmdc:mga0a205_1954_c1 | 3300050515 | Bacteria | 17924 |
| 643 | nmdc:mga0a205_270373_c1 | 3300050515 | Bacteria | 1577 |
| 644 | nmdc:mga0sz30_3231_c1 | 3300050516 | Bacteria | 5855 |
| 645 | nmdc:mga0sz30_37830_c1 | 3300050516 | Bacteria | 2021 |
| 646 | nmdc:mga0sz30_650_c1 | 3300050516 | Bacteria | 12878 |
| 647 | Ga0495601_0005038 | 3300053077 | Bacteria | 7668 |
| 648 | Ga0495601_0081330 | 3300053077 | Bacteria | 2079 |
| 649 | Ga0495612_0009349 | 3300053078 | Bacteria | 3979 |
| 650 | Ga0495595_0005893 | 3300053084 | Bacteria | 4967 |
| 651 | Ga0495619_0007719 | 3300053085 | Bacteria | 6810 |
| 652 | Ga0495619_0119477 | 3300053085 | Bacteria | 1806 |
| 653 | Ga0500616_0000466 | 3300053153 | Bacteria | 52609 |
| 654 | Ga0500616_0001931 | 3300053153 | Bacteria | 18503 |
| 655 | Ga0501084_0067010 | 3300054114 | Bacteria | 3005 |
| 656 | Ga0501082_0092234 | 3300060353 | Bacteria | 2616 |
| 657 | 2515852234 | 2515154155 | Bacteria | 7985436 |
| 658 | 2548696254 | 2547132424 | Bacteria | 8348532 |
| 659 | 2552108219 | 2551306166 | Bacteria | 9731570 |
| 660 | 2644082761 | 2643221613 | Bacteria | 4622396 |
| 661 | 2644516047 | 2643221692 | Bacteria | 7282860 |
| 662 | 2644636246 | 2643221715 | Bacteria | 6671032 |
| 663 | 2644665623 | 2643221721 | Bacteria | 4486924 |
| 664 | 2676474610 | 2675903058 | Bacteria | 6822861 |
| 665 | 2676495011 | 2675903060 | Bacteria | 10051191 |
| 666 | 2738693908 | 2738541272 | Bacteria | 6848551 |
| 667 | 2738891355 | 2738541308 | Bacteria | 7020677 |
| 668 | 2739326922 | 2738543027 | Bacteria | 6409078 |
| 669 | 2739362098 | 2738543034 | Bacteria | 6084756 |
| 670 | 2739607283 | 2739367654 | Bacteria | 6049412 |
| 671 | 2753271019 | 2751185782 | Bacteria | 11227053 |
| 672 | 2760304808 | 2758568522 | Bacteria | 5953541 |
| 673 | 2760621369 | 2758568621 | Bacteria | 5967089 |
| 674 | 2809026153 | 2808606394 | Bacteria | 6248540 |
| 675 | 2809194190 | 2808606439 | Bacteria | 5952208 |
| 676 | 2812348939 | 2811994878 | Bacteria | 5992952 |
| 677 | 2827632916 | 2827628540 | Bacteria | 6858585 |
| 678 | 2835191124 | 2835188231 | Bacteria | 3476928 |
| 679 | 2837268955 | 2837268691 | Bacteria | 7850704 |
| 680 | 2839989604 | 2839986021 | Bacteria | 3685650 |
| 681 | 2855388126 | 2855386786 | Bacteria | 4752232 |
| 682 | 2856746186 | 2856741275 | Bacteria | 8096094 |
| 683 | 2857485698 | 2857481737 | Bacteria | 4761446 |
| 684 | 2873314874 | 2873314349 | Bacteria | 8512634 |
| 685 | 2884694347 | 2884693830 | Bacteria | 11273186 |
| 686 | 2891402639 | 2891395885 | Bacteria | 9251614 |
| 687 | 2891554966 | 2891554331 | Bacteria | 8812224 |
| 688 | 2891562732 | 2891562705 | Bacteria | 8039471 |
| 689 | 2895435585 | 2895427314 | Bacteria | 13147766 |
| 690 | 2895444242 | 2895442618 | Bacteria | 11027144 |
| 691 | 2902798015 | 2902792274 | Bacteria | 7270173 |
| 692 | 2929214387 | 2929212328 | Bacteria | 7708288 |
| 693 | 2932400109 | 2932398195 | Bacteria | 3847976 |
| 694 | 2932432115 | 2932431166 | Bacteria | 4215299 |
| 695 | 2935892196 | 2935890801 | Bacteria | 4593001 |
| 696 | 2956941387 | 2956939328 | Bacteria | 3474458 |
| 697 | 3001120184 | 3001119090 | Bacteria | 3449530 |
| 698 | 8055074150 | 8055066027 | Bacteria | 9479577 |
| 699 | 8055175672 | 8055172936 | Bacteria | 9305943 |
| 700 | 8056065975 | 8056060235 | Bacteria | 7259403 |
| 701 | 8056581816 | 8056579771 | Bacteria | 5840325 |
| 702 | Ga0207674_10074365 | |||
| 703 | JGI25406J46586_10008582 | |||
| 704 | JGI25404J52841_10007710 | |||
| 705 | Ga0070658_10000319 | |||
| 706 | Ga0070658_10000776 | |||
