F476087

General Info

Members Datasets Scaffolds Average Seq Length
700 258 692 146

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10416251|Ga0105248_104162512
Length 168
Sequence VSELRTAQHDRIHAEQAPMRALVQRVREASVTVEGRVTGAIGAGLLVLAGITDGDGPDDRDWLVRKIAHLRVFDDAAGVMNRSVREAGGGILAVSQFTLYASTKKGNRPSYSAAARPEIAQPGFDAFVAALAAELGAPVPTGVFGAHMHVALVNDGPVTIWLDSKARE

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
4 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
5 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
6 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
7 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
8 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
179 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4
Rhizosphere 94.86
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1020640 3300001977 Bacteria 923
2 JGI24744J21845_10057323 3300002077 Bacteria 714
3 rootL2_10008994 3300003322 Bacteria 11630
4 Ga0065712_10090276 3300005290 Bacteria 2428
5 Ga0065715_10127025 3300005293 Bacteria 2096
6 Ga0070658_10001881 3300005327 Bacteria 17690
7 Ga0070658_10172152 3300005327 Bacteria 1819
8 Ga0070676_10000503 3300005328 Bacteria 18693
9 Ga0070676_10000863 3300005328 Bacteria 14941
10 Ga0070676_10060443 3300005328 Bacteria 2250
11 Ga0070676_10135230 3300005328 Bacteria 1563
12 Ga0070676_10283994 3300005328 Unclassified 1116
13 Ga0070683_100008459 3300005329 Bacteria 8741
14 Ga0070690_100000254 3300005330 Bacteria 27596
15 Ga0070690_100041406 3300005330 Bacteria 2916
16 Ga0070670_100018216 3300005331 Bacteria 6026
17 Ga0070670_100021410 3300005331 Bacteria 5562
18 Ga0070670_100031963 3300005331 Bacteria 4531
19 Ga0070670_100048424 3300005331 Bacteria 3658
20 Ga0070670_100146918 3300005331 Bacteria 2040
21 Ga0070677_10000200 3300005333 Bacteria 20699
22 Ga0070677_10005597 3300005333 Bacteria 4145
23 Ga0070677_10086811 3300005333 Bacteria 1352
24 Ga0070677_10110339 3300005333 Bacteria 1227
25 Ga0070677_10110441 3300005333 Bacteria 1226
26 Ga0068869_100000368 3300005334 Bacteria 24312
27 Ga0068869_100004811 3300005334 Bacteria 8431
28 Ga0068869_100017187 3300005334 Bacteria 4896
29 Ga0070666_10001671 3300005335 Bacteria 13535
30 Ga0070666_10001828 3300005335 Bacteria 12975
31 Ga0070666_10005351 3300005335 Bacteria 7868
32 Ga0070666_10007930 3300005335 Bacteria 6562
33 Ga0070666_10046621 3300005335 Bacteria 2908
34 Ga0070666_10119358 3300005335 Bacteria 1828
35 Ga0070680_100012964 3300005336 Bacteria 6484
36 Ga0070682_100515691 3300005337 Bacteria 929
37 Ga0068868_100003034 3300005338 Bacteria 11685
38 Ga0068868_100011587 3300005338 Bacteria 6422
39 Ga0068868_100125181 3300005338 Bacteria 2099
40 Ga0068868_100144318 3300005338 Bacteria 1956
41 Ga0068868_100186783 3300005338 Bacteria 1722
42 Ga0068868_100447077 3300005338 Bacteria 1123
43 Ga0068868_100834400 3300005338 Bacteria 834
44 Ga0068868_101415740 3300005338 Unclassified 649
45 Ga0070660_100003648 3300005339 Bacteria 10632
46 Ga0070660_100139936 3300005339 Bacteria 1941
47 Ga0070660_100194786 3300005339 Bacteria 1642
48 Ga0070660_100423132 3300005339 Bacteria 1103
49 Ga0070689_100010925 3300005340 Bacteria 6488
50 Ga0070689_100047971 3300005340 Bacteria 3293
51 Ga0070687_100000742 3300005343 Bacteria 10829
52 Ga0070661_100000643 3300005344 Bacteria 25810
53 Ga0070661_100073100 3300005344 Bacteria 2524
54 Ga0070692_10021027 3300005345 Bacteria 3172
55 Ga0070668_100001229 3300005347 Bacteria 18229
56 Ga0070668_100007445 3300005347 Bacteria 8122
57 Ga0070668_100007959 3300005347 Bacteria 7871
58 Ga0070668_100044979 3300005347 Bacteria 3387
59 Ga0070668_100077720 3300005347 Bacteria 2595
60 Ga0070668_100083890 3300005347 Bacteria 2502
61 Ga0070668_100422832 3300005347 Bacteria 1141
62 Ga0070668_101606984 3300005347 Bacteria 596
63 Ga0070669_100003246 3300005353 Bacteria 11684
64 Ga0070669_100003827 3300005353 Bacteria 10870
65 Ga0070669_100038686 3300005353 Bacteria 3464
66 Ga0070669_100233945 3300005353 Bacteria 1457
67 Ga0070669_100320194 3300005353 Bacteria 1252
68 Ga0070669_100460075 3300005353 Bacteria 1050
69 Ga0070675_100003536 3300005354 Bacteria 11853
70 Ga0070675_100008402 3300005354 Bacteria 8010
71 Ga0070675_100023911 3300005354 Bacteria 4890
72 Ga0070675_100698817 3300005354 Bacteria 923
73 Ga0070671_100000911 3300005355 Bacteria 21593
74 Ga0070671_100002283 3300005355 Bacteria 14795
75 Ga0070671_100041328 3300005355 Bacteria 3832
76 Ga0070671_100113027 3300005355 Bacteria 2281
77 Ga0070671_100815349 3300005355 Bacteria 813
78 Ga0070671_100928401 3300005355 Bacteria 761
79 Ga0070674_100001737 3300005356 Bacteria 11801
80 Ga0070674_100005812 3300005356 Bacteria 7164
81 Ga0070674_100012649 3300005356 Bacteria 5187
82 Ga0070674_100031258 3300005356 Bacteria 3527
83 Ga0070673_100000414 3300005364 Bacteria 22528
84 Ga0070673_100015663 3300005364 Bacteria 5333
85 Ga0070673_100022281 3300005364 Bacteria 4608
86 Ga0070673_100040168 3300005364 Bacteria 3587
87 Ga0070673_100665568 3300005364 Bacteria 954
88 Ga0070688_100001006 3300005365 Bacteria 14153
89 Ga0070688_100004036 3300005365 Bacteria 7616
90 Ga0070688_100027642 3300005365 Bacteria 3379
91 Ga0070688_100043539 3300005365 Bacteria 2766
92 Ga0070688_100572395 3300005365 Bacteria 861
93 Ga0070688_100659285 3300005365 Bacteria 807
94 Ga0070659_100006412 3300005366 Bacteria 8495
95 Ga0070659_100069794 3300005366 Bacteria 2790
96 Ga0070659_100106115 3300005366 Bacteria 2264
97 Ga0070659_100629752 3300005366 Unclassified 924
98 Ga0070667_100007580 3300005367 Bacteria 9001
99 Ga0070667_100026742 3300005367 Bacteria 4801
100 Ga0070667_100035229 3300005367 Bacteria 4192
101 Ga0070667_100142227 3300005367 Bacteria 2102
102 Ga0070667_100218604 3300005367 Bacteria 1695
103 Ga0070701_10639072 3300005438 Bacteria 709
104 Ga0070711_100959901 3300005439 Bacteria 732
105 Ga0070705_100106328 3300005440 Bacteria 1783
106 Ga0070700_100012529 3300005441 Bacteria 4737
107 Ga0070700_100396220 3300005441 Bacteria 1037
108 Ga0070700_100710645 3300005441 Bacteria 800
109 Ga0070708_100004283 3300005445 Bacteria 11217
110 Ga0070708_100736977 3300005445 Unclassified 927
111 Ga0070663_100002485 3300005455 Bacteria 10404
112 Ga0070663_100017090 3300005455 Bacteria 4727
113 Ga0070663_100036402 3300005455 Bacteria 3420
114 Ga0070663_100695364 3300005455 Bacteria 864
115 Ga0070678_100000991 3300005456 Bacteria 14681
116 Ga0070678_100004553 3300005456 Bacteria 7874
117 Ga0070678_100026328 3300005456 Bacteria 3930
118 Ga0070678_100047823 3300005456 Bacteria 3076
119 Ga0070678_100126761 3300005456 Bacteria 2022
120 Ga0070662_100002848 3300005457 Bacteria 10726
121 Ga0070662_100052544 3300005457 Bacteria 2946
122 Ga0070662_100067819 3300005457 Bacteria 2620
123 Ga0070662_100206154 3300005457 Bacteria 1562
124 Ga0070681_10361374 3300005458 Bacteria 1362
125 Ga0068867_100004322 3300005459 Bacteria 10002
126 Ga0068867_100010865 3300005459 Bacteria 6421
127 Ga0068867_100020893 3300005459 Bacteria 4670
128 Ga0068867_100095707 3300005459 Bacteria 2259
129 Ga0068867_101145928 3300005459 Bacteria 712
130 Ga0070685_10005161 3300005466 Bacteria 6622
131 Ga0070685_10021601 3300005466 Bacteria 3500
132 Ga0070685_10636688 3300005466 Bacteria 771
133 Ga0070707_101242737 3300005468 Bacteria 711
134 Ga0070698_100048873 3300005471 Bacteria 4321
135 Ga0070679_100114144 3300005530 Bacteria 2687
136 Ga0070679_100245648 3300005530 Bacteria 1747
137 Ga0070684_100051122 3300005535 Bacteria 3590
138 Ga0068853_100004263 3300005539 Bacteria 11042
139 Ga0068853_100005722 3300005539 Bacteria 9783
140 Ga0068853_100012941 3300005539 Bacteria 6800
141 Ga0068853_100067276 3300005539 Bacteria 3112
142 Ga0070672_100005198 3300005543 Bacteria 8609
143 Ga0070672_100006664 3300005543 Bacteria 7779
144 Ga0070672_100014912 3300005543 Bacteria 5519
145 Ga0070672_100073278 3300005543 Bacteria 2729
146 Ga0070672_100088031 3300005543 Bacteria 2500
