F476159

General Info

Members Datasets Scaffolds Average Seq Length
701 367 1402 433

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10074365|Ga0207674_100743653
Length 437
Sequence MEGTRVTDTLTPVLTANWDQPDSFTLAGYSRTGGYEALPRALAMGPDDVIATVKNAVLRGRGGAGFPTGMKWSFIPQNDGKPHYLTVNADESEPGTCKDMPLMMANPHVLIEGIVITCYAIRANHAFIYVRGEVLHVIRRLQYAVAQAYEAGYLGKNILGSGFDLDLVVHAGAGAYICGEETALLTSLEGYRGLPRNRPPFPAVEGLYACPTVINNVESISSVXXIINHGPEWFAGLGTEKSKGFGIFSLSGHVKNPGQYEAPLGITLRELIDLAGGMLRPGHPLKFWTPGGSSTPLLTHEHLDIPLDFEGVGAAGSMLGTRALQIFDDTTCVLRAALRWTEFYQHESCGKCTPCREGTYWLVRAVQRLEDGEGTEEDLETILDVSDNIVGRAFCALGDAAPVPITSAMKYFKDEIILHQKNGGCPFDPAASTAWAV

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
152 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
205 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
324 2547132424 Nocardia nova SH22a Isolate Unclassified
325 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
326 2643221613 Oerskovia sp. Root22 Isolate Unclassified
327 2643221692 Nocardia sp. Root136 Isolate Unclassified
328 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
329 2643221721 Oerskovia sp. Root918 Isolate Unclassified
330 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
331 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
332 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
333 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
334 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
335 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
336 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
337 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
338 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
339 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
340 2808606394 Promicromonospora sp. C35 Isolate Unclassified
341 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
342 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
343 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
344 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
345 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
346 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
347 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
348 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
349 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
350 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
351 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
352 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
353 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
354 2891562705 Microbispora tritici MT50 Isolate Unclassified
355 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
356 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
357 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
358 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
359 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
360 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
361 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
362 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
363 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
364 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
365 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
366 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
367 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.3
Metatranscriptomes 1.28
Isolates 6.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0
Rhizoplane 6.56
Rhizosphere 82.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10074365 3300026116 Bacteria 3410
2 JGI25406J46586_10008582 3300003203 Bacteria 4617
3 JGI25404J52841_10007710 3300003659 Bacteria 2282
4 Ga0070658_10000319 3300005327 Bacteria 41203
5 Ga0070658_10000776 3300005327 Bacteria 27421
6 Ga0070658_10010607 3300005327 Bacteria 7382
7 Ga0070658_10027567 3300005327 Bacteria 4557
8 Ga0070683_100048881 3300005329 Bacteria 3911
9 Ga0070683_100100892 3300005329 Bacteria 2717
10 Ga0070690_100040735 3300005330 Bacteria 2939
11 Ga0070670_100084364 3300005331 Bacteria 2729
12 Ga0068869_100010535 3300005334 Bacteria 6032
13 Ga0070680_100000061 3300005336 Bacteria 56357
14 Ga0070680_100006109 3300005336 Bacteria 9127
15 Ga0070680_100075208 3300005336 Bacteria 2780
16 Ga0070682_100005796 3300005337 Bacteria 6897
17 Ga0070682_100026958 3300005337 Bacteria 3444
18 Ga0068868_100014461 3300005338 Bacteria 5816
19 Ga0070660_100103571 3300005339 Bacteria 2257
20 Ga0070691_10000321 3300005341 Bacteria 17002
21 Ga0070661_100112153 3300005344 Bacteria 2037
22 Ga0070692_10003150 3300005345 Bacteria 6619
23 Ga0070669_100088389 3300005353 Bacteria 2319
24 Ga0070675_100011931 3300005354 Bacteria 6809
25 Ga0070671_100000753 3300005355 Bacteria 23224
26 Ga0070671_100012429 3300005355 Bacteria 6855
27 Ga0070688_100018384 3300005365 Bacteria 4033
28 Ga0070659_100022340 3300005366 Bacteria 4829
29 Ga0070659_100138193 3300005366 Bacteria 1982
30 Ga0070667_100051698 3300005367 Bacteria 3465
31 Ga0070709_10001204 3300005434 Bacteria 14216
32 Ga0070709_10001732 3300005434 Bacteria 11863
33 Ga0070709_10012907 3300005434 Bacteria 4683
34 Ga0070714_100000467 3300005435 Bacteria 29373
35 Ga0070714_100001268 3300005435 Bacteria 18229
36 Ga0070714_100106817 3300005435 Bacteria 2473
37 Ga0070714_100113297 3300005435 Bacteria 2405
38 Ga0070713_100000369 3300005436 Bacteria 28941
39 Ga0070713_100201556 3300005436 Bacteria 1797
40 Ga0070710_10000355 3300005437 Bacteria 21656
41 Ga0070710_10005713 3300005437 Bacteria 5922
42 Ga0070710_10017712 3300005437 Bacteria 3652
43 Ga0070710_10064199 3300005437 Bacteria 2099
44 Ga0070711_100000365 3300005439 Bacteria 23404
45 Ga0070711_100015248 3300005439 Bacteria 4862
46 Ga0070705_100084950 3300005440 Bacteria 1955
47 Ga0070705_100104706 3300005440 Bacteria 1795
48 Ga0070700_100018383 3300005441 Bacteria 4018
49 Ga0070663_100001319 3300005455 Bacteria 13567
50 Ga0070678_100001410 3300005456 Bacteria 12813
51 Ga0070678_100063244 3300005456 Bacteria 2737
52 Ga0070681_10001025 3300005458 Bacteria 23693
53 Ga0070681_10024594 3300005458 Bacteria 6059
54 Ga0070681_10232714 3300005458 Bacteria 1757
55 Ga0070685_10024510 3300005466 Bacteria 3315
56 Ga0070707_100026292 3300005468 Bacteria 5525
57 Ga0070707_100046868 3300005468 Bacteria 4137
58 Ga0070707_100126192 3300005468 Bacteria 2486
59 Ga0070698_100000073 3300005471 Bacteria 75512
60 Ga0070698_100049793 3300005471 Bacteria 4275
61 Ga0070698_100059542 3300005471 Bacteria 3857
62 Ga0070698_100064635 3300005471 Bacteria 3685
63 Ga0070699_100018160 3300005518 Bacteria 6043
64 Ga0070679_100001551 3300005530 Bacteria 20538
65 Ga0070679_100024000 3300005530 Bacteria 5973
66 Ga0070679_100040221 3300005530 Bacteria 4651
67 Ga0070679_100113220 3300005530 Bacteria 2699
68 Ga0070679_100126330 3300005530 Bacteria 2540
69 Ga0070679_100156061 3300005530 Bacteria 2257
70 Ga0070684_100021433 3300005535 Bacteria 5378
71 Ga0070697_100002048 3300005536 Bacteria 15439
72 Ga0070697_100033436 3300005536 Bacteria 4142
73 Ga0068853_100166571 3300005539 Bacteria 1992
74 Ga0070672_100095979 3300005543 Bacteria 2398
75 Ga0070696_100000187 3300005546 Bacteria 36190
76 Ga0070693_100001241 3300005547 Bacteria 11524
77 Ga0070693_100092344 3300005547 Bacteria 1827
78 Ga0070665_100005680 3300005548 Bacteria 12821
79 Ga0070665_100050565 3300005548 Bacteria 4171
80 Ga0068855_100039253 3300005563 Bacteria 5620
81 Ga0068857_100013348 3300005577 Bacteria 7154
82 Ga0068854_100071847 3300005578 Bacteria 2532
83 Ga0068856_100387371 3300005614 Bacteria 1417
84 Ga0070702_100000194 3300005615 Bacteria 19769