| 707 | Ga0070658_10010607 | |||
| 708 | Ga0070658_10027567 | |||
| 709 | Ga0070683_100048881 | |||
| 710 | Ga0070683_100100892 | |||
| 711 | Ga0070690_100040735 | |||
| 712 | Ga0070670_100084364 | |||
| 713 | Ga0068869_100010535 | |||
| 714 | Ga0070680_100000061 | |||
| 715 | Ga0070680_100006109 | |||
| 716 | Ga0070680_100075208 | |||
| 717 | Ga0070682_100005796 | |||
| 718 | Ga0070682_100026958 | |||
| 719 | Ga0068868_100014461 | |||
| 720 | Ga0070660_100103571 | |||
| 721 | Ga0070691_10000321 | |||
| 722 | Ga0070661_100112153 | |||
| 723 | Ga0070692_10003150 | |||
| 724 | Ga0070669_100088389 | |||
| 725 | Ga0070675_100011931 | |||
| 726 | Ga0070671_100000753 | |||
| 727 | Ga0070671_100012429 | |||
| 728 | Ga0070688_100018384 | |||
| 729 | Ga0070659_100022340 | |||
| 730 | Ga0070659_100138193 | |||
| 731 | Ga0070667_100051698 | |||
| 732 | Ga0070709_10001204 | |||
| 733 | Ga0070709_10001732 | |||
| 734 | Ga0070709_10012907 | |||
| 735 | Ga0070714_100000467 | |||
| 736 | Ga0070714_100001268 | |||
| 737 | Ga0070714_100106817 | |||
| 738 | Ga0070714_100113297 | |||
| 739 | Ga0070713_100000369 | |||
| 740 | Ga0070713_100201556 | |||
| 741 | Ga0070710_10000355 | |||
| 742 | Ga0070710_10005713 | |||
| 743 | Ga0070710_10017712 | |||
| 744 | Ga0070710_10064199 | |||
| 745 | Ga0070711_100000365 | |||
| 746 | Ga0070711_100015248 | |||
| 747 | Ga0070705_100084950 | |||
| 748 | Ga0070705_100104706 | |||
| 749 | Ga0070700_100018383 | |||
| 750 | Ga0070663_100001319 | |||
| 751 | Ga0070678_100001410 | |||
| 752 | Ga0070678_100063244 | |||
| 753 | Ga0070681_10001025 | |||
| 754 | Ga0070681_10024594 | |||
| 755 | Ga0070681_10232714 | |||
| 756 | Ga0070685_10024510 | |||
| 757 | Ga0070707_100026292 | |||
| 758 | Ga0070707_100046868 | |||
| 759 | Ga0070707_100126192 | |||
| 760 | Ga0070698_100000073 | |||
| 761 | Ga0070698_100049793 | |||
| 762 | Ga0070698_100059542 | |||
| 763 | Ga0070698_100064635 | |||
| 764 | Ga0070699_100018160 | |||
| 765 | Ga0070679_100001551 | |||
| 766 | Ga0070679_100024000 | |||
| 767 | Ga0070679_100040221 | |||
| 768 | Ga0070679_100113220 | |||
| 769 | Ga0070679_100126330 | |||
| 770 | Ga0070679_100156061 | |||
| 771 | Ga0070684_100021433 | |||
| 772 | Ga0070697_100002048 | |||
| 773 | Ga0070697_100033436 | |||
| 774 | Ga0068853_100166571 | |||
| 775 | Ga0070672_100095979 | |||
| 776 | Ga0070696_100000187 | |||
| 777 | Ga0070693_100001241 | |||
| 778 | Ga0070693_100092344 | |||
| 779 | Ga0070665_100005680 | |||
| 780 | Ga0070665_100050565 | |||
| 781 | Ga0068855_100039253 | |||
| 782 | Ga0068857_100013348 | |||
| 783 | Ga0068854_100071847 | |||
| 784 | Ga0068856_100387371 | |||
| 785 | Ga0070702_100000194 | |||
| 786 | Ga0068852_100082041 | |||
| 787 | Ga0068864_100016036 | |||
| 788 | Ga0068851_10071890 | |||
| 789 | Ga0068870_10000026 | |||
| 790 | Ga0068863_100052669 | |||
| 791 | Ga0068863_100081806 | |||
| 792 | Ga0068858_100013833 | |||
| 793 | Ga0068860_100046432 | |||
| 794 | Ga0081540_1000522 | |||
| 795 | Ga0081540_1001953 | |||
| 796 | Ga0081540_1033080 | |||
| 797 | Ga0081539_10008707 | |||
| 798 | Ga0081539_10015008 | |||
| 799 | Ga0081539_10019912 | |||
| 800 | Ga0081539_10035811 | |||
| 801 | Ga0070717_10001423 | |||
| 802 | Ga0070717_10026289 | |||
| 803 | Ga0070717_10106294 | |||
| 804 | Ga0070717_10191134 | |||
| 805 | Ga0075365_10019544 | |||
| 806 | Ga0075363_100002816 | |||
| 807 | Ga0075363_100002835 | |||
| 808 | Ga0075363_100036911 | |||
| 809 | Ga0075364_10001293 | |||
| 810 | Ga0075364_10003691 | |||
| 811 | Ga0070716_100000220 | |||
| 812 | Ga0070712_100182365 | |||