147 Ga0070672_100121847 3300005543 Bacteria 2135
148 Ga0070672_100403869 3300005543 Bacteria 1171
149 Ga0070672_100651265 3300005543 Bacteria 920
150 Ga0070686_100019245 3300005544 Bacteria 4020
151 Ga0070686_100030138 3300005544 Bacteria 3307
152 Ga0070696_100291818 3300005546 Bacteria 1246
153 Ga0070696_100439874 3300005546 Bacteria 1027
154 Ga0070693_100032512 3300005547 Bacteria 2870
155 Ga0070693_100085913 3300005547 Bacteria 1886
156 Ga0070665_100003513 3300005548 Bacteria 16670
157 Ga0070665_100013407 3300005548 Bacteria 8248
158 Ga0070665_100023907 3300005548 Bacteria 6155
159 Ga0070665_100032630 3300005548 Bacteria 5240
160 Ga0070665_100050694 3300005548 Bacteria 4165
161 Ga0070665_100108051 3300005548 Bacteria 2784
162 Ga0070665_100544117 3300005548 Bacteria 1173
163 Ga0070704_100020733 3300005549 Bacteria 4246
164 Ga0068855_100001160 3300005563 Bacteria 32655
165 Ga0068855_100008652 3300005563 Bacteria 12298
166 Ga0070664_100008495 3300005564 Bacteria 8303
167 Ga0070664_100308092 3300005564 Bacteria 1432
168 Ga0068857_100013373 3300005577 Bacteria 7147
169 Ga0068854_100002906 3300005578 Bacteria 10631
170 Ga0068854_100112335 3300005578 Bacteria 2057
171 Ga0068854_100747313 3300005578 Bacteria 848
172 Ga0068856_100001343 3300005614 Bacteria 25881
173 Ga0068856_100001740 3300005614 Bacteria 22761
174 Ga0070702_100013314 3300005615 Bacteria 4150
175 Ga0068852_100003709 3300005616 Bacteria 10702
176 Ga0068852_100032324 3300005616 Bacteria 4332
177 Ga0068852_101771349 3300005616 Bacteria 640
178 Ga0068859_100022430 3300005617 Bacteria 6330
179 Ga0068859_100041674 3300005617 Bacteria 4611
180 Ga0068859_100069797 3300005617 Bacteria 3549
181 Ga0068859_100097073 3300005617 Bacteria 3000
182 Ga0068864_100004730 3300005618 Bacteria 11150
183 Ga0068864_100008701 3300005618 Bacteria 8375
184 Ga0068864_100061299 3300005618 Bacteria 3258
185 Ga0068864_100389993 3300005618 Bacteria 1322
186 Ga0068864_100777627 3300005618 Bacteria 940
187 Ga0068866_10004026 3300005718 Bacteria 6043
188 Ga0068866_10030711 3300005718 Bacteria 2581
189 Ga0068866_10075967 3300005718 Bacteria 1790
190 Ga0068861_100005622 3300005719 Bacteria 8502
191 Ga0068861_100492390 3300005719 Bacteria 1106
192 Ga0068851_10000243 3300005834 Bacteria 25876
193 Ga0068851_10000963 3300005834 Bacteria 12458
194 Ga0068851_10046690 3300005834 Bacteria 2191
195 Ga0068870_10006113 3300005840 Bacteria 5291
196 Ga0068870_10017256 3300005840 Bacteria 3465
197 Ga0068870_10028032 3300005840 Bacteria 2823
198 Ga0068863_100003538 3300005841 Bacteria 15417
199 Ga0068863_100012970 3300005841 Bacteria 8036
200 Ga0068863_100138677 3300005841 Bacteria 2324
201 Ga0068863_100258902 3300005841 Bacteria 1682
202 Ga0068863_100265404 3300005841 Bacteria 1661
203 Ga0068863_101547362 3300005841 Bacteria 672
204 Ga0068858_100012953 3300005842 Bacteria 7864
205 Ga0068858_100033176 3300005842 Bacteria 4794
206 Ga0068858_100227140 3300005842 Bacteria 1769
207 Ga0068858_100283434 3300005842 Bacteria 1578
208 Ga0068860_100003702 3300005843 Bacteria 15736
209 Ga0068860_100007523 3300005843 Bacteria 10899
210 Ga0068860_100037793 3300005843 Bacteria 4620
211 Ga0068860_100130644 3300005843 Bacteria 2409
212 Ga0068860_100166075 3300005843 Bacteria 2131
213 Ga0068860_100675623 3300005843 Bacteria 1042
214 Ga0068860_100745160 3300005843 Bacteria 991
215 Ga0068860_101322608 3300005843 Bacteria 741
216 Ga0068862_100007500 3300005844 Bacteria 9039
217 Ga0068862_100015292 3300005844 Bacteria 6374
218 Ga0068862_100057292 3300005844 Bacteria 3341
219 Ga0068862_100391974 3300005844 Bacteria 1297
220 Ga0068862_101447804 3300005844 Bacteria 691
221 Ga0097621_100004430 3300006237 Bacteria 9776
222 Ga0097621_100063629 3300006237 Bacteria 3032
223 Ga0097621_100083808 3300006237 Bacteria 2657
224 Ga0068871_100002845 3300006358 Bacteria 11855
225 Ga0068871_100063970 3300006358 Bacteria 3010
226 Ga0068871_100175620 3300006358 Bacteria 1839
227 Ga0068871_100729039 3300006358 Bacteria 910
228 Ga0075431_100001756 3300006847 Bacteria 20399
229 Ga0075434_102471695 3300006871 Bacteria 521
230 Ga0075429_100742147 3300006880 Bacteria 860
231 Ga0068865_100019461 3300006881 Bacteria 4393
232 Ga0068865_100032504 3300006881 Bacteria 3486
233 Ga0068865_100177225 3300006881 Bacteria 1639
234 Ga0097620_100022428 3300006931 Bacteria 6330
235 Ga0097620_100041675 3300006931 Bacteria 4611
236 Ga0097620_100069799 3300006931 Bacteria 3549
237 Ga0097620_100097069 3300006931 Bacteria 3000
238 Ga0075435_100098057 3300007076 Bacteria 2426
239 Ga0105240_10005624 3300009093 Bacteria 18607
240 Ga0111539_10025183 3300009094 Bacteria 7293
241 Ga0111539_10204997 3300009094 Bacteria 2299
242 Ga0111539_12788867 3300009094 Bacteria 566
243 Ga0105245_10000551 3300009098 Bacteria 34069
244 Ga0105245_10105468 3300009098 Bacteria 2614
245 Ga0105245_10624336 3300009098 Bacteria 1106
246 Ga0105245_10898295 3300009098 Bacteria 927
247 Ga0105245_11072750 3300009098 Bacteria 851
248 Ga0105247_10156147 3300009101 Bacteria 1507
249 Ga0114129_10414974 3300009147 Bacteria 1772
250 Ga0114129_11774213 3300009147 Bacteria 751
251 Ga0114129_11882190 3300009147 Bacteria 726
252 Ga0105243_10187132 3300009148 Bacteria 1805
253 Ga0105241_10001658 3300009174 Bacteria 16970
254 Ga0105242_10309470 3300009176 Bacteria 1445
255 Ga0105248_10010465 3300009177 Bacteria 10217
256 Ga0105248_10013927 3300009177 Bacteria 8850
257 Ga0105248_10200961 3300009177 Bacteria 2246
258 Ga0105248_10416251 3300009177 Bacteria 1513
259 Ga0105237_10005798 3300009545 Bacteria 13859
260 Ga0105237_10032311 3300009545 Bacteria 5299
261 Ga0105238_12481268 3300009551 Bacteria 554
262 Ga0105249_10000377 3300009553 Bacteria 44267
263 Ga0105249_11793894 3300009553 Bacteria 686
264 Ga0105239_10002655 3300010375 Bacteria 22553
265 Ga0105239_10480027 3300010375 Bacteria 1412
266 Ga0105239_10960238 3300010375 Bacteria 982
267 Ga0105246_10001327 3300011119 Bacteria 14562
268 Ga0105246_10544670 3300011119 Bacteria 993
269 Ga0157373_10000447 3300013100 Bacteria 32642
270 Ga0157373_10007450 3300013100 Bacteria 8141
271 Ga0157373_10419366 3300013100 Bacteria 961
272 Ga0157371_10018417 3300013102 Bacteria 5164
273 Ga0157371_10160434 3300013102 Bacteria 1606
274 Ga0157369_10002477 3300013105 Bacteria 22127
275 Ga0157369_10038923 3300013105 Bacteria 5198
276 Ga0157374_10000252 3300013296 Bacteria 49560
277 Ga0157374_10004846 3300013296 Bacteria 11293
278 Ga0157374_10067000 3300013296 Bacteria 3374
279 Ga0157374_10086982 3300013296 Bacteria 2975
280 Ga0157374_10171910 3300013296 Bacteria 2114
281 Ga0157378_10005924 3300013297 Bacteria 10712
282 Ga0157378_10015035 3300013297 Bacteria 6777
283 Ga0157378_10024959 3300013297 Bacteria 5264
284 Ga0157378_10085314 3300013297 Bacteria 2860
285 Ga0157378_10219989 3300013297 Bacteria 1805
286 Ga0157378_10225493 3300013297 Bacteria 1783
287 Ga0157378_10548946 3300013297 Bacteria 1161
288 Ga0157378_10762999 3300013297 Bacteria 991
289 Ga0163162_10022758 3300013306 Bacteria 6178
290 Ga0163162_10289644 3300013306 Bacteria 1769
291 Ga0163162_10334248 3300013306 Bacteria 1647
292 Ga0163162_10339488 3300013306 Bacteria 1635
293 Ga0163162_10503627 3300013306 Bacteria 1341
294 Ga0163162_10594898 3300013306 Bacteria 1233
295 Ga0157372_10006143 3300013307 Bacteria 12762
296 Ga0157372_10013135 3300013307 Bacteria 8835
297 Ga0157372_11199566 3300013307 Bacteria 877
298 Ga0157372_12098343 3300013307 Bacteria 649
299 Ga0157375_10000991 3300013308 Bacteria 24533
300 Ga0157375_10071615 3300013308 Bacteria 3480
301 Ga0157375_10080968 3300013308 Bacteria 3286
302 Ga0157375_11437439 3300013308 Bacteria 813
303 Ga0157375_11448899 3300013308 Bacteria 810
304 Ga0157375_12900002 3300013308 Bacteria 573
305 Ga0163163_10075762 3300014325 Bacteria 3358
306 Ga0163163_10208325 3300014325 Bacteria 2004
307 Ga0163163_10444837 3300014325 Bacteria 1356