85 Ga0068852_100082041 3300005616 Bacteria 2864
86 Ga0068864_100016036 3300005618 Bacteria 6234
87 Ga0068851_10071890 3300005834 Bacteria 1791
88 Ga0068870_10000026 3300005840 Bacteria 46246
89 Ga0068863_100052669 3300005841 Bacteria 3857
90 Ga0068863_100081806 3300005841 Bacteria 3059
91 Ga0068858_100013833 3300005842 Bacteria 7616
92 Ga0068860_100046432 3300005843 Bacteria 4141
93 Ga0081540_1000522 3300005983 Bacteria 37453
94 Ga0081540_1001953 3300005983 Bacteria 17241
95 Ga0081540_1033080 3300005983 Bacteria 2813
96 Ga0081539_10008707 3300005985 Bacteria 8723
97 Ga0081539_10015008 3300005985 Bacteria 5676
98 Ga0081539_10019912 3300005985 Bacteria 4568
99 Ga0081539_10035811 3300005985 Bacteria 2978
100 Ga0070717_10001423 3300006028 Bacteria 16490
101 Ga0070717_10026289 3300006028 Bacteria 4642
102 Ga0070717_10106294 3300006028 Bacteria 2389
103 Ga0070717_10191134 3300006028 Bacteria 1789
104 Ga0075365_10019544 3300006038 Bacteria 4183
105 Ga0075363_100002816 3300006048 Bacteria 7228
106 Ga0075363_100002835 3300006048 Bacteria 7212
107 Ga0075363_100036911 3300006048 Bacteria 2564
108 Ga0075364_10001293 3300006051 Bacteria 13488
109 Ga0075364_10003691 3300006051 Bacteria 8739
110 Ga0070716_100000220 3300006173 Bacteria 22807
111 Ga0070712_100182365 3300006175 Bacteria 1637
112 Ga0070712_100220107 3300006175 Bacteria 1502
113 Ga0075362_10012217 3300006177 Bacteria 3405
114 Ga0075369_10002562 3300006186 Bacteria 6505
115 Ga0075369_10019184 3300006186 Bacteria 2790
116 Ga0097621_100011771 3300006237 Bacteria 6461
117 Ga0075370_10001448 3300006353 Bacteria 10304
118 Ga0075370_10050298 3300006353 Bacteria 2364
119 Ga0068871_100012333 3300006358 Bacteria 6295
120 Ga0075428_100030689 3300006844 Bacteria 5943
121 Ga0075428_100211642 3300006844 Bacteria 2095
122 Ga0075430_100034036 3300006846 Bacteria 4324
123 Ga0075433_10001597 3300006852 Bacteria 16787
124 Ga0075434_100006004 3300006871 Bacteria 11113
125 Ga0075436_100006291 3300006914 Bacteria 8133
126 Ga0075436_100064244 3300006914 Bacteria 2537
127 Ga0075435_100010141 3300007076 Bacteria 6880
128 Ga0075435_100035958 3300007076 Bacteria 3933
129 Ga0099795_10020220 3300007788 Bacteria 2165
130 Ga0105251_10017455 3300009011 Bacteria 3845
131 Ga0111539_10045581 3300009094 Bacteria 5248
132 Ga0114129_10056964 3300009147 Bacteria 5471
133 Ga0114129_10367981 3300009147 Bacteria 1901
134 Ga0114129_10390766 3300009147 Bacteria 1835
135 Ga0114129_10431550 3300009147 Bacteria 1731
136 Ga0105241_10021355 3300009174 Bacteria 4786
137 Ga0105242_10072318 3300009176 Bacteria 2864
138 Ga0105248_10156136 3300009177 Bacteria 2575
139 Ga0105237_10037928 3300009545 Bacteria 4868
140 Ga0105238_10010962 3300009551 Bacteria 9115
141 Ga0105238_10240234 3300009551 Bacteria 1789
142 Ga0105249_10005021 3300009553 Bacteria 11409
143 Ga0105249_10069927 3300009553 Bacteria 3240
144 Ga0105249_10093102 3300009553 Bacteria 2822
145 Ga0105239_10062210 3300010375 Bacteria 4097
146 Ga0157373_10092702 3300013100 Bacteria 2127
147 Ga0157371_10011136 3300013102 Bacteria 6960
148 Ga0157371_10109997 3300013102 Bacteria 1956
149 Ga0157370_10142065 3300013104 Bacteria 2237
150 Ga0157369_10000890 3300013105 Bacteria 38122
151 Ga0157369_10038920 3300013105 Bacteria 5198
152 Ga0157369_10082310 3300013105 Bacteria 3444
153 Ga0157369_10307047 3300013105 Bacteria 1650
154 Ga0157374_10060944 3300013296 Bacteria 3532
155 Ga0157372_10188381 3300013307 Bacteria 2389
156 Ga0157372_10525306 3300013307 Bacteria 1380
157 Ga0157375_10143866 3300013308 Bacteria 2514
158 Ga0163163_10043199 3300014325 Bacteria 4418
159 Ga0163163_10129194 3300014325 Bacteria 2566
160 Ga0157380_10001844 3300014326 Bacteria 14014
161 Ga0157380_10126490 3300014326 Bacteria 2173
162 Ga0157376_10094830 3300014969 Bacteria 2594
163 Ga0163161_10042344 3300017792 Bacteria 3275
164 Ga0163161_10092813 3300017792 Bacteria 2236
165 Ga0197907_10808444 3300020069 Bacteria 2951
166 Ga0206351_10007999 3300020077 Bacteria 2232
167 Ga0206350_10886524 3300020080 Bacteria 1702
168 Ga0206354_10175752 3300020081 Bacteria 3815
169 Ga0206353_11934209 3300020082 Bacteria 4499
170 Ga0213876_10000793 3300021384 Bacteria 21431
171 Ga0213875_10001511 3300021388 Bacteria 14975
172 Ga0213875_10010278 3300021388 Bacteria 4690
173 Ga0224712_10000868 3300022467 Bacteria 6453
174 Ga0224712_10010524 3300022467 Bacteria 2833
175 Ga0224712_10046956 3300022467 Bacteria 1660
176 Ga0207656_10062823 3300025321 Bacteria 1633
177 Ga0207692_10000079 3300025898 Bacteria 27914
178 Ga0207692_10002371 3300025898 Bacteria 7229
179 Ga0207692_10006984 3300025898 Bacteria 4607
180 Ga0207692_10029282 3300025898 Bacteria 2615
181 Ga0207692_10073474 3300025898 Bacteria 1809
182 Ga0207710_10009415 3300025900 Bacteria 4111
183 Ga0207688_10005541 3300025901 Bacteria 6866
184 Ga0207647_10042708 3300025904 Bacteria 2842
185 Ga0207699_10000297 3300025906 Bacteria 26655
186 Ga0207699_10002064 3300025906 Bacteria 9489
187 Ga0207699_10008897 3300025906 Bacteria 4977
188 Ga0207699_10028695 3300025906 Bacteria 3095
189 Ga0207699_10060008 3300025906 Bacteria 2282
190 Ga0207643_10000062 3300025908 Bacteria 71074
191 Ga0207705_10000676 3300025909 Bacteria 28263
192 Ga0207684_10010070 3300025910 Bacteria 8326
193 Ga0207684_10051241 3300025910 Bacteria 3502
194 Ga0207707_10000277 3300025912 Bacteria 55264
195 Ga0207707_10008067 3300025912 Bacteria 9144
196 Ga0207707_10009801 3300025912 Bacteria 8308
197 Ga0207707_10010633 3300025912 Bacteria 7993
198 Ga0207693_10029887 3300025915 Bacteria 4300
199 Ga0207663_10004529 3300025916 Bacteria 6920
200 Ga0207660_10000115 3300025917 Bacteria 46447
201 Ga0207660_10002198 3300025917 Bacteria 12907
202 Ga0207657_10013589 3300025919 Bacteria 7985
203 Ga0207657_10076976 3300025919 Bacteria 2813
204 Ga0207657_10115856 3300025919 Bacteria 2208
205 Ga0207657_10165060 3300025919 Bacteria 1797
206 Ga0207649_10000906 3300025920 Bacteria 18685
207 Ga0207652_10008957 3300025921 Bacteria 8066
208 Ga0207652_10010364 3300025921 Bacteria 7504
209 Ga0207652_10016837 3300025921 Bacteria 5974
210 Ga0207652_10101707 3300025921 Bacteria 2539
211 Ga0207652_10135819 3300025921 Bacteria 2196
212 Ga0207652_10193250 3300025921 Bacteria 1830
213 Ga0207646_10023054 3300025922 Bacteria 5723
214 Ga0207646_10055127 3300025922 Bacteria 3555
215 Ga0207694_10017076 3300025924 Bacteria 5482
216 Ga0207650_10008170 3300025925 Bacteria 7136
217 Ga0207659_10001919 3300025926 Bacteria 12327
218 Ga0207687_10006354 3300025927 Bacteria 7809
219 Ga0207700_10000270 3300025928 Bacteria 30934
220 Ga0207700_10003858 3300025928 Bacteria 8757
221 Ga0207700_10015247 3300025928 Bacteria 5060
222 Ga0207700_10045111 3300025928 Bacteria 3250
223 Ga0207700_10062508 3300025928 Bacteria 2829
224 Ga0207700_10140263 3300025928 Bacteria 1985
225 Ga0207700_10226550 3300025928 Bacteria 1587
226 Ga0207664_10000430 3300025929 Bacteria 29958
227 Ga0207664_10000729 3300025929 Bacteria 22368
228 Ga0207664_10011587 3300025929 Bacteria 6277
229 Ga0207664_10016341 3300025929 Bacteria 5413
230 Ga0207664_10016390 3300025929 Bacteria 5406
231 Ga0207664_10036319 3300025929 Bacteria 3808
232 Ga0207664_10083002 3300025929 Bacteria 2611
233 Ga0207664_10120614 3300025929 Bacteria 2194
234 Ga0207644_10004647 3300025931 Bacteria 8925
235 Ga0207644_10008658 3300025931 Bacteria 6656
236 Ga0207690_10000171 3300025932 Bacteria 50511
237 Ga0207665_10000611 3300025939 Bacteria 24040
238 Ga0207665_10001386 3300025939 Bacteria 16319
239 Ga0207665_10021920 3300025939 Bacteria 4201
240 Ga0207691_10019406 3300025940 Bacteria 6434
241 Ga0207691_10090667 3300025940 Bacteria 2740