| 813 | Ga0070712_100220107 | |||
| 814 | Ga0075362_10012217 | |||
| 815 | Ga0075369_10002562 | |||
| 816 | Ga0075369_10019184 | |||
| 817 | Ga0097621_100011771 | |||
| 818 | Ga0075370_10001448 | |||
| 819 | Ga0075370_10050298 | |||
| 820 | Ga0068871_100012333 | |||
| 821 | Ga0075428_100030689 | |||
| 822 | Ga0075428_100211642 | |||
| 823 | Ga0075430_100034036 | |||
| 824 | Ga0075433_10001597 | |||
| 825 | Ga0075434_100006004 | |||
| 826 | Ga0075436_100006291 | |||
| 827 | Ga0075436_100064244 | |||
| 828 | Ga0075435_100010141 | |||
| 829 | Ga0075435_100035958 | |||
| 830 | Ga0099795_10020220 | |||
| 831 | Ga0105251_10017455 | |||
| 832 | Ga0111539_10045581 | |||
| 833 | Ga0114129_10056964 | |||
| 834 | Ga0114129_10367981 | |||
| 835 | Ga0114129_10390766 | |||
| 836 | Ga0114129_10431550 | |||
| 837 | Ga0105241_10021355 | |||
| 838 | Ga0105242_10072318 | |||
| 839 | Ga0105248_10156136 | |||
| 840 | Ga0105237_10037928 | |||
| 841 | Ga0105238_10010962 | |||
| 842 | Ga0105238_10240234 | |||
| 843 | Ga0105249_10005021 | |||
| 844 | Ga0105249_10069927 | |||
| 845 | Ga0105249_10093102 | |||
| 846 | Ga0105239_10062210 | |||
| 847 | Ga0157373_10092702 | |||
| 848 | Ga0157371_10011136 | |||
| 849 | Ga0157371_10109997 | |||
| 850 | Ga0157370_10142065 | |||
| 851 | Ga0157369_10000890 | |||
| 852 | Ga0157369_10038920 | |||
| 853 | Ga0157369_10082310 | |||
| 854 | Ga0157369_10307047 | |||
| 855 | Ga0157374_10060944 | |||
| 856 | Ga0157372_10188381 | |||
| 857 | Ga0157372_10525306 | |||
| 858 | Ga0157375_10143866 | |||
| 859 | Ga0163163_10043199 | |||
| 860 | Ga0163163_10129194 | |||
| 861 | Ga0157380_10001844 | |||
| 862 | Ga0157380_10126490 | |||
| 863 | Ga0157376_10094830 | |||
| 864 | Ga0163161_10042344 | |||
| 865 | Ga0163161_10092813 | |||
| 866 | Ga0197907_10808444 | |||
| 867 | Ga0206351_10007999 | |||
| 868 | Ga0206350_10886524 | |||
| 869 | Ga0206354_10175752 | |||
| 870 | Ga0206353_11934209 | |||
| 871 | Ga0213876_10000793 | |||
| 872 | Ga0213875_10001511 | |||
| 873 | Ga0213875_10010278 | |||
| 874 | Ga0224712_10000868 | |||
| 875 | Ga0224712_10010524 | |||
| 876 | Ga0224712_10046956 | |||
| 877 | Ga0207656_10062823 | |||
| 878 | Ga0207692_10000079 | |||
| 879 | Ga0207692_10002371 | |||
| 880 | Ga0207692_10006984 | |||
| 881 | Ga0207692_10029282 | |||
| 882 | Ga0207692_10073474 | |||
| 883 | Ga0207710_10009415 | |||
| 884 | Ga0207688_10005541 | |||
| 885 | Ga0207647_10042708 | |||
| 886 | Ga0207699_10000297 | |||
| 887 | Ga0207699_10002064 | |||
| 888 | Ga0207699_10008897 | |||
| 889 | Ga0207699_10028695 | |||
| 890 | Ga0207699_10060008 | |||
| 891 | Ga0207643_10000062 | |||
| 892 | Ga0207705_10000676 | |||
| 893 | Ga0207684_10010070 | |||
| 894 | Ga0207684_10051241 | |||
| 895 | Ga0207707_10000277 | |||
| 896 | Ga0207707_10008067 | |||
| 897 | Ga0207707_10009801 | |||
| 898 | Ga0207707_10010633 | |||
| 899 | Ga0207693_10029887 | |||
| 900 | Ga0207663_10004529 | |||
| 901 | Ga0207660_10000115 | |||
| 902 | Ga0207660_10002198 | |||
| 903 | Ga0207657_10013589 | |||
| 904 | Ga0207657_10076976 | |||
| 905 | Ga0207657_10115856 | |||
| 906 | Ga0207657_10165060 | |||
| 907 | Ga0207649_10000906 | |||
| 908 | Ga0207652_10008957 | |||
| 909 | Ga0207652_10010364 | |||
| 910 | Ga0207652_10016837 | |||
| 911 | Ga0207652_10101707 | |||
| 912 | Ga0207652_10135819 | |||
| 913 | Ga0207652_10193250 | |||
| 914 | Ga0207646_10023054 | |||
| 915 | Ga0207646_10055127 | |||
| 916 | Ga0207694_10017076 | |||
| 917 | Ga0207650_10008170 | |||
| 918 | Ga0207659_10001919 | |||
| 919 | Ga0207687_10006354 | |||