308 Ga0163163_10787718 3300014325 Bacteria 1014
309 Ga0157380_10054818 3300014326 Bacteria 3165
310 Ga0157377_10000845 3300014745 Bacteria 12705
311 Ga0157377_10012946 3300014745 Bacteria 4208
312 Ga0157379_10006850 3300014968 Bacteria 9851
313 Ga0157379_10044808 3300014968 Bacteria 3948
314 Ga0157376_10001467 3300014969 Bacteria 15534
315 Ga0157376_10008365 3300014969 Bacteria 7463
316 Ga0157376_10089712 3300014969 Bacteria 2658
317 Ga0157376_10121182 3300014969 Bacteria 2318
318 Ga0157376_10196776 3300014969 Bacteria 1852
319 Ga0163161_10007813 3300017792 Bacteria 7400
320 Ga0163161_10387947 3300017792 Bacteria 1117
321 Ga0163161_11530291 3300017792 Bacteria 586
322 Ga0213872_10005063 3300021361 Bacteria 6836
323 Ga0213872_10334219 3300021361 Bacteria 624
324 Ga0207673_1015395 3300025290 Bacteria 1012
325 Ga0207697_10000447 3300025315 Bacteria 23239
326 Ga0207697_10000594 3300025315 Bacteria 20589
327 Ga0207697_10030086 3300025315 Bacteria 2223
328 Ga0207697_10126564 3300025315 Bacteria 1102
329 Ga0207697_10146031 3300025315 Bacteria 1027
330 Ga0207697_10169298 3300025315 Bacteria 955
331 Ga0207656_10055084 3300025321 Bacteria 1730
332 Ga0207682_10000138 3300025893 Bacteria 32763
333 Ga0207682_10000556 3300025893 Bacteria 17211
334 Ga0207682_10001173 3300025893 Bacteria 12153
335 Ga0207642_10019098 3300025899 Bacteria 2646
336 Ga0207642_10054452 3300025899 Bacteria 1825
337 Ga0207642_10150718 3300025899 Bacteria 1237
338 Ga0207688_10000079 3300025901 Bacteria 36923
339 Ga0207688_10102128 3300025901 Bacteria 1657
340 Ga0207688_10147854 3300025901 Bacteria 1386
341 Ga0207688_10430506 3300025901 Bacteria 821
342 Ga0207688_10574751 3300025901 Bacteria 709
343 Ga0207680_10002377 3300025903 Bacteria 8766
344 Ga0207680_10002438 3300025903 Bacteria 8673
345 Ga0207680_10021666 3300025903 Bacteria 3480
346 Ga0207680_10046982 3300025903 Bacteria 2555
347 Ga0207680_10069013 3300025903 Bacteria 2183
348 Ga0207680_10580407 3300025903 Bacteria 801
349 Ga0207647_10023772 3300025904 Bacteria 4049
350 Ga0207699_10408739 3300025906 Bacteria 968
351 Ga0207645_10000937 3300025907 Bacteria 24221
352 Ga0207645_10001033 3300025907 Bacteria 22978
353 Ga0207645_10004215 3300025907 Bacteria 10675
354 Ga0207645_10013012 3300025907 Bacteria 5623
355 Ga0207643_10000010 3300025908 Bacteria 159218
356 Ga0207643_10005125 3300025908 Bacteria 7011
357 Ga0207643_10568563 3300025908 Bacteria 728
358 Ga0207705_10933583 3300025909 Bacteria 671
359 Ga0207684_10294702 3300025910 Bacteria 1399
360 Ga0207654_10001503 3300025911 Bacteria 12291
361 Ga0207695_10215201 3300025913 Bacteria 1831
362 Ga0207671_10036871 3300025914 Bacteria 3626
363 Ga0207671_10736990 3300025914 Bacteria 783
364 Ga0207660_10016036 3300025917 Bacteria 4954
365 Ga0207662_10000127 3300025918 Bacteria 36567
366 Ga0207662_10008271 3300025918 Bacteria 5695
367 Ga0207657_10000060 3300025919 Bacteria 101953
368 Ga0207657_10000709 3300025919 Bacteria 35416
369 Ga0207657_10171353 3300025919 Unclassified 1758
370 Ga0207657_10528478 3300025919 Bacteria 923
371 Ga0207649_10100338 3300025920 Bacteria 1914
372 Ga0207652_10226834 3300025921 Bacteria 1684
373 Ga0207681_10025488 3300025923 Bacteria 3804
374 Ga0207681_10117265 3300025923 Bacteria 1947
375 Ga0207681_10316163 3300025923 Bacteria 1240
376 Ga0207681_10581913 3300025923 Bacteria 923
377 Ga0207681_11074910 3300025923 Bacteria 675
378 Ga0207694_10026321 3300025924 Bacteria 4424
379 Ga0207650_10000179 3300025925 Bacteria 74527
380 Ga0207650_10042617 3300025925 Bacteria 3329
381 Ga0207650_10047375 3300025925 Bacteria 3168
382 Ga0207650_10191071 3300025925 Bacteria 1636
383 Ga0207650_10540398 3300025925 Bacteria 976
384 Ga0207659_10002387 3300025926 Bacteria 11183
385 Ga0207659_10009398 3300025926 Bacteria 6106
386 Ga0207659_10033517 3300025926 Bacteria 3535
387 Ga0207687_10001231 3300025927 Bacteria 17541
388 Ga0207644_10002884 3300025931 Bacteria 11075
389 Ga0207644_10004192 3300025931 Bacteria 9355
390 Ga0207644_10050284 3300025931 Bacteria 2987
391 Ga0207644_10055446 3300025931 Bacteria 2856
392 Ga0207644_10251091 3300025931 Bacteria 1411
393 Ga0207644_10483028 3300025931 Bacteria 1020
394 Ga0207644_10689801 3300025931 Bacteria 851
395 Ga0207644_10889068 3300025931 Bacteria 746
396 Ga0207644_11238853 3300025931 Bacteria 627
397 Ga0207690_10002679 3300025932 Bacteria 10730
398 Ga0207690_10003165 3300025932 Bacteria 9891
399 Ga0207690_10077275 3300025932 Bacteria 2314
400 Ga0207690_10627993 3300025932 Unclassified 879
401 Ga0207706_10000002 3300025933 Bacteria 360309
402 Ga0207706_10000132 3300025933 Bacteria 81128
403 Ga0207706_10030107 3300025933 Bacteria 4844
404 Ga0207706_10187655 3300025933 Bacteria 1815
405 Ga0207709_10038422 3300025935 Bacteria 2851
406 Ga0207670_10001364 3300025936 Bacteria 12843
407 Ga0207670_10033653 3300025936 Bacteria 3305
408 Ga0207670_10054237 3300025936 Bacteria 2704
409 Ga0207669_10003338 3300025937 Bacteria 6945
410 Ga0207669_10004470 3300025937 Bacteria 6160
411 Ga0207669_10029177 3300025937 Bacteria 3047
412 Ga0207669_10478623 3300025937 Bacteria 992
413 Ga0207704_10000637 3300025938 Bacteria 15492
414 Ga0207704_10022409 3300025938 Bacteria 3384
415 Ga0207704_10028008 3300025938 Bacteria 3119
416 Ga0207704_10840076 3300025938 Bacteria 769
417 Ga0207691_10000006 3300025940 Bacteria 161922
418 Ga0207691_10000011 3300025940 Bacteria 147984
419 Ga0207691_10010710 3300025940 Bacteria 8804
420 Ga0207691_10031258 3300025940 Bacteria 4970
421 Ga0207691_10044324 3300025940 Bacteria 4095
422 Ga0207691_10071692 3300025940 Bacteria 3125
423 Ga0207691_10090772 3300025940 Bacteria 2738
424 Ga0207691_10095935 3300025940 Bacteria 2652
425 Ga0207691_10219015 3300025940 Bacteria 1651
426 Ga0207691_10765706 3300025940 Bacteria 812
427 Ga0207711_10000671 3300025941 Bacteria 33993
428 Ga0207711_10011342 3300025941 Bacteria 7403
429 Ga0207711_10017206 3300025941 Bacteria 6008
430 Ga0207711_10767160 3300025941 Bacteria 899
431 Ga0207689_10001249 3300025942 Bacteria 24492
432 Ga0207689_10008383 3300025942 Bacteria 9002
433 Ga0207689_10044818 3300025942 Bacteria 3658
434 Ga0207679_10003495 3300025945 Bacteria 9717
435 Ga0207679_10154583 3300025945 Bacteria 1872
436 Ga0207667_10003619 3300025949 Bacteria 19070
437 Ga0207667_10011656 3300025949 Bacteria 10200
438 Ga0207667_12001638 3300025949 Bacteria 539
439 Ga0207651_10001846 3300025960 Bacteria 9893
440 Ga0207651_10009803 3300025960 Bacteria 5269
441 Ga0207651_10017048 3300025960 Bacteria 4278
442 Ga0207651_10073766 3300025960 Bacteria 2427
443 Ga0207651_10080974 3300025960 Bacteria 2339
444 Ga0207651_10156141 3300025960 Bacteria 1783
445 Ga0207651_10914797 3300025960 Bacteria 782
446 Ga0207651_10953755 3300025960 Bacteria 765
447 Ga0207712_10008751 3300025961 Bacteria 6402
448 Ga0207712_10076124 3300025961 Bacteria 2428
449 Ga0207668_10002769 3300025972 Bacteria 10253
450 Ga0207668_10005307 3300025972 Bacteria 7583
451 Ga0207668_10010238 3300025972 Bacteria 5661
452 Ga0207668_10013784 3300025972 Bacteria 4988
453 Ga0207668_10171424 3300025972 Bacteria 1702
454 Ga0207668_10373334 3300025972 Bacteria 1198
455 Ga0207668_10921398 3300025972 Bacteria 778
456 Ga0207640_10016628 3300025981 Bacteria 4285
457 Ga0207640_10657743 3300025981 Bacteria 894
458 Ga0207658_10002750 3300025986 Bacteria 12689
459 Ga0207658_10078833 3300025986 Bacteria 2518
460 Ga0207658_10078909 3300025986 Bacteria 2517
461 Ga0207658_10110353 3300025986 Bacteria 2173
462 Ga0207658_10143550 3300025986 Bacteria 1935
463 Ga0207658_10183838 3300025986 Bacteria 1732
464 Ga0207658_10247729 3300025986 Bacteria 1512
465 Ga0207658_10485253 3300025986 Bacteria 1099
466 Ga0207677_10010440 3300026023 Bacteria 5254
467 Ga0207677_10025654 3300026023 Bacteria 3681
468 Ga0207677_10116465 3300026023 Bacteria 2001
469 Ga0207677_10304217 3300026023 Bacteria 1318
470 Ga0207677_10383657 3300026023 Bacteria 1187