242 Ga0207711_10327572 3300025941 Bacteria 1416
243 Ga0207689_10001383 3300025942 Bacteria 23240
244 Ga0207661_10013928 3300025944 Bacteria 5878
245 Ga0207661_10086006 3300025944 Bacteria 2608
246 Ga0207661_10290431 3300025944 Bacteria 1463
247 Ga0207679_10000828 3300025945 Bacteria 19903
248 Ga0207667_10244285 3300025949 Bacteria 1837
249 Ga0207651_10161614 3300025960 Bacteria 1756
250 Ga0207712_10043986 3300025961 Bacteria 3084
251 Ga0207640_10036130 3300025981 Bacteria 3099
252 Ga0207677_10003805 3300026023 Bacteria 8017
253 Ga0207678_10000105 3300026067 Bacteria 68804
254 Ga0207708_10042151 3300026075 Bacteria 3480
255 Ga0207702_10000662 3300026078 Bacteria 37468
256 Ga0207702_10006045 3300026078 Bacteria 10503
257 Ga0207641_10002000 3300026088 Bacteria 19446
258 Ga0207641_10050658 3300026088 Bacteria 3513
259 Ga0207676_10000596 3300026095 Bacteria 29670
260 Ga0207674_10017071 3300026116 Bacteria 7922
261 Ga0207674_10072722 3300026116 Bacteria 3453
262 Ga0207675_100054587 3300026118 Bacteria 3728
263 Ga0207675_100129117 3300026118 Bacteria 2396
264 Ga0207683_10000092 3300026121 Bacteria 72389
265 Ga0207683_10026749 3300026121 Bacteria 4982
266 Ga0207698_10016868 3300026142 Bacteria 4937
267 Ga0207428_10006417 3300027907 Bacteria 10862
268 Ga0268266_10003190 3300028379 Bacteria 16606
269 Ga0268266_10014301 3300028379 Bacteria 6825
270 Ga0268266_10036756 3300028379 Bacteria 4171
271 Ga0268266_10214456 3300028379 Bacteria 1767
272 Ga0265337_1000389 3300028556 Bacteria 23661
273 Ga0265326_10000357 3300028558 Bacteria 19299
274 Ga0265319_1000939 3300028563 Bacteria 18253
275 Ga0265334_10000792 3300028573 Bacteria 15812
276 Ga0265323_10002259 3300028653 Bacteria 8950
277 Ga0265322_10020698 3300028654 Bacteria 1884
278 Ga0265336_10001444 3300028666 Bacteria 10832
279 Ga0265338_10001255 3300028800 Bacteria 41829
280 Ga0265324_10000773 3300029957 Bacteria 21095
281 Ga0307511_10118667 3300030521 Bacteria 1647
282 Ga0316177_1184759 3300030731 Bacteria 2315
283 Ga0265332_10001478 3300031238 Bacteria 13116
284 Ga0265320_10000980 3300031240 Bacteria 21245
285 Ga0265325_10002776 3300031241 Bacteria 11694
286 Ga0265340_10001509 3300031247 Bacteria 13356
287 Ga0265340_10004198 3300031247 Bacteria 8082
288 Ga0265339_10008767 3300031249 Bacteria 6409
289 Ga0265339_10012226 3300031249 Bacteria 5249
290 Ga0265327_10000021 3300031251 Bacteria 417788
291 Ga0265327_10000071 3300031251 Bacteria 215502
292 Ga0265327_10030444 3300031251 Bacteria 3052
293 Ga0265316_10004740 3300031344 Bacteria 13456
294 Ga0307513_10001302 3300031456 Bacteria 36100
295 Ga0265313_10010756 3300031595 Bacteria 5751
296 Ga0316579_10000030 3300031691 Bacteria 32158
297 Ga0265314_10006663 3300031711 Bacteria 10148
298 Ga0265314_10007781 3300031711 Bacteria 9260
299 Ga0265342_10001351 3300031712 Bacteria 22957
300 Ga0316576_10081962 3300031727 Bacteria 2394
301 Ga0307405_10022837 3300031731 Bacteria 3544
302 Ga0307405_10101594 3300031731 Bacteria 1930
303 Ga0307405_10149266 3300031731 Bacteria 1641
304 Ga0307410_10026915 3300031852 Bacteria 3627
305 Ga0307406_10179281 3300031901 Bacteria 1541
306 Ga0307409_100022479 3300031995 Bacteria 4350
307 Ga0307409_100029871 3300031995 Bacteria 3907
308 Ga0307409_100129522 3300031995 Bacteria 2153
309 Ga0307409_100273098 3300031995 Bacteria 1558
310 Ga0307409_100337170 3300031995 Bacteria 1417
311 Ga0307416_100155902 3300032002 Bacteria 2102
312 Ga0307414_10080970 3300032004 Bacteria 2376
313 Ga0307414_10298932 3300032004 Bacteria 1361
314 Ga0373926_0009309 3300035083 Bacteria 3280
315 Ga0373934_0000169 3300035086 Bacteria 23878
316 Ga0373934_0003190 3300035086 Bacteria 5994
317 Ga0373934_0022810 3300035086 Bacteria 2415
318 Ga0373923_0018883 3300035111 Bacteria 2661
319 Ga0373923_0052334 3300035111 Bacteria 1715
320 Ga0373936_0011330 3300035113 Bacteria 3375
321 Ga0373941_0015611 3300035115 Bacteria 2052
322 Ga0373945_0005546 3300035116 Bacteria 4043
323 Ga0373945_0023475 3300035116 Bacteria 2131
324 Ga0373953_0000574 3300035117 Bacteria 10228
325 Ga0373953_0010793 3300035117 Bacteria 3189
326 Ga0373954_0000115 3300035118 Bacteria 27323
327 Ga0373954_0020972 3300035118 Bacteria 2957
328 Ga0373954_0081750 3300035118 Bacteria 1544
329 Ga0373956_0000283 3300035119 Bacteria 20458
330 Ga0373957_0000047 3300035120 Bacteria 31450
331 Ga0373957_0000330 3300035120 Bacteria 11918
332 Ga0373957_0008086 3300035120 Bacteria 3394
333 Ga0373957_0016566 3300035120 Bacteria 2552
334 Ga0373943_0001264 3300035170 Bacteria 11318
335 Ga0373955_0000020 3300035172 Bacteria 63100
336 Ga0373955_0023105 3300035172 Bacteria 3163
337 Ga0373924_0053212 3300035410 Bacteria 1681
338 Ga0373935_0001783 3300035692 Bacteria 12111
339 Ga0373935_0002440 3300035692 Bacteria 10639
340 Ga0373935_0003356 3300035692 Bacteria 9277
341 Ga0373935_0125318 3300035692 Bacteria 1720
342 Ga0373927_0002894 3300035695 Bacteria 12485
343 Ga0373933_0000192 3300035724 Bacteria 40573
344 Ga0373933_0004542 3300035724 Bacteria 7612
345 Ga0373933_0009726 3300035724 Bacteria 5261
346 Ga0373933_0013288 3300035724 Bacteria 4561
347 Ga0373933_0067971 3300035724 Bacteria 2163
348 Ga0373947_0000009 3300035725 Bacteria 172751
349 Ga0373947_0023195 3300035725 Bacteria 3608
350 Ga0373937_0000067 3300036401 Bacteria 94291
351 Ga0373937_0048534 3300036401 Bacteria 3886
352 Ga0373937_0099769 3300036401 Bacteria 2693
353 Ga0373937_0155586 3300036401 Bacteria 2142
354 Ga0372808_000433 3300036459 Bacteria 3250
355 Ga0373925_0000006 3300037068 Bacteria 278942
356 Ga0373925_0054670 3300037068 Bacteria 2986
357 Ga0373925_0152704 3300037068 Bacteria 1814
358 Ga0373925_0221428 3300037068 Bacteria 1510
359 Ga0395900_0003901 3300037418 Bacteria 15934
360 Ga0395900_0074645 3300037418 Bacteria 3486
361 Ga0395898_0040878 3300037466 Bacteria 4583
362 Ga0395898_0114918 3300037466 Bacteria 2579
363 Ga0436364_0411147 3300037853 Bacteria 1824
364 Ga0436364_0724530 3300037853 Bacteria 21942
365 Ga0436364_0735260 3300037853 Bacteria 16919
366 Ga0436364_1004318 3300037853 Bacteria 7937
367 Ga0436364_1469180 3300037853 Bacteria 1974
368 Ga0400485_14323 3300038735 Bacteria 58881
369 Ga0400486_16675 3300038742 Bacteria 25458
370 Ga0436365_0567091 3300039437 Bacteria 46375
371 Ga0436363_0152383 3300039450 Bacteria 2983
372 Ga0436363_1296994 3300039450 Bacteria 1566
373 Ga0439442_003290 3300042002 Bacteria 3194
374 Ga0439460_0022389 3300042461 Bacteria 1733
375 Ga0466972_0011562 3300044658 Bacteria 4432
376 Ga0466965_0034461 3300044683 Bacteria 2477
377 Ga0466965_0037007 3300044683 Bacteria 2396
378 Ga0466966_0005406 3300044684 Bacteria 8394
379 Ga0466966_0033562 3300044684 Bacteria 3323
380 Ga0466966_0042033 3300044684 Bacteria 2936
381 Ga0466961_0016926 3300044693 Bacteria 4685
382 Ga0466961_0021195 3300044693 Bacteria 4183
383 Ga0466961_0108726 3300044693 Bacteria 1745
384 Ga0466963_0001501 3300044694 Bacteria 12624
385 Ga0466963_0104802 3300044694 Bacteria 1938
386 Ga0466964_0011072 3300044706 Bacteria 3408
387 Ga0466964_0021022 3300044706 Bacteria 2520
388 Ga0466970_0041705 3300044765 Bacteria 2439
389 Ga0466957_0001084 3300044842 Bacteria 14046
390 Ga0466957_0007517 3300044842 Bacteria 6157
391 Ga0466957_0008284 3300044842 Bacteria 5910
392 Ga0466957_0023207 3300044842 Bacteria 3666
393 Ga0466960_0005774 3300044901 Bacteria 4926
394 Ga0466960_0016391 3300044901 Bacteria 3213
395 Ga0466960_0025185 3300044901 Bacteria 2690
396 Ga0466959_0026506 3300045049 Bacteria 4296
397 Ga0466958_0012247 3300045836 Bacteria 4855
398 Ga0466958_0027717 3300045836 Bacteria 3353
399 Ga0466958_0030764 3300045836 Bacteria 3190