| 920 | Ga0207700_10000270 | |||
| 921 | Ga0207700_10003858 | |||
| 922 | Ga0207700_10015247 | |||
| 923 | Ga0207700_10045111 | |||
| 924 | Ga0207700_10062508 | |||
| 925 | Ga0207700_10140263 | |||
| 926 | Ga0207700_10226550 | |||
| 927 | Ga0207664_10000430 | |||
| 928 | Ga0207664_10000729 | |||
| 929 | Ga0207664_10011587 | |||
| 930 | Ga0207664_10016341 | |||
| 931 | Ga0207664_10016390 | |||
| 932 | Ga0207664_10036319 | |||
| 933 | Ga0207664_10083002 | |||
| 934 | Ga0207664_10120614 | |||
| 935 | Ga0207644_10004647 | |||
| 936 | Ga0207644_10008658 | |||
| 937 | Ga0207690_10000171 | |||
| 938 | Ga0207665_10000611 | |||
| 939 | Ga0207665_10001386 | |||
| 940 | Ga0207665_10021920 | |||
| 941 | Ga0207691_10019406 | |||
| 942 | Ga0207691_10090667 | |||
| 943 | Ga0207711_10327572 | |||
| 944 | Ga0207689_10001383 | |||
| 945 | Ga0207661_10013928 | |||
| 946 | Ga0207661_10086006 | |||
| 947 | Ga0207661_10290431 | |||
| 948 | Ga0207679_10000828 | |||
| 949 | Ga0207667_10244285 | |||
| 950 | Ga0207651_10161614 | |||
| 951 | Ga0207712_10043986 | |||
| 952 | Ga0207640_10036130 | |||
| 953 | Ga0207677_10003805 | |||
| 954 | Ga0207678_10000105 | |||
| 955 | Ga0207708_10042151 | |||
| 956 | Ga0207702_10000662 | |||
| 957 | Ga0207702_10006045 | |||
| 958 | Ga0207641_10002000 | |||
| 959 | Ga0207641_10050658 | |||
| 960 | Ga0207676_10000596 | |||
| 961 | Ga0207674_10017071 | |||
| 962 | Ga0207674_10072722 | |||
| 963 | Ga0207675_100054587 | |||
| 964 | Ga0207675_100129117 | |||
| 965 | Ga0207683_10000092 | |||
| 966 | Ga0207683_10026749 | |||
| 967 | Ga0207698_10016868 | |||
| 968 | Ga0207428_10006417 | |||
| 969 | Ga0268266_10003190 | |||
| 970 | Ga0268266_10014301 | |||
| 971 | Ga0268266_10036756 | |||
| 972 | Ga0268266_10214456 | |||
| 973 | Ga0265337_1000389 | |||
| 974 | Ga0265326_10000357 | |||
| 975 | Ga0265319_1000939 | |||
| 976 | Ga0265334_10000792 | |||
| 977 | Ga0265323_10002259 | |||
| 978 | Ga0265322_10020698 | |||
| 979 | Ga0265336_10001444 | |||
| 980 | Ga0265338_10001255 | |||
| 981 | Ga0265324_10000773 | |||
| 982 | Ga0307511_10118667 | |||
| 983 | Ga0316177_1184759 | |||
| 984 | Ga0265332_10001478 | |||
| 985 | Ga0265320_10000980 | |||
| 986 | Ga0265325_10002776 | |||
| 987 | Ga0265340_10001509 | |||
| 988 | Ga0265340_10004198 | |||
| 989 | Ga0265339_10008767 | |||
| 990 | Ga0265339_10012226 | |||
| 991 | Ga0265327_10000021 | |||
| 992 | Ga0265327_10000071 | |||
| 993 | Ga0265327_10030444 | |||
| 994 | Ga0265316_10004740 | |||
| 995 | Ga0307513_10001302 | |||
| 996 | Ga0265313_10010756 | |||
| 997 | Ga0316579_10000030 | |||
| 998 | Ga0265314_10006663 | |||
| 999 | Ga0265314_10007781 | |||
| 1000 | Ga0265342_10001351 | |||
| 1001 | Ga0316576_10081962 | |||
| 1002 | Ga0307405_10022837 | |||
| 1003 | Ga0307405_10101594 | |||
| 1004 | Ga0307405_10149266 | |||
| 1005 | Ga0307410_10026915 | |||
| 1006 | Ga0307406_10179281 | |||
| 1007 | Ga0307409_100022479 | |||
| 1008 | Ga0307409_100029871 | |||
| 1009 | Ga0307409_100129522 | |||
| 1010 | Ga0307409_100273098 | |||
| 1011 | Ga0307409_100337170 | |||
| 1012 | Ga0307416_100155902 | |||
| 1013 | Ga0307414_10080970 | |||
| 1014 | Ga0307414_10298932 | |||
| 1015 | Ga0373926_0009309 | |||
| 1016 | Ga0373934_0000169 | |||
| 1017 | Ga0373934_0003190 | |||
| 1018 | Ga0373934_0022810 | |||
| 1019 | Ga0373923_0018883 | |||
| 1020 | Ga0373923_0052334 | |||
| 1021 | Ga0373936_0011330 | |||
| 1022 | Ga0373941_0015611 | |||
| 1023 | Ga0373945_0005546 | |||
| 1024 | Ga0373945_0023475 | |||
| 1025 | Ga0373953_0000574 | |||
| 1026 | Ga0373953_0010793 | |||