471 Ga0207677_10749249 3300026023 Bacteria 870
472 Ga0207703_10002130 3300026035 Bacteria 17414
473 Ga0207703_10026631 3300026035 Bacteria 4553
474 Ga0207703_10030482 3300026035 Bacteria 4263
475 Ga0207703_10059243 3300026035 Bacteria 3127
476 Ga0207703_10061325 3300026035 Bacteria 3079
477 Ga0207703_11516323 3300026035 Bacteria 645
478 Ga0207639_10005406 3300026041 Bacteria 8640
479 Ga0207639_10025283 3300026041 Bacteria 4305
480 Ga0207639_10031271 3300026041 Bacteria 3911
481 Ga0207639_10107654 3300026041 Bacteria 2265
482 Ga0207639_10803940 3300026041 Bacteria 876
483 Ga0207639_11717291 3300026041 Unclassified 588
484 Ga0207678_10000667 3300026067 Bacteria 31484
485 Ga0207678_10029888 3300026067 Bacteria 4757
486 Ga0207678_10032127 3300026067 Bacteria 4576
487 Ga0207678_10054639 3300026067 Bacteria 3440
488 Ga0207708_10008568 3300026075 Bacteria 7566
489 Ga0207708_10438917 3300026075 Bacteria 1085
490 Ga0207708_10680954 3300026075 Bacteria 878
491 Ga0207708_10915500 3300026075 Bacteria 759
492 Ga0207702_10019353 3300026078 Bacteria 5634
493 Ga0207702_11241718 3300026078 Bacteria 739
494 Ga0207641_10017555 3300026088 Bacteria 5858
495 Ga0207641_10029865 3300026088 Bacteria 4509
496 Ga0207641_10072611 3300026088 Bacteria 2964
497 Ga0207641_10100800 3300026088 Bacteria 2544
498 Ga0207641_10205271 3300026088 Bacteria 1819
499 Ga0207641_10267507 3300026088 Bacteria 1603
500 Ga0207641_10357620 3300026088 Bacteria 1393
501 Ga0207641_10715265 3300026088 Bacteria 987
502 Ga0207648_10001949 3300026089 Bacteria 22555
503 Ga0207648_10004828 3300026089 Bacteria 13744
504 Ga0207648_10007280 3300026089 Bacteria 10910
505 Ga0207648_10016091 3300026089 Bacteria 6851
506 Ga0207648_10183211 3300026089 Bacteria 1854
507 Ga0207648_10298814 3300026089 Bacteria 1443
508 Ga0207648_11201408 3300026089 Bacteria 712
509 Ga0207676_10002144 3300026095 Bacteria 14263
510 Ga0207676_10002785 3300026095 Bacteria 12434
511 Ga0207676_10032022 3300026095 Bacteria 3958
512 Ga0207676_10054834 3300026095 Bacteria 3125
513 Ga0207674_10001682 3300026116 Bacteria 28412
514 Ga0207674_10356307 3300026116 Bacteria 1414
515 Ga0207675_100000515 3300026118 Bacteria 37539
516 Ga0207675_100033118 3300026118 Bacteria 4814
517 Ga0207675_100045920 3300026118 Bacteria 4080
518 Ga0207675_100179851 3300026118 Bacteria 2025
519 Ga0207675_100720894 3300026118 Unclassified 1007
520 Ga0207683_10000011 3300026121 Bacteria 140261
521 Ga0207683_10000384 3300026121 Bacteria 40812
522 Ga0207683_10000853 3300026121 Bacteria 27981
523 Ga0207683_10001221 3300026121 Bacteria 23317
524 Ga0207683_10009011 3300026121 Bacteria 8501
525 Ga0207683_10172610 3300026121 Bacteria 1959
526 Ga0207683_10345014 3300026121 Bacteria 1366
527 Ga0207683_10704067 3300026121 Bacteria 936
528 Ga0207683_10797385 3300026121 Bacteria 877
529 Ga0207698_10003568 3300026142 Bacteria 9386
530 Ga0207698_10108047 3300026142 Bacteria 2324
531 Ga0207698_10588067 3300026142 Bacteria 1096
532 Ga0207698_11663208 3300026142 Bacteria 654
533 Ga0210002_1030315 3300027617 Bacteria 897
534 Ga0209971_1011522 3300027682 Bacteria 2095
535 Ga0209998_10015932 3300027717 Unclassified 1579
536 Ga0209974_10013928 3300027876 Bacteria 2679
537 Ga0268266_10000550 3300028379 Bacteria 52292
538 Ga0268266_10006477 3300028379 Bacteria 10715
539 Ga0268266_10155288 3300028379 Bacteria 2066
540 Ga0268266_10239635 3300028379 Bacteria 1673
541 Ga0268265_10006209 3300028380 Bacteria 8096
542 Ga0268265_10065128 3300028380 Bacteria 2811
543 Ga0268265_10168700 3300028380 Bacteria 1868
544 Ga0268265_10318742 3300028380 Bacteria 1407
545 Ga0268264_10000825 3300028381 Bacteria 33267
546 Ga0268264_10011656 3300028381 Bacteria 7250
547 Ga0268264_10098757 3300028381 Bacteria 2532
548 Ga0268264_10308254 3300028381 Bacteria 1493
549 Ga0268264_10866203 3300028381 Bacteria 905
550 Ga0268264_10932149 3300028381 Bacteria 873
551 Ga0265337_1060079 3300028556 Bacteria 1054
552 Ga0265319_1005556 3300028563 Bacteria 6011
553 Ga0265319_1029755 3300028563 Bacteria 1915
554 Ga0265319_1060175 3300028563 Bacteria 1234
555 Ga0265334_10037790 3300028573 Unclassified 1902
556 Ga0265320_10002559 3300031240 Bacteria 12643
557 Ga0265320_10007847 3300031240 Bacteria 6590
558 Ga0265320_10093407 3300031240 Unclassified 1392
559 Ga0307408_100008399 3300031548 Bacteria 6817
560 Ga0307405_10007530 3300031731 Bacteria 5452
561 Ga0307413_10000069 3300031824 Bacteria 25469
562 Ga0307413_10572240 3300031824 Bacteria 920
563 Ga0307410_10035157 3300031852 Bacteria 3251
564 Ga0307406_10009872 3300031901 Bacteria 5372
565 Ga0307409_100000176 3300031995 Bacteria 24870
566 Ga0307416_100039177 3300032002 Bacteria 3666
567 Ga0307414_10164356 3300032004 Bacteria 1767
568 Ga0307415_100003537 3300032126 Bacteria 7968
569 Ga0373924_0018012 3300035410 Bacteria 2717
570 Ga0373931_0099417 3300035691 Bacteria 1634
571 Ga0373931_1078584 3300035691 Bacteria 546
572 Ga0373933_1191507 3300035724 Bacteria 502
573 Ga0373937_0033849 3300036401 Bacteria 4645
574 Ga0373937_1195172 3300036401 Bacteria 709
575 Ga0395900_0236583 3300037418 Bacteria 1834
576 Ga0436361_0288677 3300039447 Bacteria 5045
577 Ga0436361_0462490 3300039447 Bacteria 1662
578 Ga0451807_0379536 3300041486 Unclassified 964
579 Ga0451577_0526855 3300042876 Unclassified 1073
580 Ga0466969_0046836 3300044656 Bacteria 2142
581 Ga0466965_0038508 3300044683 Bacteria 2349
582 Ga0466965_0101389 3300044683 Bacteria 1472
583 Ga0466961_0009600 3300044693 Bacteria 6159
584 Ga0466959_0009776 3300045049 Bacteria 6832
585 Ga0451576_0001536 3300045051 Bacteria 38840
586 Ga0495621_0038823 3300046539 Bacteria 1663
587 Ga0495647_0252620 3300046681 Bacteria 785
588 Ga0495613_0761308 3300046689 Bacteria 634
589 Ga0496100_0103604 3300048903 Bacteria 1965
590 Ga0496101_0118882 3300048904 Bacteria 1996
591 Ga0496101_0900928 3300048904 Bacteria 696
592 Ga0496102_0006121 3300048905 Bacteria 10254
593 Ga0496102_0225458 3300048905 Bacteria 1767
594 Ga0496102_0402426 3300048905 Bacteria 1287
595 Ga0496103_0038791 3300048906 Bacteria 2925
596 Ga0496104_0025710 3300048907 Bacteria 5430
597 Ga0496104_0536474 3300048907 Bacteria 1081
598 Ga0496105_0017692 3300048908 Bacteria 5719
599 Ga0496105_0490047 3300048908 Bacteria 966
600 Ga0496106_0000409 3300048909 Bacteria 30485
601 Ga0496106_0233368 3300048909 Bacteria 1469
602 Ga0496106_0322021 3300048909 Bacteria 1241
603 Ga0496106_0496743 3300048909 Bacteria 980
604 Ga0496107_0174879 3300048910 Bacteria 1594
605 Ga0496108_0001057 3300048911 Bacteria 21487
606 Ga0496108_0228885 3300048911 Bacteria 1616
607 Ga0496108_0362954 3300048911 Bacteria 1264
608 Ga0496109_0003127 3300048912 Bacteria 13811
609 Ga0496109_0092882 3300048912 Bacteria 2791
610 Ga0496109_0154269 3300048912 Bacteria 2151
611 Ga0496110_0116119 3300048913 Bacteria 2409
612 Ga0496111_0654617 3300048914 Bacteria 766
613 Ga0496112_0001083 3300048915 Bacteria 20143
614 Ga0496114_0029086 3300048917 Bacteria 4539
615 Ga0496115_0005629 3300048918 Bacteria 9115
616 Ga0496122_0000349 3300048925 Bacteria 99749
617 Ga0496125_0034014 3300048928 Bacteria 4499
618 Ga0496126_0000424 3300048929 Bacteria 85019
619 Ga0496126_0385524 3300048929 Bacteria 1140
620 Ga0501033_0044240 3300049570 Bacteria 3315
621 Ga0501033_0096269 3300049570 Bacteria 2163
622 Ga0501036_0007376 3300049572 Bacteria 8959
623 Ga0501036_0208815 3300049572 Bacteria 1641
624 Ga0501036_1574176 3300049572 Bacteria 531
625 Ga0501037_0265816 3300049573 Bacteria 1198
626 Ga0501038_0013332 3300049574 Bacteria 7497
627 Ga0501038_0085251 3300049574 Bacteria 2657
628 Ga0501038_0427332 3300049574 Bacteria 1021
629 Ga0501039_0073742 3300049575 Bacteria 2652
630 Ga0501039_0272929 3300049575 Unclassified 1329
631 Ga0501040_0015955 3300049576 Bacteria 4967
632 Ga0501040_0021361 3300049576 Bacteria 4323
633 Ga0501040_0137385 3300049576 Bacteria 1721
634 Ga0501041_0030161 3300049577 Bacteria 3273