400 Ga0466958_0032180 3300045836 Bacteria 3119
401 Ga0466958_0064424 3300045836 Bacteria 2235
402 Ga0466967_0006860 3300045976 Bacteria 8128
403 Ga0466967_0009250 3300045976 Bacteria 7297
404 Ga0466967_0009645 3300045976 Bacteria 7179
405 Ga0466967_0010064 3300045976 Bacteria 7067
406 Ga0466967_0010481 3300045976 Bacteria 6957
407 Ga0466967_0017591 3300045976 Bacteria 5682
408 Ga0466967_0059894 3300045976 Bacteria 3372
409 Ga0466967_0352801 3300045976 Bacteria 1424
410 Ga0495627_007742 3300046453 Bacteria 4094
411 Ga0495592_0000069 3300046454 Bacteria 94288
412 Ga0495592_0048705 3300046454 Bacteria 3151
413 Ga0495592_0139114 3300046454 Bacteria 1690
414 Ga0495629_0064814 3300046459 Bacteria 2550
415 Ga0495651_0000016 3300046462 Bacteria 125612
416 Ga0495651_0009105 3300046462 Bacteria 7620
417 Ga0495651_0010707 3300046462 Bacteria 7053
418 Ga0495651_0017471 3300046462 Bacteria 5555
419 Ga0495651_0088199 3300046462 Bacteria 2331
420 Ga0495653_0000381 3300046463 Bacteria 35673
421 Ga0495653_0050107 3300046463 Bacteria 3212
422 Ga0495653_0075984 3300046463 Bacteria 2498
423 Ga0495653_0128304 3300046463 Bacteria 1798
424 Ga0495580_0160330 3300046472 Bacteria 1557
425 Ga0495582_0010542 3300046473 Bacteria 5084
426 Ga0495582_0039979 3300046473 Bacteria 2582
427 Ga0495639_0013444 3300046475 Bacteria 3535
428 Ga0495639_0019615 3300046475 Bacteria 2952
429 Ga0495662_0001777 3300046476 Bacteria 10788
430 Ga0495662_0030379 3300046476 Bacteria 2608
431 Ga0495662_0047183 3300046476 Bacteria 2080
432 Ga0495664_0003802 3300046477 Bacteria 8236
433 Ga0495664_0011084 3300046477 Bacteria 5071
434 Ga0495664_0047656 3300046477 Bacteria 2543
435 Ga0495664_0084815 3300046477 Bacteria 1901
436 Ga0495607_0053419 3300046501 Bacteria 2335
437 Ga0495608_0000051 3300046511 Bacteria 94719
438 Ga0495608_0063559 3300046511 Bacteria 2421
439 Ga0495618_0014794 3300046514 Bacteria 4759
440 Ga0495618_0123310 3300046514 Bacteria 1659
441 Ga0495628_0000126 3300046516 Bacteria 63839
442 Ga0495628_0014290 3300046516 Bacteria 6660
443 Ga0495628_0042115 3300046516 Bacteria 3643
444 Ga0495628_0046900 3300046516 Bacteria 3430
445 Ga0495630_0019309 3300046517 Bacteria 5009
446 Ga0495630_0044091 3300046517 Bacteria 3333
447 Ga0495630_0136953 3300046517 Bacteria 1860
448 Ga0495630_0145452 3300046517 Bacteria 1802
449 Ga0495652_0000831 3300046529 Bacteria 35576
450 Ga0495652_0062714 3300046529 Bacteria 3133
451 Ga0495665_0007121 3300046531 Bacteria 6036
452 Ga0495665_0010808 3300046531 Bacteria 4941
453 Ga0495640_0010451 3300046533 Bacteria 7169
454 Ga0495640_0021758 3300046533 Bacteria 4698
455 Ga0495640_0022598 3300046533 Bacteria 4593
456 Ga0495587_0000058 3300046536 Bacteria 94307
457 Ga0495587_0007728 3300046536 Bacteria 6952
458 Ga0495587_0008381 3300046536 Bacteria 6651
459 Ga0495587_0016591 3300046536 Bacteria 4582
460 Ga0495587_0021679 3300046536 Bacteria 3963
461 Ga0495645_0058993 3300046543 Bacteria 2783
462 Ga0495667_0000062 3300046559 Bacteria 94307
463 Ga0495667_0015798 3300046559 Bacteria 5104
464 Ga0495667_0035985 3300046559 Bacteria 3306
465 Ga0495667_0075135 3300046559 Bacteria 2199
466 Ga0495667_0172284 3300046559 Bacteria 1390
467 Ga0495634_0005403 3300046642 Bacteria 9842
468 Ga0495634_0031381 3300046642 Bacteria 3660
469 Ga0495634_0113937 3300046642 Bacteria 1736
470 Ga0495635_0045886 3300046663 Bacteria 3014
471 Ga0495588_0101906 3300046674 Bacteria 1509
472 Ga0495657_0000065 3300046675 Bacteria 94307
473 Ga0495657_0004954 3300046675 Bacteria 10586
474 Ga0495599_0000045 3300046678 Bacteria 86086
475 Ga0495599_0031083 3300046678 Bacteria 3351
476 Ga0495599_0078591 3300046678 Bacteria 2060
477 Ga0495623_0000051 3300046679 Bacteria 72814
478 Ga0495623_0013751 3300046679 Bacteria 5246
479 Ga0495623_0019760 3300046679 Bacteria 4355
480 Ga0495646_0021582 3300046680 Bacteria 4067
481 Ga0495646_0039263 3300046680 Bacteria 2919
482 Ga0495646_0056938 3300046680 Bacteria 2342
483 Ga0495613_0008898 3300046689 Bacteria 7449
484 Ga0495613_0056674 3300046689 Bacteria 2877
485 Ga0495624_0006149 3300046690 Bacteria 8549
486 Ga0495624_0114142 3300046690 Bacteria 1660
487 Ga0495600_0012030 3300046809 Bacteria 5404
488 Ga0495600_0015392 3300046809 Bacteria 4835
489 Ga0495600_0051991 3300046809 Bacteria 2674
490 Ga0495581_0001158 3300047315 Bacteria 14442
491 Ga0495581_0023049 3300047315 Bacteria 3608
492 Ga0495581_0065200 3300047315 Bacteria 2105
493 Ga0495604_0000233 3300047317 Bacteria 49951
494 Ga0495604_0025821 3300047317 Bacteria 4678
495 Ga0495604_0037096 3300047317 Bacteria 3840
496 Ga0495674_0029025 3300047319 Bacteria 5039
497 Ga0495674_0057173 3300047319 Bacteria 3414
498 Ga0495676_0087330 3300047321 Bacteria 2344
499 Ga0495680_0000678 3300047322 Bacteria 38049
500 Ga0495680_0037000 3300047322 Bacteria 3911
501 Ga0495680_0065874 3300047322 Bacteria 2773
502 Ga0495683_0000766 3300047323 Bacteria 23099
503 Ga0495675_0000325 3300047444 Bacteria 33817
504 Ga0495675_0008260 3300047444 Bacteria 6441
505 Ga0495684_0056389 3300047471 Bacteria 2995
506 Ga0495684_0182173 3300047471 Bacteria 1556
507 Ga0495593_0000429 3300047673 Bacteria 23434
508 Ga0495593_0004828 3300047673 Bacteria 7996
509 Ga0495593_0087486 3300047673 Bacteria 1606
510 Ga0495602_0000079 3300048088 Bacteria 94307
511 Ga0495602_0037927 3300048088 Bacteria 4462
512 Ga0495602_0047650 3300048088 Bacteria 3859
513 Ga0495602_0103494 3300048088 Bacteria 2331
514 Ga0496100_0015308 3300048903 Bacteria 4477
515 Ga0496101_0010709 3300048904 Bacteria 6062
516 Ga0496101_0043399 3300048904 Bacteria 3215
517 Ga0496101_0079065 3300048904 Bacteria 2427
518 Ga0496102_0003939 3300048905 Bacteria 12577
519 Ga0496102_0006978 3300048905 Bacteria 9635
520 Ga0496102_0041912 3300048905 Bacteria 4147
521 Ga0496102_0054275 3300048905 Bacteria 3654
522 Ga0496103_0029451 3300048906 Bacteria 3337
523 Ga0496103_0037480 3300048906 Bacteria 2971
524 Ga0496104_0001831 3300048907 Bacteria 18382
525 Ga0496104_0007517 3300048907 Bacteria 9631
526 Ga0496105_0001640 3300048908 Bacteria 15925
527 Ga0496105_0012381 3300048908 Bacteria 6753
528 Ga0496105_0016909 3300048908 Bacteria 5837
529 Ga0496106_0006573 3300048909 Bacteria 8608
530 Ga0496106_0024633 3300048909 Bacteria 4474
531 Ga0496106_0164875 3300048909 Bacteria 1754
532 Ga0496107_0012322 3300048910 Bacteria 5969
533 Ga0496107_0058015 3300048910 Bacteria 2799
534 Ga0496108_0002276 3300048911 Bacteria 15379
535 Ga0496108_0013268 3300048911 Bacteria 6716
536 Ga0496108_0017769 3300048911 Bacteria 5817
537 Ga0496108_0114894 3300048911 Bacteria 2305
538 Ga0496109_0026156 3300048912 Bacteria 5202
539 Ga0496109_0052275 3300048912 Bacteria 3723
540 Ga0496109_0107219 3300048912 Bacteria 2595
541 Ga0496109_0324763 3300048912 Bacteria 1452
542 Ga0496110_0033104 3300048913 Bacteria 4469
543 Ga0496111_0002607 3300048914 Bacteria 10915
544 Ga0496111_0032008 3300048914 Bacteria 3748
545 Ga0496111_0032687 3300048914 Bacteria 3710
546 Ga0496111_0060874 3300048914 Bacteria 2737
547 Ga0496112_0004865 3300048915 Bacteria 11480
548 Ga0496112_0012658 3300048915 Bacteria 7756
549 Ga0496112_0048294 3300048915 Bacteria 4173
550 Ga0496112_0090894 3300048915 Bacteria 3022
551 Ga0496112_0166311 3300048915 Bacteria 2171
552 Ga0496112_0362527 3300048915 Bacteria 1391
553 Ga0496113_0016538 3300048916 Bacteria 5098
554 Ga0496113_0021834 3300048916 Bacteria 4519
555 Ga0496113_0087695 3300048916 Bacteria 2393
556 Ga0496113_0261783 3300048916 Bacteria 1382
557 Ga0496114_0006040 3300048917 Bacteria 9531
558 Ga0496114_0060716 3300048917 Bacteria 3160
559 Ga0496114_0113863 3300048917 Bacteria 2319
560 Ga0496125_0032453 3300048928 Bacteria 4638