| 1027 | Ga0373954_0000115 | |||
| 1028 | Ga0373954_0020972 | |||
| 1029 | Ga0373954_0081750 | |||
| 1030 | Ga0373956_0000283 | |||
| 1031 | Ga0373957_0000047 | |||
| 1032 | Ga0373957_0000330 | |||
| 1033 | Ga0373957_0008086 | |||
| 1034 | Ga0373957_0016566 | |||
| 1035 | Ga0373943_0001264 | |||
| 1036 | Ga0373955_0000020 | |||
| 1037 | Ga0373955_0023105 | |||
| 1038 | Ga0373924_0053212 | |||
| 1039 | Ga0373935_0001783 | |||
| 1040 | Ga0373935_0002440 | |||
| 1041 | Ga0373935_0003356 | |||
| 1042 | Ga0373935_0125318 | |||
| 1043 | Ga0373927_0002894 | |||
| 1044 | Ga0373933_0000192 | |||
| 1045 | Ga0373933_0004542 | |||
| 1046 | Ga0373933_0009726 | |||
| 1047 | Ga0373933_0013288 | |||
| 1048 | Ga0373933_0067971 | |||
| 1049 | Ga0373947_0000009 | |||
| 1050 | Ga0373947_0023195 | |||
| 1051 | Ga0373937_0000067 | |||
| 1052 | Ga0373937_0048534 | |||
| 1053 | Ga0373937_0099769 | |||
| 1054 | Ga0373937_0155586 | |||
| 1055 | Ga0372808_000433 | |||
| 1056 | Ga0373925_0000006 | |||
| 1057 | Ga0373925_0054670 | |||
| 1058 | Ga0373925_0152704 | |||
| 1059 | Ga0373925_0221428 | |||
| 1060 | Ga0395900_0003901 | |||
| 1061 | Ga0395900_0074645 | |||
| 1062 | Ga0395898_0040878 | |||
| 1063 | Ga0395898_0114918 | |||
| 1064 | Ga0436364_0411147 | |||
| 1065 | Ga0436364_0724530 | |||
| 1066 | Ga0436364_0735260 | |||
| 1067 | Ga0436364_1004318 | |||
| 1068 | Ga0436364_1469180 | |||
| 1069 | Ga0400485_14323 | |||
| 1070 | Ga0400486_16675 | |||
| 1071 | Ga0436365_0567091 | |||
| 1072 | Ga0436363_0152383 | |||
| 1073 | Ga0436363_1296994 | |||
| 1074 | Ga0439442_003290 | |||
| 1075 | Ga0439460_0022389 | |||
| 1076 | Ga0466972_0011562 | |||
| 1077 | Ga0466965_0034461 | |||
| 1078 | Ga0466965_0037007 | |||
| 1079 | Ga0466966_0005406 | |||
| 1080 | Ga0466966_0033562 | |||
| 1081 | Ga0466966_0042033 | |||
| 1082 | Ga0466961_0016926 | |||
| 1083 | Ga0466961_0021195 | |||
| 1084 | Ga0466961_0108726 | |||
| 1085 | Ga0466963_0001501 | |||
| 1086 | Ga0466963_0104802 | |||
| 1087 | Ga0466964_0011072 | |||
| 1088 | Ga0466964_0021022 | |||
| 1089 | Ga0466970_0041705 | |||
| 1090 | Ga0466957_0001084 | |||
| 1091 | Ga0466957_0007517 | |||
| 1092 | Ga0466957_0008284 | |||
| 1093 | Ga0466957_0023207 | |||
| 1094 | Ga0466960_0005774 | |||
| 1095 | Ga0466960_0016391 | |||
| 1096 | Ga0466960_0025185 | |||
| 1097 | Ga0466959_0026506 | |||
| 1098 | Ga0466958_0012247 | |||
| 1099 | Ga0466958_0027717 | |||
| 1100 | Ga0466958_0030764 | |||
| 1101 | Ga0466958_0032180 | |||
| 1102 | Ga0466958_0064424 | |||
| 1103 | Ga0466967_0006860 | |||
| 1104 | Ga0466967_0009250 | |||
| 1105 | Ga0466967_0009645 | |||
| 1106 | Ga0466967_0010064 | |||
| 1107 | Ga0466967_0010481 | |||
| 1108 | Ga0466967_0017591 | |||
| 1109 | Ga0466967_0059894 | |||
| 1110 | Ga0466967_0352801 | |||
| 1111 | Ga0495627_007742 | |||
| 1112 | Ga0495592_0000069 | |||
| 1113 | Ga0495592_0048705 | |||
| 1114 | Ga0495592_0139114 | |||
| 1115 | Ga0495629_0064814 | |||
| 1116 | Ga0495651_0000016 | |||
| 1117 | Ga0495651_0009105 | |||
| 1118 | Ga0495651_0010707 | |||
| 1119 | Ga0495651_0017471 | |||
| 1120 | Ga0495651_0088199 | |||
| 1121 | Ga0495653_0000381 | |||
| 1122 | Ga0495653_0050107 | |||
| 1123 | Ga0495653_0075984 | |||
| 1124 | Ga0495653_0128304 | |||
| 1125 | Ga0495580_0160330 | |||
| 1126 | Ga0495582_0010542 | |||
| 1127 | Ga0495582_0039979 | |||
| 1128 | Ga0495639_0013444 | |||
| 1129 | Ga0495639_0019615 | |||
| 1130 | Ga0495662_0001777 | |||
| 1131 | Ga0495662_0030379 | |||
| 1132 | Ga0495662_0047183 | |||
| 1133 | Ga0495664_0003802 | |||
| 1134 | Ga0495664_0011084 | |||