635 Ga0501041_0206623 3300049577 Bacteria 1231
636 Ga0501042_0024438 3300049578 Bacteria 4238
637 Ga0501042_0030042 3300049578 Bacteria 3837
638 Ga0501046_0169672 3300049580 Unclassified 1638
639 Ga0501046_0170676 3300049580 Bacteria 1633
640 Ga0501046_0262263 3300049580 Bacteria 1269
641 Ga0501068_0147349 3300049584 Unclassified 1478
642 Ga0501068_0632150 3300049584 Bacteria 698
643 Ga0501069_0147501 3300049585 Bacteria 1351
644 Ga0501071_0065086 3300049587 Bacteria 2646
645 Ga0501071_0505689 3300049587 Bacteria 927
646 Ga0501072_0005767 3300049588 Bacteria 9425
647 Ga0501072_0008319 3300049588 Bacteria 7880
648 Ga0501072_0788366 3300049588 Bacteria 745
649 Ga0501072_0923490 3300049588 Unclassified 681
650 Ga0501073_0042806 3300049589 Bacteria 3195
651 Ga0501074_0028699 3300049590 Bacteria 4033
652 Ga0501075_0000774 3300049591 Bacteria 19960
653 Ga0501075_0162074 3300049591 Bacteria 1706
654 Ga0501075_0746996 3300049591 Bacteria 745
655 Ga0501075_1012688 3300049591 Unclassified 631
656 Ga0501076_0000617 3300049592 Bacteria 22782
657 Ga0501076_0228688 3300049592 Bacteria 1520
658 Ga0501076_0338255 3300049592 Unclassified 1235
659 Ga0501076_0606429 3300049592 Bacteria 903
660 Ga0501077_0024814 3300049593 Bacteria 3807
661 Ga0501079_0024346 3300049741 Bacteria 4644
662 Ga0501079_0151202 3300049741 Bacteria 1810
663 Ga0501079_0161483 3300049741 Bacteria 1747
664 Ga0501080_0043343 3300049742 Bacteria 4190
665 Ga0501080_0056792 3300049742 Bacteria 3644
666 Ga0501080_0291724 3300049742 Bacteria 1481
667 Ga0501081_0003594 3300049743 Bacteria 9920
668 Ga0501081_0017426 3300049743 Bacteria 4754
669 Ga0501081_0129377 3300049743 Bacteria 1803
670 Ga0501081_0280655 3300049743 Unclassified 1219
671 Ga0501083_0022447 3300049744 Bacteria 4380
672 Ga0501035_0239450 3300049822 Unclassified 1544
673 Ga0501044_0404732 3300049823 Bacteria 1277
674 Ga0501045_0073879 3300049824 Bacteria 2511
675 Ga0501045_1241874 3300049824 Bacteria 543
676 nmdc:mga05p37_186212_c1 3300050507 Bacteria 2524
677 nmdc:mga09592_168747_c1 3300050508 Bacteria 1892
678 nmdc:mga08y16_21282_c1 3300050511 Bacteria 6847
679 nmdc:mga0rr50_1132969_c1 3300050513 Bacteria 665
680 nmdc:mga0rr50_201760_c1 3300050513 Bacteria 1634
681 nmdc:mga0rr50_277349_c1 3300050513 Bacteria 1398
682 nmdc:mga0a205_295178_c1 3300050515 Bacteria 1494
683 Ga0500568_0008930 3300053139 Bacteria 4795
684 Ga0501084_0001469 3300054114 Bacteria 18716
685 Ga0501084_0018583 3300054114 Bacteria 5785
686 Ga0501084_0230859 3300054114 Bacteria 1562
687 Ga0501084_1758054 3300054114 Bacteria 518
688 Ga0501082_0047446 3300060353 Bacteria 3701
689 Ga0501082_0410547 3300060353 Unclassified 1182
690 Ga0530510_0000010 3300061734 Bacteria 155647
691 Ga0530510_0038671 3300061734 Bacteria 3445
692 Ga0530510_0571148 3300061734 Unclassified 859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100001756 Ga0075431_1000017568 114
2 3300006880 Ga0075429_100742147 Ga0075429_1007421471 114
3 3300005355 Ga0070671_100928401 Ga0070671_1009284011 119
4 3300003322 rootL2_10008994 rootL2_100089943 120
5 3300005331 Ga0070670_100146918 Ga0070670_1001469182 120
6 3300027617 Ga0210002_1030315 Ga0210002_10303152 120
7 3300027717 Ga0209998_10015932 Ga0209998_100159322 120
8 3300027876 Ga0209974_10013928 Ga0209974_100139282 120
9 3300050508 nmdc:mga09592_168747_c1 nmdc:mga09592_168747_c1_79_507 121
10 3300005293 Ga0065715_10127025 Ga0065715_101270252 123
11 3300005330 Ga0070690_100000254 Ga0070690_10000025427 123
12 3300005336 Ga0070680_100012964 Ga0070680_1000129643 123
13 3300005344 Ga0070661_100000643 Ga0070661_1000006434 123
14 3300005347 Ga0070668_100007959 Ga0070668_1000079593 123
15 3300005365 Ga0070688_100001006 Ga0070688_10000100614 123
16 3300005441 Ga0070700_100012529 Ga0070700_1000125292 123
17 3300005455 Ga0070663_100002485 Ga0070663_1000024854 123
18 3300005466 Ga0070685_10005161 Ga0070685_100051613 123
19 3300005530 Ga0070679_100114144 Ga0070679_1001141442 123
20 3300005549 Ga0070704_100020733 Ga0070704_1000207333 123
21 3300005840 Ga0068870_10028032 Ga0068870_100280321 123
22 3300009174 Ga0105241_10001658 Ga0105241_100016587 123
23 3300013100 Ga0157373_10007450 Ga0157373_100074503 123
24 3300013297 Ga0157378_10005924 Ga0157378_100059243 123
25 3300025893 Ga0207682_10000138 Ga0207682_1000013820 123
26 3300025899 Ga0207642_10019098 Ga0207642_100190983 123
27 3300025907 Ga0207645_10000937 Ga0207645_1000093725 123
28 3300025911 Ga0207654_10001503 Ga0207654_100015033 123
29 3300025917 Ga0207660_10016036 Ga0207660_100160367 123
30 3300025921 Ga0207652_10226834 Ga0207652_102268342 123
31 3300025931 Ga0207644_10004192 Ga0207644_1000419211 123
32 3300025936 Ga0207670_10001364 Ga0207670_100013643 123
33 3300025972 Ga0207668_10010238 Ga0207668_100102382 123
34 3300026067 Ga0207678_10000667 Ga0207678_1000066716 123
35 3300026075 Ga0207708_10008568 Ga0207708_100085683 123
36 3300028380 Ga0268265_10006209 Ga0268265_100062093 123
37 3300035410 Ga0373924_0018012 Ga0373924_0018012_332_814 125
38 3300046689 Ga0495613_0761308 Ga0495613_0761308_128_610 125
39 3300049588 Ga0501072_0923490 Ga0501072_0923490_19_447 125
40 iso_pu_bacteria 2858438669 2858439472 127
41 3300005335 Ga0070666_10046621 Ga0070666_100466212 128
42 3300005338 Ga0068868_100834400 Ga0068868_1008344002 128
43 3300005347 Ga0070668_101606984 Ga0070668_1016069841 128
44 3300005353 Ga0070669_100320194 Ga0070669_1003201942 128
45 3300005364 Ga0070673_100040168 Ga0070673_1000401684 128
46 3300005365 Ga0070688_100659285 Ga0070688_1006592851 128
47 3300005457 Ga0070662_100067819 Ga0070662_1000678192 128
48 3300005543 Ga0070672_100088031 Ga0070672_1000880313 128
49 3300005548 Ga0070665_100544117 Ga0070665_1005441172 128
50 3300005616 Ga0068852_101771349 Ga0068852_1017713492 128
51 3300005841 Ga0068863_100138677 Ga0068863_1001386773 128
52 3300005841 Ga0068863_100258902 Ga0068863_1002589022 128
53 3300009098 Ga0105245_11072750 Ga0105245_110727501 128
54 3300009177 Ga0105248_10013927 Ga0105248_100139278 128
55 3300013297 Ga0157378_10219989 Ga0157378_102199892 128
56 3300013297 Ga0157378_10762999 Ga0157378_107629992 128
57 3300013306 Ga0163162_10339488 Ga0163162_103394882 128
58 3300025903 Ga0207680_10046982 Ga0207680_100469822 128
59 3300025910 Ga0207684_10294702 Ga0207684_102947021 128
60 3300025931 Ga0207644_10689801 Ga0207644_106898011 128
61 3300025933 Ga0207706_10187655 Ga0207706_101876553 128
62 3300025940 Ga0207691_10095935 Ga0207691_100959353 128
63 3300025941 Ga0207711_10011342 Ga0207711_100113424 128
64 3300025949 Ga0207667_12001638 Ga0207667_120016381 128
65 3300025960 Ga0207651_10009803 Ga0207651_100098033 128
66 3300026023 Ga0207677_10749249 Ga0207677_107492491 128
67 3300026078 Ga0207702_11241718 Ga0207702_112417182 128
68 3300026088 Ga0207641_10100800 Ga0207641_101008002 128
69 3300026142 Ga0207698_10588067 Ga0207698_105880672 128
70 3300031824 Ga0307413_10000069 Ga0307413_1000006915 128
71 3300048905 Ga0496102_0402426 Ga0496102_0402426_691_1131 128
72 3300048909 Ga0496106_0322021 Ga0496106_0322021_539_976 128
73 3300048909 Ga0496106_0496743 Ga0496106_0496743_55_495 128
74 3300048910 Ga0496107_0174879 Ga0496107_0174879_597_1034 128
75 3300048917 Ga0496114_0029086 Ga0496114_0029086_3121_3558 128
76 3300048918 Ga0496115_0005629 Ga0496115_0005629_4622_5059 128
77 iso_pu_bacteria 2547132103 2547376268 128
78 iso_pu_bacteria 2846033681 2846036951 128
79 iso_pu_bacteria 2890804823 2890805723 128
80 iso_pu_bacteria 2998344455 2998346260 128
81 3300010375 Ga0105239_10960238 Ga0105239_109602382 129
82 3300035724 Ga0373933_1191507 Ga0373933_1191507_43_486 129
83 iso_pu_bacteria 2739367866 2740031187 129
84 3300009553 Ga0105249_11793894 Ga0105249_117938942 130
85 3300013100 Ga0157373_10419366 Ga0157373_104193661 130
86 3300050515 nmdc:mga0a205_295178_c1 nmdc:mga0a205_295178_c1_1038_1484 130
87 3300045051 Ga0451576_0001536 Ga0451576_0001536_35635_36105 131