561 Ga0496126_0048164 3300048929 Bacteria 3897
562 Ga0501031_0084813 3300049568 Bacteria 2065
563 Ga0501032_0028699 3300049569 Bacteria 3822
564 Ga0501034_0008726 3300049571 Bacteria 10668
565 Ga0501034_0012561 3300049571 Bacteria 8742
566 Ga0501034_0232054 3300049571 Bacteria 1794
567 Ga0501036_0014281 3300049572 Bacteria 6608
568 Ga0501037_0014849 3300049573 Bacteria 5729
569 Ga0501037_0024195 3300049573 Bacteria 4491
570 Ga0501037_0109103 3300049573 Bacteria 1994
571 Ga0501038_0002500 3300049574 Bacteria 17111
572 Ga0501042_0013116 3300049578 Bacteria 5637
573 Ga0501042_0094584 3300049578 Bacteria 2146
574 Ga0501042_0130583 3300049578 Bacteria 1810
575 Ga0501043_0000940 3300049579 Bacteria 25841
576 Ga0501043_0005179 3300049579 Bacteria 10551
577 Ga0501047_0000112 3300049581 Bacteria 98939
578 Ga0501047_0003079 3300049581 Bacteria 15814
579 Ga0501047_0013998 3300049581 Bacteria 7623
580 Ga0501047_0142066 3300049581 Bacteria 2278
581 Ga0501047_0162706 3300049581 Bacteria 2103
582 Ga0501048_0000430 3300049582 Bacteria 29484
583 Ga0501048_0005883 3300049582 Bacteria 9335
584 Ga0501048_0136097 3300049582 Bacteria 1736
585 Ga0501067_0017500 3300049583 Bacteria 3965
586 Ga0501067_0021891 3300049583 Bacteria 3536
587 Ga0501067_0031109 3300049583 Bacteria 2962
588 Ga0501069_0000223 3300049585 Bacteria 25278
589 Ga0501070_0001165 3300049586 Bacteria 23519
590 Ga0501070_0001589 3300049586 Bacteria 20181
591 Ga0501070_0003370 3300049586 Bacteria 13863
592 Ga0501070_0004084 3300049586 Bacteria 12547
593 Ga0501070_0160626 3300049586 Bacteria 1852
594 Ga0501071_0006703 3300049587 Bacteria 7485
595 Ga0501072_0004752 3300049588 Bacteria 10340
596 Ga0501073_0003012 3300049589 Bacteria 12622
597 Ga0501073_0015509 3300049589 Bacteria 5528
598 Ga0501073_0035738 3300049589 Bacteria 3530
599 Ga0501074_0002302 3300049590 Bacteria 13294
600 Ga0501074_0014120 3300049590 Bacteria 5806
601 Ga0501074_0016485 3300049590 Bacteria 5363
602 Ga0501074_0033445 3300049590 Bacteria 3725
603 Ga0501076_0088499 3300049592 Bacteria 2489
604 Ga0501079_0000093 3300049741 Bacteria 43802
605 Ga0501080_0000266 3300049742 Bacteria 39496
606 Ga0501080_0002959 3300049742 Bacteria 14937
607 Ga0501080_0003067 3300049742 Bacteria 14750
608 Ga0501080_0016002 3300049742 Bacteria 6921
609 Ga0501080_0016463 3300049742 Bacteria 6828
610 Ga0501080_0159102 3300049742 Bacteria 2086
611 Ga0501083_0012707 3300049744 Bacteria 5890
612 Ga0501035_0004984 3300049822 Bacteria 12582
613 Ga0501035_0054112 3300049822 Bacteria 3586
614 Ga0501044_0006618 3300049823 Bacteria 12782
615 Ga0501044_0010160 3300049823 Bacteria 10228
616 Ga0501044_0028412 3300049823 Bacteria 5904
617 nmdc:mga03n38_19585_c1 3300050490 Bacteria 2692
618 nmdc:mga03n38_252_c1 3300050490 Bacteria 12593
619 nmdc:mga03n38_25558_c1 3300050490 Bacteria 2427
620 nmdc:mga03n38_43231_c1 3300050490 Bacteria 1974
621 nmdc:mga00v17_1493_c1 3300050491 Bacteria 12233
622 nmdc:mga00v17_20713_c1 3300050491 Bacteria 3771
623 nmdc:mga00v17_25570_c1 3300050491 Bacteria 3432
624 nmdc:mga00v17_58198_c1 3300050491 Bacteria 2367
625 nmdc:mga00v17_5845_c1 3300050491 Bacteria 6496
626 nmdc:mga0yw44_14407_c1 3300050492 Bacteria 4198
627 nmdc:mga0yw44_59698_c1 3300050492 Bacteria 2334
628 nmdc:mga06z11_5203_c1 3300050494 Bacteria 5199
629 nmdc:mga07m45_22236_c1 3300050496 Bacteria 3461
630 nmdc:mga07m45_5281_c1 3300050496 Bacteria 6422
631 nmdc:mga05p37_126133_c1 3300050507 Bacteria 3143
632 nmdc:mga05p37_95172_c1 3300050507 Bacteria 3669
633 nmdc:mga06r32_95864_c1 3300050510 Bacteria 2904
634 nmdc:mga08y16_8573_c1 3300050511 Bacteria 10713
635 nmdc:mga0n895_1561_c1 3300050512 Bacteria 17213
636 nmdc:mga0n895_66340_c1 3300050512 Bacteria 3574
637 nmdc:mga0rr50_13786_c1 3300050513 Bacteria 5277
638 nmdc:mga0rr50_2977_c1 3300050513 Bacteria 9684
639 nmdc:mga08x19_10412_c1 3300050514 Bacteria 5583
640 nmdc:mga08x19_116202_c1 3300050514 Bacteria 1789
641 nmdc:mga08x19_41410_c1 3300050514 Bacteria 2934
642 nmdc:mga0a205_1954_c1 3300050515 Bacteria 17924
643 nmdc:mga0a205_270373_c1 3300050515 Bacteria 1577
644 nmdc:mga0sz30_3231_c1 3300050516 Bacteria 5855
645 nmdc:mga0sz30_37830_c1 3300050516 Bacteria 2021
646 nmdc:mga0sz30_650_c1 3300050516 Bacteria 12878
647 Ga0495601_0005038 3300053077 Bacteria 7668
648 Ga0495601_0081330 3300053077 Bacteria 2079
649 Ga0495612_0009349 3300053078 Bacteria 3979
650 Ga0495595_0005893 3300053084 Bacteria 4967
651 Ga0495619_0007719 3300053085 Bacteria 6810
652 Ga0495619_0119477 3300053085 Bacteria 1806
653 Ga0500616_0000466 3300053153 Bacteria 52609
654 Ga0500616_0001931 3300053153 Bacteria 18503
655 Ga0501084_0067010 3300054114 Bacteria 3005
656 Ga0501082_0092234 3300060353 Bacteria 2616
657 2515852234 2515154155 Bacteria 7985436
658 2548696254 2547132424 Bacteria 8348532
659 2552108219 2551306166 Bacteria 9731570
660 2644082761 2643221613 Bacteria 4622396
661 2644516047 2643221692 Bacteria 7282860
662 2644636246 2643221715 Bacteria 6671032
663 2644665623 2643221721 Bacteria 4486924
664 2676474610 2675903058 Bacteria 6822861
665 2676495011 2675903060 Bacteria 10051191
666 2738693908 2738541272 Bacteria 6848551
667 2738891355 2738541308 Bacteria 7020677
668 2739326922 2738543027 Bacteria 6409078
669 2739362098 2738543034 Bacteria 6084756
670 2739607283 2739367654 Bacteria 6049412
671 2753271019 2751185782 Bacteria 11227053
672 2760304808 2758568522 Bacteria 5953541
673 2760621369 2758568621 Bacteria 5967089
674 2809026153 2808606394 Bacteria 6248540
675 2809194190 2808606439 Bacteria 5952208
676 2812348939 2811994878 Bacteria 5992952
677 2827632916 2827628540 Bacteria 6858585
678 2835191124 2835188231 Bacteria 3476928
679 2837268955 2837268691 Bacteria 7850704
680 2839989604 2839986021 Bacteria 3685650
681 2855388126 2855386786 Bacteria 4752232
682 2856746186 2856741275 Bacteria 8096094
683 2857485698 2857481737 Bacteria 4761446
684 2873314874 2873314349 Bacteria 8512634
685 2884694347 2884693830 Bacteria 11273186
686 2891402639 2891395885 Bacteria 9251614
687 2891554966 2891554331 Bacteria 8812224
688 2891562732 2891562705 Bacteria 8039471
689 2895435585 2895427314 Bacteria 13147766
690 2895444242 2895442618 Bacteria 11027144
691 2902798015 2902792274 Bacteria 7270173
692 2929214387 2929212328 Bacteria 7708288
693 2932400109 2932398195 Bacteria 3847976
694 2932432115 2932431166 Bacteria 4215299
695 2935892196 2935890801 Bacteria 4593001
696 2956941387 2956939328 Bacteria 3474458
697 3001120184 3001119090 Bacteria 3449530
698 8055074150 8055066027 Bacteria 9479577
699 8055175672 8055172936 Bacteria 9305943
700 8056065975 8056060235 Bacteria 7259403
701 8056581816 8056579771 Bacteria 5840325
702 Ga0207674_10074365
703 JGI25406J46586_10008582
704 JGI25404J52841_10007710
705 Ga0070658_10000319
706 Ga0070658_10000776
707 Ga0070658_10010607
708 Ga0070658_10027567
709 Ga0070683_100048881
710 Ga0070683_100100892
711 Ga0070690_100040735
712 Ga0070670_100084364
713 Ga0068869_100010535
714 Ga0070680_100000061
715 Ga0070680_100006109
716 Ga0070680_100075208
717 Ga0070682_100005796
718 Ga0070682_100026958
719 Ga0068868_100014461
720 Ga0070660_100103571
721 Ga0070691_10000321
722 Ga0070661_100112153
723 Ga0070692_10003150
724 Ga0070669_100088389
725 Ga0070675_100011931
726 Ga0070671_100000753
727 Ga0070671_100012429
728 Ga0070688_100018384
729 Ga0070659_100022340
730 Ga0070659_100138193
731 Ga0070667_100051698
732 Ga0070709_10001204
733 Ga0070709_10001732
734 Ga0070709_10012907
735 Ga0070714_100000467
736 Ga0070714_100001268
737 Ga0070714_100106817
738 Ga0070714_100113297
739 Ga0070713_100000369
740 Ga0070713_100201556