| 1135 | Ga0495664_0047656 | |||
| 1136 | Ga0495664_0084815 | |||
| 1137 | Ga0495607_0053419 | |||
| 1138 | Ga0495608_0000051 | |||
| 1139 | Ga0495608_0063559 | |||
| 1140 | Ga0495618_0014794 | |||
| 1141 | Ga0495618_0123310 | |||
| 1142 | Ga0495628_0000126 | |||
| 1143 | Ga0495628_0014290 | |||
| 1144 | Ga0495628_0042115 | |||
| 1145 | Ga0495628_0046900 | |||
| 1146 | Ga0495630_0019309 | |||
| 1147 | Ga0495630_0044091 | |||
| 1148 | Ga0495630_0136953 | |||
| 1149 | Ga0495630_0145452 | |||
| 1150 | Ga0495652_0000831 | |||
| 1151 | Ga0495652_0062714 | |||
| 1152 | Ga0495665_0007121 | |||
| 1153 | Ga0495665_0010808 | |||
| 1154 | Ga0495640_0010451 | |||
| 1155 | Ga0495640_0021758 | |||
| 1156 | Ga0495640_0022598 | |||
| 1157 | Ga0495587_0000058 | |||
| 1158 | Ga0495587_0007728 | |||
| 1159 | Ga0495587_0008381 | |||
| 1160 | Ga0495587_0016591 | |||
| 1161 | Ga0495587_0021679 | |||
| 1162 | Ga0495645_0058993 | |||
| 1163 | Ga0495667_0000062 | |||
| 1164 | Ga0495667_0015798 | |||
| 1165 | Ga0495667_0035985 | |||
| 1166 | Ga0495667_0075135 | |||
| 1167 | Ga0495667_0172284 | |||
| 1168 | Ga0495634_0005403 | |||
| 1169 | Ga0495634_0031381 | |||
| 1170 | Ga0495634_0113937 | |||
| 1171 | Ga0495635_0045886 | |||
| 1172 | Ga0495588_0101906 | |||
| 1173 | Ga0495657_0000065 | |||
| 1174 | Ga0495657_0004954 | |||
| 1175 | Ga0495599_0000045 | |||
| 1176 | Ga0495599_0031083 | |||
| 1177 | Ga0495599_0078591 | |||
| 1178 | Ga0495623_0000051 | |||
| 1179 | Ga0495623_0013751 | |||
| 1180 | Ga0495623_0019760 | |||
| 1181 | Ga0495646_0021582 | |||
| 1182 | Ga0495646_0039263 | |||
| 1183 | Ga0495646_0056938 | |||
| 1184 | Ga0495613_0008898 | |||
| 1185 | Ga0495613_0056674 | |||
| 1186 | Ga0495624_0006149 | |||
| 1187 | Ga0495624_0114142 | |||
| 1188 | Ga0495600_0012030 | |||
| 1189 | Ga0495600_0015392 | |||
| 1190 | Ga0495600_0051991 | |||
| 1191 | Ga0495581_0001158 | |||
| 1192 | Ga0495581_0023049 | |||
| 1193 | Ga0495581_0065200 | |||
| 1194 | Ga0495604_0000233 | |||
| 1195 | Ga0495604_0025821 | |||
| 1196 | Ga0495604_0037096 | |||
| 1197 | Ga0495674_0029025 | |||
| 1198 | Ga0495674_0057173 | |||
| 1199 | Ga0495676_0087330 | |||
| 1200 | Ga0495680_0000678 | |||
| 1201 | Ga0495680_0037000 | |||
| 1202 | Ga0495680_0065874 | |||
| 1203 | Ga0495683_0000766 | |||
| 1204 | Ga0495675_0000325 | |||
| 1205 | Ga0495675_0008260 | |||
| 1206 | Ga0495684_0056389 | |||
| 1207 | Ga0495684_0182173 | |||
| 1208 | Ga0495593_0000429 | |||
| 1209 | Ga0495593_0004828 | |||
| 1210 | Ga0495593_0087486 | |||
| 1211 | Ga0495602_0000079 | |||
| 1212 | Ga0495602_0037927 | |||
| 1213 | Ga0495602_0047650 | |||
| 1214 | Ga0495602_0103494 | |||
| 1215 | Ga0496100_0015308 | |||
| 1216 | Ga0496101_0010709 | |||
| 1217 | Ga0496101_0043399 | |||
| 1218 | Ga0496101_0079065 | |||
| 1219 | Ga0496102_0003939 | |||
| 1220 | Ga0496102_0006978 | |||
| 1221 | Ga0496102_0041912 | |||
| 1222 | Ga0496102_0054275 | |||
| 1223 | Ga0496103_0029451 | |||
| 1224 | Ga0496103_0037480 | |||
| 1225 | Ga0496104_0001831 | |||
| 1226 | Ga0496104_0007517 | |||
| 1227 | Ga0496105_0001640 | |||
| 1228 | Ga0496105_0012381 | |||
| 1229 | Ga0496105_0016909 | |||
| 1230 | Ga0496106_0006573 | |||
| 1231 | Ga0496106_0024633 | |||
| 1232 | Ga0496106_0164875 | |||
| 1233 | Ga0496107_0012322 | |||
| 1234 | Ga0496107_0058015 | |||
| 1235 | Ga0496108_0002276 | |||
| 1236 | Ga0496108_0013268 | |||
| 1237 | Ga0496108_0017769 | |||
| 1238 | Ga0496108_0114894 | |||
| 1239 | Ga0496109_0026156 | |||
| 1240 | Ga0496109_0052275 | |||
| 1241 | Ga0496109_0107219 | |||
| 1242 | Ga0496109_0324763 | |||