88 3300050513 nmdc:mga0rr50_277349_c1 nmdc:mga0rr50_277349_c1_167_616 131
89 3300002077 JGI24744J21845_10057323 JGI24744J21845_100573231 132
90 3300005327 Ga0070658_10172152 Ga0070658_101721523 132
91 3300005328 Ga0070676_10000863 Ga0070676_100008633 132
92 3300005328 Ga0070676_10060443 Ga0070676_100604432 132
93 3300005328 Ga0070676_10135230 Ga0070676_101352303 132
94 3300005328 Ga0070676_10283994 Ga0070676_102839942 132
95 3300005330 Ga0070690_100041406 Ga0070690_1000414062 132
96 3300005331 Ga0070670_100021410 Ga0070670_1000214104 132
97 3300005331 Ga0070670_100031963 Ga0070670_1000319635 132
98 3300005331 Ga0070670_100048424 Ga0070670_1000484244 132
99 3300005333 Ga0070677_10005597 Ga0070677_100055975 132
100 3300005333 Ga0070677_10086811 Ga0070677_100868112 132
101 3300005333 Ga0070677_10110339 Ga0070677_101103392 132
102 3300005333 Ga0070677_10110441 Ga0070677_101104412 132
103 3300005334 Ga0068869_100004811 Ga0068869_1000048116 132
104 3300005334 Ga0068869_100017187 Ga0068869_1000171875 132
105 3300005335 Ga0070666_10001671 Ga0070666_100016717 132
106 3300005335 Ga0070666_10001828 Ga0070666_100018289 132
107 3300005335 Ga0070666_10005351 Ga0070666_100053514 132
108 3300005335 Ga0070666_10119358 Ga0070666_101193583 132
109 3300005338 Ga0068868_100003034 Ga0068868_1000030346 132
110 3300005338 Ga0068868_100011587 Ga0068868_1000115871 132
111 3300005338 Ga0068868_100125181 Ga0068868_1001251812 132
112 3300005338 Ga0068868_100144318 Ga0068868_1001443183 132
113 3300005338 Ga0068868_100447077 Ga0068868_1004470772 132
114 3300005338 Ga0068868_101415740 Ga0068868_1014157402 132
115 3300005339 Ga0070660_100139936 Ga0070660_1001399362 132
116 3300005339 Ga0070660_100194786 Ga0070660_1001947863 132
117 3300005339 Ga0070660_100423132 Ga0070660_1004231322 132
118 3300005340 Ga0070689_100047971 Ga0070689_1000479713 132
119 3300005344 Ga0070661_100073100 Ga0070661_1000731003 132
120 3300005347 Ga0070668_100001229 Ga0070668_1000012297 132
121 3300005347 Ga0070668_100007445 Ga0070668_1000074455 132
122 3300005347 Ga0070668_100044979 Ga0070668_1000449793 132
123 3300005347 Ga0070668_100077720 Ga0070668_1000777203 132
124 3300005347 Ga0070668_100083890 Ga0070668_1000838904 132
125 3300005347 Ga0070668_100422832 Ga0070668_1004228322 132
126 3300005353 Ga0070669_100003246 Ga0070669_10000324611 132
127 3300005353 Ga0070669_100038686 Ga0070669_1000386863 132
128 3300005353 Ga0070669_100233945 Ga0070669_1002339452 132
129 3300005353 Ga0070669_100460075 Ga0070669_1004600752 132
130 3300005354 Ga0070675_100008402 Ga0070675_1000084026 132
131 3300005354 Ga0070675_100023911 Ga0070675_1000239115 132
132 3300005354 Ga0070675_100698817 Ga0070675_1006988172 132
133 3300005355 Ga0070671_100002283 Ga0070671_10000228313 132
134 3300005355 Ga0070671_100041328 Ga0070671_1000413283 132
135 3300005355 Ga0070671_100113027 Ga0070671_1001130272 132
136 3300005355 Ga0070671_100815349 Ga0070671_1008153492 132
137 3300005356 Ga0070674_100001737 Ga0070674_10000173710 132
138 3300005356 Ga0070674_100005812 Ga0070674_1000058126 132
139 3300005356 Ga0070674_100012649 Ga0070674_1000126491 132
140 3300005356 Ga0070674_100031258 Ga0070674_1000312584 132
141 3300005364 Ga0070673_100000414 Ga0070673_10000041415 132
142 3300005364 Ga0070673_100015663 Ga0070673_1000156638 132
143 3300005364 Ga0070673_100022281 Ga0070673_1000222812 132
144 3300005364 Ga0070673_100665568 Ga0070673_1006655682 132
145 3300005365 Ga0070688_100004036 Ga0070688_1000040362 132
146 3300005365 Ga0070688_100027642 Ga0070688_1000276425 132
147 3300005365 Ga0070688_100043539 Ga0070688_1000435393 132
148 3300005365 Ga0070688_100572395 Ga0070688_1005723951 132
149 3300005366 Ga0070659_100069794 Ga0070659_1000697943 132
150 3300005366 Ga0070659_100106115 Ga0070659_1001061153 132
151 3300005366 Ga0070659_100629752 Ga0070659_1006297521 132
152 3300005367 Ga0070667_100007580 Ga0070667_10000758010 132
153 3300005367 Ga0070667_100026742 Ga0070667_1000267425 132
154 3300005367 Ga0070667_100142227 Ga0070667_1001422273 132
155 3300005367 Ga0070667_100218604 Ga0070667_1002186042 132
156 3300005438 Ga0070701_10639072 Ga0070701_106390722 132
157 3300005441 Ga0070700_100396220 Ga0070700_1003962201 132
158 3300005441 Ga0070700_100710645 Ga0070700_1007106451 132
159 3300005445 Ga0070708_100004283 Ga0070708_1000042837 132
160 3300005445 Ga0070708_100736977 Ga0070708_1007369771 132
161 3300005455 Ga0070663_100017090 Ga0070663_1000170907 132
162 3300005455 Ga0070663_100036402 Ga0070663_1000364024 132
163 3300005455 Ga0070663_100695364 Ga0070663_1006953642 132
164 3300005456 Ga0070678_100000991 Ga0070678_10000099112 132
165 3300005456 Ga0070678_100004553 Ga0070678_1000045538 132
166 3300005456 Ga0070678_100047823 Ga0070678_1000478232 132
167 3300005456 Ga0070678_100126761 Ga0070678_1001267612 132
168 3300005457 Ga0070662_100052544 Ga0070662_1000525443 132
169 3300005457 Ga0070662_100206154 Ga0070662_1002061543 132
170 3300005459 Ga0068867_100004322 Ga0068867_1000043225 132
171 3300005459 Ga0068867_100020893 Ga0068867_1000208933 132
172 3300005459 Ga0068867_100095707 Ga0068867_1000957072 132
173 3300005459 Ga0068867_101145928 Ga0068867_1011459281 132
174 3300005466 Ga0070685_10021601 Ga0070685_100216013 132
175 3300005466 Ga0070685_10636688 Ga0070685_106366881 132
176 3300005468 Ga0070707_101242737 Ga0070707_1012427371 132
177 3300005471 Ga0070698_100048873 Ga0070698_1000488737 132
178 3300005530 Ga0070679_100245648 Ga0070679_1002456481 132
179 3300005539 Ga0068853_100005722 Ga0068853_10000572210 132
180 3300005539 Ga0068853_100012941 Ga0068853_1000129416 132
181 3300005539 Ga0068853_100067276 Ga0068853_1000672762 132
182 3300005543 Ga0070672_100006664 Ga0070672_1000066647 132
183 3300005543 Ga0070672_100014912 Ga0070672_1000149122 132
184 3300005543 Ga0070672_100073278 Ga0070672_1000732783 132
185 3300005543 Ga0070672_100121847 Ga0070672_1001218472 132
186 3300005543 Ga0070672_100403869 Ga0070672_1004038692 132
187 3300005543 Ga0070672_100651265 Ga0070672_1006512652 132
188 3300005544 Ga0070686_100030138 Ga0070686_1000301384 132
189 3300005546 Ga0070696_100439874 Ga0070696_1004398742 132
190 3300005547 Ga0070693_100085913 Ga0070693_1000859132 132
191 3300005548 Ga0070665_100003513 Ga0070665_1000035135 132
192 3300005548 Ga0070665_100013407 Ga0070665_1000134078 132
193 3300005548 Ga0070665_100032630 Ga0070665_1000326305 132
194 3300005548 Ga0070665_100050694 Ga0070665_1000506943 132
195 3300005548 Ga0070665_100108051 Ga0070665_1001080512 132
196 3300005563 Ga0068855_100001160 Ga0068855_1000011608 132
197 3300005564 Ga0070664_100308092 Ga0070664_1003080923 132
198 3300005578 Ga0068854_100112335 Ga0068854_1001123352 132
199 3300005578 Ga0068854_100747313 Ga0068854_1007473132 132
200 3300005614 Ga0068856_100001343 Ga0068856_1000013438 132
201 3300005615 Ga0070702_100013314 Ga0070702_1000133142 132
202 3300005616 Ga0068852_100003709 Ga0068852_1000037095 132
203 3300005616 Ga0068852_100032324 Ga0068852_1000323244 132
204 3300005617 Ga0068859_100041674 Ga0068859_1000416746 132
205 3300005617 Ga0068859_100069797 Ga0068859_1000697974 132
206 3300005617 Ga0068859_100097073 Ga0068859_1000970734 132
207 3300005618 Ga0068864_100004730 Ga0068864_1000047303 132
208 3300005618 Ga0068864_100061299 Ga0068864_1000612992 132
209 3300005618 Ga0068864_100389993 Ga0068864_1003899931 132
210 3300005618 Ga0068864_100777627 Ga0068864_1007776272 132
211 3300005718 Ga0068866_10030711 Ga0068866_100307112 132
212 3300005718 Ga0068866_10075967 Ga0068866_100759673 132
213 3300005719 Ga0068861_100492390 Ga0068861_1004923902 132
214 3300005834 Ga0068851_10000963 Ga0068851_100009635 132
215 3300005834 Ga0068851_10046690 Ga0068851_100466902 132
216 3300005840 Ga0068870_10006113 Ga0068870_100061133 132
217 3300005840 Ga0068870_10017256 Ga0068870_100172563 132
218 3300005841 Ga0068863_100003538 Ga0068863_10000353811 132