741 Ga0070710_10000355
742 Ga0070710_10005713
743 Ga0070710_10017712
744 Ga0070710_10064199
745 Ga0070711_100000365
746 Ga0070711_100015248
747 Ga0070705_100084950
748 Ga0070705_100104706
749 Ga0070700_100018383
750 Ga0070663_100001319
751 Ga0070678_100001410
752 Ga0070678_100063244
753 Ga0070681_10001025
754 Ga0070681_10024594
755 Ga0070681_10232714
756 Ga0070685_10024510
757 Ga0070707_100026292
758 Ga0070707_100046868
759 Ga0070707_100126192
760 Ga0070698_100000073
761 Ga0070698_100049793
762 Ga0070698_100059542
763 Ga0070698_100064635
764 Ga0070699_100018160
765 Ga0070679_100001551
766 Ga0070679_100024000
767 Ga0070679_100040221
768 Ga0070679_100113220
769 Ga0070679_100126330
770 Ga0070679_100156061
771 Ga0070684_100021433
772 Ga0070697_100002048
773 Ga0070697_100033436
774 Ga0068853_100166571
775 Ga0070672_100095979
776 Ga0070696_100000187
777 Ga0070693_100001241
778 Ga0070693_100092344
779 Ga0070665_100005680
780 Ga0070665_100050565
781 Ga0068855_100039253
782 Ga0068857_100013348
783 Ga0068854_100071847
784 Ga0068856_100387371
785 Ga0070702_100000194
786 Ga0068852_100082041
787 Ga0068864_100016036
788 Ga0068851_10071890
789 Ga0068870_10000026
790 Ga0068863_100052669
791 Ga0068863_100081806
792 Ga0068858_100013833
793 Ga0068860_100046432
794 Ga0081540_1000522
795 Ga0081540_1001953
796 Ga0081540_1033080
797 Ga0081539_10008707
798 Ga0081539_10015008
799 Ga0081539_10019912
800 Ga0081539_10035811
801 Ga0070717_10001423
802 Ga0070717_10026289
803 Ga0070717_10106294
804 Ga0070717_10191134
805 Ga0075365_10019544
806 Ga0075363_100002816
807 Ga0075363_100002835
808 Ga0075363_100036911
809 Ga0075364_10001293
810 Ga0075364_10003691
811 Ga0070716_100000220
812 Ga0070712_100182365
813 Ga0070712_100220107
814 Ga0075362_10012217
815 Ga0075369_10002562
816 Ga0075369_10019184
817 Ga0097621_100011771
818 Ga0075370_10001448
819 Ga0075370_10050298
820 Ga0068871_100012333
821 Ga0075428_100030689
822 Ga0075428_100211642
823 Ga0075430_100034036
824 Ga0075433_10001597
825 Ga0075434_100006004
826 Ga0075436_100006291
827 Ga0075436_100064244
828 Ga0075435_100010141
829 Ga0075435_100035958
830 Ga0099795_10020220
831 Ga0105251_10017455
832 Ga0111539_10045581
833 Ga0114129_10056964
834 Ga0114129_10367981
835 Ga0114129_10390766
836 Ga0114129_10431550
837 Ga0105241_10021355
838 Ga0105242_10072318
839 Ga0105248_10156136
840 Ga0105237_10037928
841 Ga0105238_10010962
842 Ga0105238_10240234
843 Ga0105249_10005021
844 Ga0105249_10069927
845 Ga0105249_10093102
846 Ga0105239_10062210
847 Ga0157373_10092702
848 Ga0157371_10011136
849 Ga0157371_10109997
850 Ga0157370_10142065
851 Ga0157369_10000890
852 Ga0157369_10038920
853 Ga0157369_10082310
854 Ga0157369_10307047
855 Ga0157374_10060944
856 Ga0157372_10188381
857 Ga0157372_10525306
858 Ga0157375_10143866
859 Ga0163163_10043199
860 Ga0163163_10129194
861 Ga0157380_10001844
862 Ga0157380_10126490
863 Ga0157376_10094830
864 Ga0163161_10042344
865 Ga0163161_10092813
866 Ga0197907_10808444
867 Ga0206351_10007999
868 Ga0206350_10886524
869 Ga0206354_10175752
870 Ga0206353_11934209
871 Ga0213876_10000793
872 Ga0213875_10001511
873 Ga0213875_10010278
874 Ga0224712_10000868
875 Ga0224712_10010524
876 Ga0224712_10046956
877 Ga0207656_10062823
878 Ga0207692_10000079
879 Ga0207692_10002371
880 Ga0207692_10006984
881 Ga0207692_10029282
882 Ga0207692_10073474
883 Ga0207710_10009415
884 Ga0207688_10005541
885 Ga0207647_10042708
886 Ga0207699_10000297
887 Ga0207699_10002064
888 Ga0207699_10008897
889 Ga0207699_10028695
890 Ga0207699_10060008
891 Ga0207643_10000062
892 Ga0207705_10000676
893 Ga0207684_10010070
894 Ga0207684_10051241
895 Ga0207707_10000277
896 Ga0207707_10008067
897 Ga0207707_10009801
898 Ga0207707_10010633
899 Ga0207693_10029887
900 Ga0207663_10004529
901 Ga0207660_10000115
902 Ga0207660_10002198
903 Ga0207657_10013589
904 Ga0207657_10076976
905 Ga0207657_10115856
906 Ga0207657_10165060
907 Ga0207649_10000906
908 Ga0207652_10008957
909 Ga0207652_10010364
910 Ga0207652_10016837
911 Ga0207652_10101707
912 Ga0207652_10135819
913 Ga0207652_10193250
914 Ga0207646_10023054
915 Ga0207646_10055127
916 Ga0207694_10017076
917 Ga0207650_10008170
918 Ga0207659_10001919
919 Ga0207687_10006354
920 Ga0207700_10000270
921 Ga0207700_10003858
922 Ga0207700_10015247
923 Ga0207700_10045111
924 Ga0207700_10062508
925 Ga0207700_10140263
926 Ga0207700_10226550
927 Ga0207664_10000430
928 Ga0207664_10000729
929 Ga0207664_10011587
930 Ga0207664_10016341
931 Ga0207664_10016390
932 Ga0207664_10036319
933 Ga0207664_10083002
934 Ga0207664_10120614
935 Ga0207644_10004647
936 Ga0207644_10008658
937 Ga0207690_10000171
938 Ga0207665_10000611
939 Ga0207665_10001386
940 Ga0207665_10021920
941 Ga0207691_10019406
942 Ga0207691_10090667
943 Ga0207711_10327572
944 Ga0207689_10001383
945 Ga0207661_10013928
946 Ga0207661_10086006
947 Ga0207661_10290431
948 Ga0207679_10000828
949 Ga0207667_10244285
950 Ga0207651_10161614
951 Ga0207712_10043986
952 Ga0207640_10036130
953 Ga0207677_10003805
954 Ga0207678_10000105
955 Ga0207708_10042151
956 Ga0207702_10000662
957 Ga0207702_10006045
958 Ga0207641_10002000
959 Ga0207641_10050658
960 Ga0207676_10000596
961 Ga0207674_10017071
962 Ga0207674_10072722
963 Ga0207675_100054587
964 Ga0207675_100129117
965 Ga0207683_10000092
966 Ga0207683_10026749
967 Ga0207698_10016868
968 Ga0207428_10006417
969 Ga0268266_10003190
970 Ga0268266_10014301
971 Ga0268266_10036756
972 Ga0268266_10214456
973 Ga0265337_1000389
974 Ga0265326_10000357
975 Ga0265319_1000939
976 Ga0265334_10000792
977 Ga0265323_10002259
978 Ga0265322_10020698
979 Ga0265336_10001444
980 Ga0265338_10001255
981 Ga0265324_10000773
982 Ga0307511_10118667
983 Ga0316177_1184759
984 Ga0265332_10001478
985 Ga0265320_10000980
986 Ga0265325_10002776
987 Ga0265340_10001509
988 Ga0265340_10004198
989 Ga0265339_10008767
990 Ga0265339_10012226
991 Ga0265327_10000021
992 Ga0265327_10000071
993 Ga0265327_10030444
994 Ga0265316_10004740
995 Ga0307513_10001302
996 Ga0265313_10010756
997 Ga0316579_10000030
998 Ga0265314_10006663
999 Ga0265314_10007781
1000 Ga0265342_10001351
1001 Ga0316576_10081962
1002 Ga0307405_10022837
1003 Ga0307405_10101594
1004 Ga0307405_10149266
1005 Ga0307410_10026915
1006 Ga0307406_10179281
1007 Ga0307409_100022479
1008 Ga0307409_100029871
1009 Ga0307409_100129522
1010 Ga0307409_100273098
1011 Ga0307409_100337170
1012 Ga0307416_100155902
1013 Ga0307414_10080970
1014 Ga0307414_10298932
1015 Ga0373926_0009309
1016 Ga0373934_0000169
1017 Ga0373934_0003190
1018 Ga0373934_0022810
1019 Ga0373923_0018883
1020 Ga0373923_0052334
1021 Ga0373936_0011330
1022 Ga0373941_0015611
1023 Ga0373945_0005546
1024 Ga0373945_0023475
1025 Ga0373953_0000574
1026 Ga0373953_0010793
1027 Ga0373954_0000115
1028 Ga0373954_0020972
1029 Ga0373954_0081750
1030 Ga0373956_0000283
1031 Ga0373957_0000047
1032 Ga0373957_0000330
1033 Ga0373957_0008086
1034 Ga0373957_0016566
1035 Ga0373943_0001264
1036 Ga0373955_0000020
1037 Ga0373955_0023105
1038 Ga0373924_0053212
1039 Ga0373935_0001783
1040 Ga0373935_0002440
1041 Ga0373935_0003356
1042 Ga0373935_0125318
1043 Ga0373927_0002894
1044 Ga0373933_0000192
1045 Ga0373933_0004542
1046 Ga0373933_0009726
1047 Ga0373933_0013288
1048 Ga0373933_0067971
1049 Ga0373947_0000009
1050 Ga0373947_0023195
1051 Ga0373937_0000067
1052 Ga0373937_0048534
1053 Ga0373937_0099769
1054 Ga0373937_0155586
1055 Ga0372808_000433
1056 Ga0373925_0000006
1057 Ga0373925_0054670
1058 Ga0373925_0152704
1059 Ga0373925_0221428
1060 Ga0395900_0003901
1061 Ga0395900_0074645
1062 Ga0395898_0040878
1063 Ga0395898_0114918
1064 Ga0436364_0411147
1065 Ga0436364_0724530