| 1243 | Ga0496110_0033104 | |||
| 1244 | Ga0496111_0002607 | |||
| 1245 | Ga0496111_0032008 | |||
| 1246 | Ga0496111_0032687 | |||
| 1247 | Ga0496111_0060874 | |||
| 1248 | Ga0496112_0004865 | |||
| 1249 | Ga0496112_0012658 | |||
| 1250 | Ga0496112_0048294 | |||
| 1251 | Ga0496112_0090894 | |||
| 1252 | Ga0496112_0166311 | |||
| 1253 | Ga0496112_0362527 | |||
| 1254 | Ga0496113_0016538 | |||
| 1255 | Ga0496113_0021834 | |||
| 1256 | Ga0496113_0087695 | |||
| 1257 | Ga0496113_0261783 | |||
| 1258 | Ga0496114_0006040 | |||
| 1259 | Ga0496114_0060716 | |||
| 1260 | Ga0496114_0113863 | |||
| 1261 | Ga0496125_0032453 | |||
| 1262 | Ga0496126_0048164 | |||
| 1263 | Ga0501031_0084813 | |||
| 1264 | Ga0501032_0028699 | |||
| 1265 | Ga0501034_0008726 | |||
| 1266 | Ga0501034_0012561 | |||
| 1267 | Ga0501034_0232054 | |||
| 1268 | Ga0501036_0014281 | |||
| 1269 | Ga0501037_0014849 | |||
| 1270 | Ga0501037_0024195 | |||
| 1271 | Ga0501037_0109103 | |||
| 1272 | Ga0501038_0002500 | |||
| 1273 | Ga0501042_0013116 | |||
| 1274 | Ga0501042_0094584 | |||
| 1275 | Ga0501042_0130583 | |||
| 1276 | Ga0501043_0000940 | |||
| 1277 | Ga0501043_0005179 | |||
| 1278 | Ga0501047_0000112 | |||
| 1279 | Ga0501047_0003079 | |||
| 1280 | Ga0501047_0013998 | |||
| 1281 | Ga0501047_0142066 | |||
| 1282 | Ga0501047_0162706 | |||
| 1283 | Ga0501048_0000430 | |||
| 1284 | Ga0501048_0005883 | |||
| 1285 | Ga0501048_0136097 | |||
| 1286 | Ga0501067_0017500 | |||
| 1287 | Ga0501067_0021891 | |||
| 1288 | Ga0501067_0031109 | |||
| 1289 | Ga0501069_0000223 | |||
| 1290 | Ga0501070_0001165 | |||
| 1291 | Ga0501070_0001589 | |||
| 1292 | Ga0501070_0003370 | |||
| 1293 | Ga0501070_0004084 | |||
| 1294 | Ga0501070_0160626 | |||
| 1295 | Ga0501071_0006703 | |||
| 1296 | Ga0501072_0004752 | |||
| 1297 | Ga0501073_0003012 | |||
| 1298 | Ga0501073_0015509 | |||
| 1299 | Ga0501073_0035738 | |||
| 1300 | Ga0501074_0002302 | |||
| 1301 | Ga0501074_0014120 | |||
| 1302 | Ga0501074_0016485 | |||
| 1303 | Ga0501074_0033445 | |||
| 1304 | Ga0501076_0088499 | |||
| 1305 | Ga0501079_0000093 | |||
| 1306 | Ga0501080_0000266 | |||
| 1307 | Ga0501080_0002959 | |||
| 1308 | Ga0501080_0003067 | |||
| 1309 | Ga0501080_0016002 | |||
| 1310 | Ga0501080_0016463 | |||
| 1311 | Ga0501080_0159102 | |||
| 1312 | Ga0501083_0012707 | |||
| 1313 | Ga0501035_0004984 | |||
| 1314 | Ga0501035_0054112 | |||
| 1315 | Ga0501044_0006618 | |||
| 1316 | Ga0501044_0010160 | |||
| 1317 | Ga0501044_0028412 | |||
| 1318 | nmdc:mga03n38_19585_c1 | |||
| 1319 | nmdc:mga03n38_252_c1 | |||
| 1320 | nmdc:mga03n38_25558_c1 | |||
| 1321 | nmdc:mga03n38_43231_c1 | |||
| 1322 | nmdc:mga00v17_1493_c1 | |||
| 1323 | nmdc:mga00v17_20713_c1 | |||
| 1324 | nmdc:mga00v17_25570_c1 | |||
| 1325 | nmdc:mga00v17_58198_c1 | |||
| 1326 | nmdc:mga00v17_5845_c1 | |||
| 1327 | nmdc:mga0yw44_14407_c1 | |||
| 1328 | nmdc:mga0yw44_59698_c1 | |||
| 1329 | nmdc:mga06z11_5203_c1 | |||
| 1330 | nmdc:mga07m45_22236_c1 | |||
| 1331 | nmdc:mga07m45_5281_c1 | |||
| 1332 | nmdc:mga05p37_126133_c1 | |||
| 1333 | nmdc:mga05p37_95172_c1 | |||
| 1334 | nmdc:mga06r32_95864_c1 | |||
| 1335 | nmdc:mga08y16_8573_c1 | |||
| 1336 | nmdc:mga0n895_1561_c1 | |||
| 1337 | nmdc:mga0n895_66340_c1 | |||
| 1338 | nmdc:mga0rr50_13786_c1 | |||
| 1339 | nmdc:mga0rr50_2977_c1 | |||
| 1340 | nmdc:mga08x19_10412_c1 | |||
| 1341 | nmdc:mga08x19_116202_c1 | |||
| 1342 | nmdc:mga08x19_41410_c1 | |||
| 1343 | nmdc:mga0a205_1954_c1 | |||
| 1344 | nmdc:mga0a205_270373_c1 | |||
| 1345 | nmdc:mga0sz30_3231_c1 | |||