219 3300005841 Ga0068863_100265404 Ga0068863_1002654042 132
220 3300005841 Ga0068863_101547362 Ga0068863_1015473622 132
221 3300005842 Ga0068858_100012953 Ga0068858_10001295310 132
222 3300005842 Ga0068858_100033176 Ga0068858_1000331763 132
223 3300005842 Ga0068858_100227140 Ga0068858_1002271403 132
224 3300005842 Ga0068858_100283434 Ga0068858_1002834342 132
225 3300005843 Ga0068860_100003702 Ga0068860_10000370215 132
226 3300005843 Ga0068860_100037793 Ga0068860_1000377934 132
227 3300005843 Ga0068860_100130644 Ga0068860_1001306443 132
228 3300005843 Ga0068860_100166075 Ga0068860_1001660753 132
229 3300005843 Ga0068860_100675623 Ga0068860_1006756232 132
230 3300005843 Ga0068860_100745160 Ga0068860_1007451602 132
231 3300005843 Ga0068860_101322608 Ga0068860_1013226081 132
232 3300005844 Ga0068862_100007500 Ga0068862_1000075006 132
233 3300005844 Ga0068862_100057292 Ga0068862_1000572921 132
234 3300005844 Ga0068862_100391974 Ga0068862_1003919742 132
235 3300005844 Ga0068862_101447804 Ga0068862_1014478042 132
236 3300006237 Ga0097621_100063629 Ga0097621_1000636294 132
237 3300006237 Ga0097621_100083808 Ga0097621_1000838083 132
238 3300006358 Ga0068871_100063970 Ga0068871_1000639703 132
239 3300006358 Ga0068871_100729039 Ga0068871_1007290392 132
240 3300006871 Ga0075434_102471695 Ga0075434_1024716951 132
241 3300006881 Ga0068865_100019461 Ga0068865_1000194613 132
242 3300006881 Ga0068865_100032504 Ga0068865_1000325045 132
243 3300006881 Ga0068865_100177225 Ga0068865_1001772253 132
244 3300006931 Ga0097620_100041675 Ga0097620_1000416756 132
245 3300006931 Ga0097620_100069799 Ga0097620_1000697994 132
246 3300006931 Ga0097620_100097069 Ga0097620_1000970694 132
247 3300007076 Ga0075435_100098057 Ga0075435_1000980573 132
248 3300009093 Ga0105240_10005624 Ga0105240_1000562417 132
249 3300009094 Ga0111539_10025183 Ga0111539_100251835 132
250 3300009094 Ga0111539_10204997 Ga0111539_102049974 132
251 3300009094 Ga0111539_12788867 Ga0111539_127888672 132
252 3300009098 Ga0105245_10105468 Ga0105245_101054685 132
253 3300009098 Ga0105245_10624336 Ga0105245_106243362 132
254 3300009098 Ga0105245_10898295 Ga0105245_108982952 132
255 3300009101 Ga0105247_10156147 Ga0105247_101561473 132
256 3300009147 Ga0114129_10414974 Ga0114129_104149742 132
257 3300009147 Ga0114129_11774213 Ga0114129_117742132 132
258 3300009147 Ga0114129_11882190 Ga0114129_118821902 132
259 3300009148 Ga0105243_10187132 Ga0105243_101871322 132
260 3300009176 Ga0105242_10309470 Ga0105242_103094703 132
261 3300009177 Ga0105248_10010465 Ga0105248_100104655 132
262 3300009177 Ga0105248_10200961 Ga0105248_102009613 132
263 3300009545 Ga0105237_10032311 Ga0105237_100323112 132
264 3300009551 Ga0105238_12481268 Ga0105238_124812681 132
265 3300010375 Ga0105239_10480027 Ga0105239_104800273 132
266 3300011119 Ga0105246_10544670 Ga0105246_105446702 132
267 3300013100 Ga0157373_10000447 Ga0157373_1000044731 132
268 3300013102 Ga0157371_10018417 Ga0157371_100184174 132
269 3300013102 Ga0157371_10160434 Ga0157371_101604342 132
270 3300013105 Ga0157369_10038923 Ga0157369_100389233 132
271 3300013296 Ga0157374_10000252 Ga0157374_1000025236 132
272 3300013296 Ga0157374_10067000 Ga0157374_100670003 132
273 3300013296 Ga0157374_10086982 Ga0157374_100869823 132
274 3300013296 Ga0157374_10171910 Ga0157374_101719103 132
275 3300013297 Ga0157378_10015035 Ga0157378_100150352 132
276 3300013297 Ga0157378_10024959 Ga0157378_100249597 132
277 3300013297 Ga0157378_10085314 Ga0157378_100853142 132
278 3300013297 Ga0157378_10225493 Ga0157378_102254932 132
279 3300013297 Ga0157378_10548946 Ga0157378_105489461 132
280 3300013306 Ga0163162_10022758 Ga0163162_100227585 132
281 3300013306 Ga0163162_10334248 Ga0163162_103342482 132
282 3300013306 Ga0163162_10503627 Ga0163162_105036272 132
283 3300013306 Ga0163162_10594898 Ga0163162_105948983 132
284 3300013307 Ga0157372_10013135 Ga0157372_100131355 132
285 3300013307 Ga0157372_11199566 Ga0157372_111995662 132
286 3300013307 Ga0157372_12098343 Ga0157372_120983431 132
287 3300013308 Ga0157375_10000991 Ga0157375_1000099111 132
288 3300013308 Ga0157375_10071615 Ga0157375_100716152 132
289 3300013308 Ga0157375_10080968 Ga0157375_100809683 132
290 3300013308 Ga0157375_11437439 Ga0157375_114374392 132
291 3300013308 Ga0157375_11448899 Ga0157375_114488992 132
292 3300014325 Ga0163163_10075762 Ga0163163_100757624 132
293 3300014325 Ga0163163_10208325 Ga0163163_102083252 132
294 3300014325 Ga0163163_10444837 Ga0163163_104448371 132
295 3300014325 Ga0163163_10787718 Ga0163163_107877182 132
296 3300014745 Ga0157377_10012946 Ga0157377_100129464 132
297 3300014968 Ga0157379_10006850 Ga0157379_100068501 132
298 3300014968 Ga0157379_10044808 Ga0157379_100448085 132
299 3300014969 Ga0157376_10008365 Ga0157376_100083653 132
300 3300014969 Ga0157376_10089712 Ga0157376_100897121 132
301 3300014969 Ga0157376_10121182 Ga0157376_101211823 132
302 3300014969 Ga0157376_10196776 Ga0157376_101967763 132
303 3300017792 Ga0163161_10007813 Ga0163161_100078136 132
304 3300017792 Ga0163161_10387947 Ga0163161_103879472 132
305 3300017792 Ga0163161_11530291 Ga0163161_115302912 132
306 3300021361 Ga0213872_10005063 Ga0213872_100050635 132
307 3300021361 Ga0213872_10334219 Ga0213872_103342191 132
308 3300025315 Ga0207697_10000594 Ga0207697_100005944 132
309 3300025315 Ga0207697_10030086 Ga0207697_100300863 132
310 3300025315 Ga0207697_10126564 Ga0207697_101265642 132
311 3300025315 Ga0207697_10146031 Ga0207697_101460312 132
312 3300025315 Ga0207697_10169298 Ga0207697_101692982 132
313 3300025321 Ga0207656_10055084 Ga0207656_100550842 132
314 3300025893 Ga0207682_10000556 Ga0207682_100005562 132
315 3300025893 Ga0207682_10001173 Ga0207682_1000117312 132
316 3300025899 Ga0207642_10054452 Ga0207642_100544522 132
317 3300025899 Ga0207642_10150718 Ga0207642_101507182 132
318 3300025901 Ga0207688_10102128 Ga0207688_101021282 132
319 3300025901 Ga0207688_10147854 Ga0207688_101478541 132
320 3300025901 Ga0207688_10430506 Ga0207688_104305062 132
321 3300025901 Ga0207688_10574751 Ga0207688_105747512 132
322 3300025903 Ga0207680_10002377 Ga0207680_100023777 132
323 3300025903 Ga0207680_10002438 Ga0207680_100024385 132
324 3300025903 Ga0207680_10021666 Ga0207680_100216663 132
325 3300025903 Ga0207680_10069013 Ga0207680_100690133 132
326 3300025903 Ga0207680_10580407 Ga0207680_105804072 132
327 3300025907 Ga0207645_10001033 Ga0207645_1000103313 132
328 3300025907 Ga0207645_10004215 Ga0207645_100042157 132
329 3300025907 Ga0207645_10013012 Ga0207645_100130127 132
330 3300025908 Ga0207643_10005125 Ga0207643_100051256 132
331 3300025908 Ga0207643_10568563 Ga0207643_105685632 132
332 3300025909 Ga0207705_10933583 Ga0207705_109335832 132
333 3300025913 Ga0207695_10215201 Ga0207695_102152012 132
334 3300025914 Ga0207671_10036871 Ga0207671_100368712 132
335 3300025914 Ga0207671_10736990 Ga0207671_107369902 132
336 3300025918 Ga0207662_10008271 Ga0207662_100082711 132
337 3300025919 Ga0207657_10000709 Ga0207657_1000070932 132
338 3300025919 Ga0207657_10171353 Ga0207657_101713533 132
339 3300025919 Ga0207657_10528478 Ga0207657_105284781 132
340 3300025920 Ga0207649_10100338 Ga0207649_101003383 132
341 3300025923 Ga0207681_10025488 Ga0207681_100254884 132
342 3300025923 Ga0207681_10117265 Ga0207681_101172651 132
343 3300025923 Ga0207681_10316163 Ga0207681_103161632 132
344 3300025923 Ga0207681_11074910 Ga0207681_110749101 132
345 3300025925 Ga0207650_10042617 Ga0207650_100426174 132
346 3300025925 Ga0207650_10047375 Ga0207650_100473753 132
347 3300025925 Ga0207650_10191071 Ga0207650_101910712 132
348 3300025925 Ga0207650_10540398 Ga0207650_105403982 132
349 3300025926 Ga0207659_10009398 Ga0207659_100093988 132
350 3300025926 Ga0207659_10033517 Ga0207659_100335173 132
351 3300025931 Ga0207644_10002884 Ga0207644_1000288413 132
352 3300025931 Ga0207644_10050284 Ga0207644_100502843 132