1066 Ga0436364_0735260
1067 Ga0436364_1004318
1068 Ga0436364_1469180
1069 Ga0400485_14323
1070 Ga0400486_16675
1071 Ga0436365_0567091
1072 Ga0436363_0152383
1073 Ga0436363_1296994
1074 Ga0439442_003290
1075 Ga0439460_0022389
1076 Ga0466972_0011562
1077 Ga0466965_0034461
1078 Ga0466965_0037007
1079 Ga0466966_0005406
1080 Ga0466966_0033562
1081 Ga0466966_0042033
1082 Ga0466961_0016926
1083 Ga0466961_0021195
1084 Ga0466961_0108726
1085 Ga0466963_0001501
1086 Ga0466963_0104802
1087 Ga0466964_0011072
1088 Ga0466964_0021022
1089 Ga0466970_0041705
1090 Ga0466957_0001084
1091 Ga0466957_0007517
1092 Ga0466957_0008284
1093 Ga0466957_0023207
1094 Ga0466960_0005774
1095 Ga0466960_0016391
1096 Ga0466960_0025185
1097 Ga0466959_0026506
1098 Ga0466958_0012247
1099 Ga0466958_0027717
1100 Ga0466958_0030764
1101 Ga0466958_0032180
1102 Ga0466958_0064424
1103 Ga0466967_0006860
1104 Ga0466967_0009250
1105 Ga0466967_0009645
1106 Ga0466967_0010064
1107 Ga0466967_0010481
1108 Ga0466967_0017591
1109 Ga0466967_0059894
1110 Ga0466967_0352801
1111 Ga0495627_007742
1112 Ga0495592_0000069
1113 Ga0495592_0048705
1114 Ga0495592_0139114
1115 Ga0495629_0064814
1116 Ga0495651_0000016
1117 Ga0495651_0009105
1118 Ga0495651_0010707
1119 Ga0495651_0017471
1120 Ga0495651_0088199
1121 Ga0495653_0000381
1122 Ga0495653_0050107
1123 Ga0495653_0075984
1124 Ga0495653_0128304
1125 Ga0495580_0160330
1126 Ga0495582_0010542
1127 Ga0495582_0039979
1128 Ga0495639_0013444
1129 Ga0495639_0019615
1130 Ga0495662_0001777
1131 Ga0495662_0030379
1132 Ga0495662_0047183
1133 Ga0495664_0003802
1134 Ga0495664_0011084
1135 Ga0495664_0047656
1136 Ga0495664_0084815
1137 Ga0495607_0053419
1138 Ga0495608_0000051
1139 Ga0495608_0063559
1140 Ga0495618_0014794
1141 Ga0495618_0123310
1142 Ga0495628_0000126
1143 Ga0495628_0014290
1144 Ga0495628_0042115
1145 Ga0495628_0046900
1146 Ga0495630_0019309
1147 Ga0495630_0044091
1148 Ga0495630_0136953
1149 Ga0495630_0145452
1150 Ga0495652_0000831
1151 Ga0495652_0062714
1152 Ga0495665_0007121
1153 Ga0495665_0010808
1154 Ga0495640_0010451
1155 Ga0495640_0021758
1156 Ga0495640_0022598
1157 Ga0495587_0000058
1158 Ga0495587_0007728
1159 Ga0495587_0008381
1160 Ga0495587_0016591
1161 Ga0495587_0021679
1162 Ga0495645_0058993
1163 Ga0495667_0000062
1164 Ga0495667_0015798
1165 Ga0495667_0035985
1166 Ga0495667_0075135
1167 Ga0495667_0172284
1168 Ga0495634_0005403
1169 Ga0495634_0031381
1170 Ga0495634_0113937
1171 Ga0495635_0045886
1172 Ga0495588_0101906
1173 Ga0495657_0000065
1174 Ga0495657_0004954
1175 Ga0495599_0000045
1176 Ga0495599_0031083
1177 Ga0495599_0078591
1178 Ga0495623_0000051
1179 Ga0495623_0013751
1180 Ga0495623_0019760
1181 Ga0495646_0021582
1182 Ga0495646_0039263
1183 Ga0495646_0056938
1184 Ga0495613_0008898
1185 Ga0495613_0056674
1186 Ga0495624_0006149
1187 Ga0495624_0114142
1188 Ga0495600_0012030
1189 Ga0495600_0015392
1190 Ga0495600_0051991
1191 Ga0495581_0001158
1192 Ga0495581_0023049
1193 Ga0495581_0065200
1194 Ga0495604_0000233
1195 Ga0495604_0025821
1196 Ga0495604_0037096
1197 Ga0495674_0029025
1198 Ga0495674_0057173
1199 Ga0495676_0087330
1200 Ga0495680_0000678
1201 Ga0495680_0037000
1202 Ga0495680_0065874
1203 Ga0495683_0000766
1204 Ga0495675_0000325
1205 Ga0495675_0008260
1206 Ga0495684_0056389
1207 Ga0495684_0182173
1208 Ga0495593_0000429
1209 Ga0495593_0004828
1210 Ga0495593_0087486
1211 Ga0495602_0000079
1212 Ga0495602_0037927
1213 Ga0495602_0047650
1214 Ga0495602_0103494
1215 Ga0496100_0015308
1216 Ga0496101_0010709
1217 Ga0496101_0043399
1218 Ga0496101_0079065
1219 Ga0496102_0003939
1220 Ga0496102_0006978
1221 Ga0496102_0041912
1222 Ga0496102_0054275
1223 Ga0496103_0029451
1224 Ga0496103_0037480
1225 Ga0496104_0001831
1226 Ga0496104_0007517
1227 Ga0496105_0001640
1228 Ga0496105_0012381
1229 Ga0496105_0016909
1230 Ga0496106_0006573
1231 Ga0496106_0024633
1232 Ga0496106_0164875
1233 Ga0496107_0012322
1234 Ga0496107_0058015
1235 Ga0496108_0002276
1236 Ga0496108_0013268
1237 Ga0496108_0017769
1238 Ga0496108_0114894
1239 Ga0496109_0026156
1240 Ga0496109_0052275
1241 Ga0496109_0107219
1242 Ga0496109_0324763
1243 Ga0496110_0033104
1244 Ga0496111_0002607
1245 Ga0496111_0032008
1246 Ga0496111_0032687
1247 Ga0496111_0060874
1248 Ga0496112_0004865
1249 Ga0496112_0012658
1250 Ga0496112_0048294
1251 Ga0496112_0090894
1252 Ga0496112_0166311
1253 Ga0496112_0362527
1254 Ga0496113_0016538
1255 Ga0496113_0021834
1256 Ga0496113_0087695
1257 Ga0496113_0261783
1258 Ga0496114_0006040
1259 Ga0496114_0060716
1260 Ga0496114_0113863
1261 Ga0496125_0032453
1262 Ga0496126_0048164
1263 Ga0501031_0084813
1264 Ga0501032_0028699
1265 Ga0501034_0008726
1266 Ga0501034_0012561
1267 Ga0501034_0232054
1268 Ga0501036_0014281
1269 Ga0501037_0014849
1270 Ga0501037_0024195
1271 Ga0501037_0109103
1272 Ga0501038_0002500
1273 Ga0501042_0013116
1274 Ga0501042_0094584
1275 Ga0501042_0130583
1276 Ga0501043_0000940
1277 Ga0501043_0005179
1278 Ga0501047_0000112
1279 Ga0501047_0003079
1280 Ga0501047_0013998
1281 Ga0501047_0142066
1282 Ga0501047_0162706
1283 Ga0501048_0000430
1284 Ga0501048_0005883
1285 Ga0501048_0136097
1286 Ga0501067_0017500
1287 Ga0501067_0021891
1288 Ga0501067_0031109
1289 Ga0501069_0000223
1290 Ga0501070_0001165
1291 Ga0501070_0001589
1292 Ga0501070_0003370
1293 Ga0501070_0004084
1294 Ga0501070_0160626
1295 Ga0501071_0006703
1296 Ga0501072_0004752
1297 Ga0501073_0003012
1298 Ga0501073_0015509
1299 Ga0501073_0035738
1300 Ga0501074_0002302
1301 Ga0501074_0014120
1302 Ga0501074_0016485
1303 Ga0501074_0033445
1304 Ga0501076_0088499
1305 Ga0501079_0000093
1306 Ga0501080_0000266
1307 Ga0501080_0002959
1308 Ga0501080_0003067
1309 Ga0501080_0016002
1310 Ga0501080_0016463
1311 Ga0501080_0159102
1312 Ga0501083_0012707
1313 Ga0501035_0004984
1314 Ga0501035_0054112
1315 Ga0501044_0006618
1316 Ga0501044_0010160
1317 Ga0501044_0028412
1318 nmdc:mga03n38_19585_c1
1319 nmdc:mga03n38_252_c1
1320 nmdc:mga03n38_25558_c1
1321 nmdc:mga03n38_43231_c1
1322 nmdc:mga00v17_1493_c1
1323 nmdc:mga00v17_20713_c1
1324 nmdc:mga00v17_25570_c1
1325 nmdc:mga00v17_58198_c1
1326 nmdc:mga00v17_5845_c1
1327 nmdc:mga0yw44_14407_c1
1328 nmdc:mga0yw44_59698_c1
1329 nmdc:mga06z11_5203_c1
1330 nmdc:mga07m45_22236_c1
1331 nmdc:mga07m45_5281_c1
1332 nmdc:mga05p37_126133_c1
1333 nmdc:mga05p37_95172_c1
1334 nmdc:mga06r32_95864_c1
1335 nmdc:mga08y16_8573_c1
1336 nmdc:mga0n895_1561_c1
1337 nmdc:mga0n895_66340_c1
1338 nmdc:mga0rr50_13786_c1
1339 nmdc:mga0rr50_2977_c1
1340 nmdc:mga08x19_10412_c1
1341 nmdc:mga08x19_116202_c1
1342 nmdc:mga08x19_41410_c1
1343 nmdc:mga0a205_1954_c1
1344 nmdc:mga0a205_270373_c1
1345 nmdc:mga0sz30_3231_c1
1346 nmdc:mga0sz30_37830_c1
1347 nmdc:mga0sz30_650_c1
1348 Ga0495601_0005038
1349 Ga0495601_0081330
1350 Ga0495612_0009349
1351 Ga0495595_0005893
1352 Ga0495619_0007719
1353 Ga0495619_0119477
1354 Ga0500616_0000466
1355 Ga0500616_0001931
1356 Ga0501084_0067010
1357 Ga0501082_0092234
1358 2515852234
1359 2548696254
1360 2552108219
1361 2644082761
1362 2644516047
1363 2644636246
1364 2644665623
1365 2676474610
1366 2676495011
1367 2738693908
1368 2738891355
1369 2739326922
1370 2739362098
1371 2739607283
1372 2753271019
1373 2760304808
1374 2760621369
1375 2809026153
1376 2809194190
1377 2812348939
1378 2827632916
1379 2835191124
1380 2837268955
1381 2839989604
1382 2855388126
1383 2856746186
1384 2857485698
1385 2873314874
1386 2884694347
1387 2891402639
1388 2891554966
1389 2891562732
1390 2895435585
1391 2895444242
1392 2902798015
1393 2929214387
1394 2932400109
1395 2932432115
1396 2935892196
1397 2956941387
1398 3001120184
1399 8055074150
1400 8055175672
1401 8056065975
1402 8056581816