| 1346 | nmdc:mga0sz30_37830_c1 | |||
| 1347 | nmdc:mga0sz30_650_c1 | |||
| 1348 | Ga0495601_0005038 | |||
| 1349 | Ga0495601_0081330 | |||
| 1350 | Ga0495612_0009349 | |||
| 1351 | Ga0495595_0005893 | |||
| 1352 | Ga0495619_0007719 | |||
| 1353 | Ga0495619_0119477 | |||
| 1354 | Ga0500616_0000466 | |||
| 1355 | Ga0500616_0001931 | |||
| 1356 | Ga0501084_0067010 | |||
| 1357 | Ga0501082_0092234 | |||
| 1358 | 2515852234 | |||
| 1359 | 2548696254 | |||
| 1360 | 2552108219 | |||
| 1361 | 2644082761 | |||
| 1362 | 2644516047 | |||
| 1363 | 2644636246 | |||
| 1364 | 2644665623 | |||
| 1365 | 2676474610 | |||
| 1366 | 2676495011 | |||
| 1367 | 2738693908 | |||
| 1368 | 2738891355 | |||
| 1369 | 2739326922 | |||
| 1370 | 2739362098 | |||
| 1371 | 2739607283 | |||
| 1372 | 2753271019 | |||
| 1373 | 2760304808 | |||
| 1374 | 2760621369 | |||
| 1375 | 2809026153 | |||
| 1376 | 2809194190 | |||
| 1377 | 2812348939 | |||
| 1378 | 2827632916 | |||
| 1379 | 2835191124 | |||
| 1380 | 2837268955 | |||
| 1381 | 2839989604 | |||
| 1382 | 2855388126 | |||
| 1383 | 2856746186 | |||
| 1384 | 2857485698 | |||
| 1385 | 2873314874 | |||
| 1386 | 2884694347 | |||
| 1387 | 2891402639 | |||
| 1388 | 2891554966 | |||
| 1389 | 2891562732 | |||
| 1390 | 2895435585 | |||
| 1391 | 2895444242 | |||
| 1392 | 2902798015 | |||
| 1393 | 2929214387 | |||
| 1394 | 2932400109 | |||
| 1395 | 2932432115 | |||
| 1396 | 2935892196 | |||
| 1397 | 2956941387 | |||
| 1398 | 3001120184 | |||
| 1399 | 8055074150 | |||
| 1400 | 8055175672 | |||
| 1401 | 8056065975 | |||
| 1402 | 8056581816 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e9i-assembly1.cif.gz_F | mycobacterial respiratory complex i, semi-inserted quinone | 0.9263 | 3 | 428 |
| 8gym-assembly1.cif.gz_v1 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.9146 | 8 | 416 |
| 7p5h-assembly1.cif.gz_b | tmhydabc- d2 map | 0.9107 | 5 | 421 |
| 7ard-assembly1.cif.gz_F | cryo-em structure of polytomella complex-i (complete composition) | 0.9096 | 8 | 416 |
| 6vw7-assembly1.cif.gz_B | formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound | 0.9096 | 5 | 410 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIV7_242_335_3.10.20.600 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 1.003 | 232 | 325 | 3.10.20.600 |
| af_P9WIV7_242_335_3.10.20.600 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.9929 | 232 | 325 | 3.10.20.600 |
| af_P9WIV7_336_431_1.20.1440.230 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain | 0.9726 | 326 | 421 | 1.20.1440.230 |
| af_A1ZAW7_585_680_1.20.1440.230 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain | 0.9662 | 327 | 416 | 1.20.1440.230 |
| af_P9WIV7_336_431_1.20.1440.230 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain | 0.9628 | 326 | 421 | 1.20.1440.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8LPE3-F1-model_v4 | deleted | 0.9879 | 239 | 427 |
|
| AF-A0A7Y4QEK5-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.982 | 248 | 417 |
GO:0008137
GO:0010181 GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A356F953-F1-model_v4 | NADH-ubiquinone oxidoreductase 51kDa subunit iron-sulphur binding domain-containing protein | 0.9782 | 209 | 417 |
GO:0003954
GO:0008137 GO:0010181 GO:0045333 GO:0046872 GO:0051539 |
| AF-A0A7C5WER3-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.9777 | 216 | 422 |
GO:0008137
GO:0010181 GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A7Z9Y2L4-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.9752 | 321 | 414 |
GO:0003954
GO:0008137 GO:0010181 GO:0045333 GO:0046872 GO:0051539 |