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10589

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region

335

419

0.97

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

53

225

0.96

PF22461

SLBB_2

SLBB domain

247

311

0.9

PF10531

SLBB

SLBB domain

247

298

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9i-assembly1.cif.gz_F mycobacterial respiratory complex i, semi-inserted quinone 0.9263 3 428
8gym-assembly1.cif.gz_v1 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9146 8 416
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.9107 5 421
7ard-assembly1.cif.gz_F cryo-em structure of polytomella complex-i (complete composition) 0.9096 8 416
6vw7-assembly1.cif.gz_B formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.9096 5 410
ID Description Score Start End Superfamily
af_P9WIV7_242_335_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 1.003 232 325 3.10.20.600
af_P9WIV7_242_335_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9929 232 325 3.10.20.600
af_P9WIV7_336_431_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9726 326 421 1.20.1440.230
af_A1ZAW7_585_680_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9662 327 416 1.20.1440.230
af_P9WIV7_336_431_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9628 326 421 1.20.1440.230
ID Description Score Start End GO Terms
AF-A0A2S8LPE3-F1-model_v4 deleted 0.9879 239 427
AF-A0A7Y4QEK5-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.982 248 417 GO:0008137
GO:0010181
GO:0046872
GO:0048038
GO:0051539
AF-A0A356F953-F1-model_v4 NADH-ubiquinone oxidoreductase 51kDa subunit iron-sulphur binding domain-containing protein 0.9782 209 417 GO:0003954
GO:0008137
GO:0010181
GO:0045333
GO:0046872
GO:0051539
AF-A0A7C5WER3-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9777 216 422 GO:0008137
GO:0010181
GO:0046872
GO:0048038
GO:0051539
AF-A0A7Z9Y2L4-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9752 321 414 GO:0003954
GO:0008137
GO:0010181
GO:0045333
GO:0046872
GO:0051539

Map