353 3300025931 Ga0207644_10055446 Ga0207644_100554462 132
354 3300025931 Ga0207644_10251091 Ga0207644_102510913 132
355 3300025931 Ga0207644_10483028 Ga0207644_104830281 132
356 3300025931 Ga0207644_10889068 Ga0207644_108890681 132
357 3300025931 Ga0207644_11238853 Ga0207644_112388532 132
358 3300025932 Ga0207690_10003165 Ga0207690_100031654 132
359 3300025932 Ga0207690_10077275 Ga0207690_100772752 132
360 3300025932 Ga0207690_10627993 Ga0207690_106279932 132
361 3300025933 Ga0207706_10000002 Ga0207706_100000027 132
362 3300025933 Ga0207706_10030107 Ga0207706_100301072 132
363 3300025936 Ga0207670_10033653 Ga0207670_100336534 132
364 3300025936 Ga0207670_10054237 Ga0207670_100542373 132
365 3300025937 Ga0207669_10003338 Ga0207669_100033384 132
366 3300025937 Ga0207669_10029177 Ga0207669_100291772 132
367 3300025937 Ga0207669_10478623 Ga0207669_104786231 132
368 3300025938 Ga0207704_10022409 Ga0207704_100224094 132
369 3300025938 Ga0207704_10028008 Ga0207704_100280084 132
370 3300025938 Ga0207704_10840076 Ga0207704_108400762 132
371 3300025940 Ga0207691_10000006 Ga0207691_1000000644 132
372 3300025940 Ga0207691_10010710 Ga0207691_100107105 132
373 3300025940 Ga0207691_10031258 Ga0207691_100312583 132
374 3300025940 Ga0207691_10044324 Ga0207691_100443242 132
375 3300025940 Ga0207691_10071692 Ga0207691_100716922 132
376 3300025940 Ga0207691_10090772 Ga0207691_100907723 132
377 3300025940 Ga0207691_10219015 Ga0207691_102190152 132
378 3300025940 Ga0207691_10765706 Ga0207691_107657061 132
379 3300025941 Ga0207711_10017206 Ga0207711_100172062 132
380 3300025941 Ga0207711_10767160 Ga0207711_107671602 132
381 3300025942 Ga0207689_10008383 Ga0207689_100083835 132
382 3300025942 Ga0207689_10044818 Ga0207689_100448184 132
383 3300025945 Ga0207679_10154583 Ga0207679_101545833 132
384 3300025949 Ga0207667_10003619 Ga0207667_1000361921 132
385 3300025960 Ga0207651_10017048 Ga0207651_100170484 132
386 3300025960 Ga0207651_10073766 Ga0207651_100737664 132
387 3300025960 Ga0207651_10080974 Ga0207651_100809743 132
388 3300025960 Ga0207651_10156141 Ga0207651_101561411 132
389 3300025960 Ga0207651_10914797 Ga0207651_109147972 132
390 3300025960 Ga0207651_10953755 Ga0207651_109537552 132
391 3300025961 Ga0207712_10076124 Ga0207712_100761242 132
392 3300025972 Ga0207668_10002769 Ga0207668_1000276911 132
393 3300025972 Ga0207668_10005307 Ga0207668_100053079 132
394 3300025972 Ga0207668_10013784 Ga0207668_100137844 132
395 3300025972 Ga0207668_10171424 Ga0207668_101714242 132
396 3300025972 Ga0207668_10373334 Ga0207668_103733342 132
397 3300025972 Ga0207668_10921398 Ga0207668_109213982 132
398 3300025981 Ga0207640_10016628 Ga0207640_100166285 132
399 3300025981 Ga0207640_10657743 Ga0207640_106577432 132
400 3300025986 Ga0207658_10078833 Ga0207658_100788333 132
401 3300025986 Ga0207658_10078909 Ga0207658_100789093 132
402 3300025986 Ga0207658_10110353 Ga0207658_101103532 132
403 3300025986 Ga0207658_10143550 Ga0207658_101435502 132
404 3300025986 Ga0207658_10183838 Ga0207658_101838383 132
405 3300025986 Ga0207658_10247729 Ga0207658_102477292 132
406 3300025986 Ga0207658_10485253 Ga0207658_104852532 132
407 3300026023 Ga0207677_10010440 Ga0207677_100104407 132
408 3300026023 Ga0207677_10025654 Ga0207677_100256544 132
409 3300026023 Ga0207677_10116465 Ga0207677_101164654 132
410 3300026023 Ga0207677_10304217 Ga0207677_103042172 132
411 3300026023 Ga0207677_10383657 Ga0207677_103836572 132
412 3300026035 Ga0207703_10026631 Ga0207703_100266313 132
413 3300026035 Ga0207703_10030482 Ga0207703_100304822 132
414 3300026035 Ga0207703_10059243 Ga0207703_100592433 132
415 3300026035 Ga0207703_10061325 Ga0207703_100613253 132
416 3300026035 Ga0207703_11516323 Ga0207703_115163231 132
417 3300026041 Ga0207639_10005406 Ga0207639_100054064 132
418 3300026041 Ga0207639_10031271 Ga0207639_100312715 132
419 3300026041 Ga0207639_10107654 Ga0207639_101076542 132
420 3300026041 Ga0207639_10803940 Ga0207639_108039402 132
421 3300026041 Ga0207639_11717291 Ga0207639_117172912 132
422 3300026067 Ga0207678_10029888 Ga0207678_100298887 132
423 3300026067 Ga0207678_10032127 Ga0207678_100321271 132
424 3300026067 Ga0207678_10054639 Ga0207678_100546394 132
425 3300026075 Ga0207708_10438917 Ga0207708_104389172 132
426 3300026075 Ga0207708_10680954 Ga0207708_106809542 132
427 3300026075 Ga0207708_10915500 Ga0207708_109155002 132
428 3300026088 Ga0207641_10029865 Ga0207641_100298654 132
429 3300026088 Ga0207641_10072611 Ga0207641_100726114 132
430 3300026088 Ga0207641_10205271 Ga0207641_102052713 132
431 3300026088 Ga0207641_10267507 Ga0207641_102675072 132
432 3300026088 Ga0207641_10357620 Ga0207641_103576202 132
433 3300026088 Ga0207641_10715265 Ga0207641_107152652 132
434 3300026089 Ga0207648_10001949 Ga0207648_1000194912 132
435 3300026089 Ga0207648_10004828 Ga0207648_100048286 132
436 3300026089 Ga0207648_10016091 Ga0207648_100160914 132
437 3300026089 Ga0207648_10183211 Ga0207648_101832112 132
438 3300026089 Ga0207648_10298814 Ga0207648_102988143 132
439 3300026089 Ga0207648_11201408 Ga0207648_112014082 132
440 3300026095 Ga0207676_10002144 Ga0207676_1000214414 132
441 3300026095 Ga0207676_10032022 Ga0207676_100320222 132
442 3300026095 Ga0207676_10054834 Ga0207676_100548342 132
443 3300026116 Ga0207674_10356307 Ga0207674_103563072 132
444 3300026118 Ga0207675_100033118 Ga0207675_1000331182 132
445 3300026118 Ga0207675_100045920 Ga0207675_1000459204 132
446 3300026118 Ga0207675_100179851 Ga0207675_1001798512 132
447 3300026118 Ga0207675_100720894 Ga0207675_1007208941 132
448 3300026121 Ga0207683_10000011 Ga0207683_1000001124 132
449 3300026121 Ga0207683_10000853 Ga0207683_100008539 132
450 3300026121 Ga0207683_10001221 Ga0207683_100012213 132
451 3300026121 Ga0207683_10009011 Ga0207683_1000901111 132
452 3300026121 Ga0207683_10172610 Ga0207683_101726102 132
453 3300026121 Ga0207683_10345014 Ga0207683_103450142 132
454 3300026121 Ga0207683_10704067 Ga0207683_107040672 132
455 3300026121 Ga0207683_10797385 Ga0207683_107973852 132
456 3300026142 Ga0207698_10003568 Ga0207698_100035684 132
457 3300026142 Ga0207698_11663208 Ga0207698_116632081 132
458 3300027682 Ga0209971_1011522 Ga0209971_10115223 132
459 3300028379 Ga0268266_10006477 Ga0268266_1000647710 132
460 3300028379 Ga0268266_10155288 Ga0268266_101552883 132
461 3300028379 Ga0268266_10239635 Ga0268266_102396352 132
462 3300028380 Ga0268265_10065128 Ga0268265_100651283 132
463 3300028380 Ga0268265_10168700 Ga0268265_101687001 132
464 3300028380 Ga0268265_10318742 Ga0268265_103187422 132
465 3300028381 Ga0268264_10011656 Ga0268264_100116564 132
466 3300028381 Ga0268264_10098757 Ga0268264_100987573 132
467 3300028381 Ga0268264_10308254 Ga0268264_103082542 132
468 3300028381 Ga0268264_10866203 Ga0268264_108662031 132
469 3300028381 Ga0268264_10932149 Ga0268264_109321492 132
470 3300028573 Ga0265334_10037790 Ga0265334_100377902 132
471 3300031240 Ga0265320_10093407 Ga0265320_100934072 132
472 3300031548 Ga0307408_100008399 Ga0307408_1000083994 132
473 3300031731 Ga0307405_10007530 Ga0307405_100075302 132
474 3300031824 Ga0307413_10572240 Ga0307413_105722402 132
475 3300031852 Ga0307410_10035157 Ga0307410_100351575 132
476 3300031901 Ga0307406_10009872 Ga0307406_100098727 132
477 3300031995 Ga0307409_100000176 Ga0307409_10000017610 132
478 3300032002 Ga0307416_100039177 Ga0307416_1000391773 132
479 3300032004 Ga0307414_10164356 Ga0307414_101643563 132
480 3300032126 Ga0307415_100003537 Ga0307415_1000035375 132
481 3300035691 Ga0373931_0099417 Ga0373931_0099417_243_695 132
482 3300035691 Ga0373931_1078584 Ga0373931_1078584_58_510 132
483 3300036401 Ga0373937_0033849 Ga0373937_0033849_1455_1907 132
484 3300036401 Ga0373937_1195172 Ga0373937_1195172_120_572 132
485 3300037418 Ga0395900_0236583 Ga0395900_0236583_325_777 132
486 3300039447 Ga0436361_0288677 Ga0436361_0288677_4266_4724 132
487 3300039447 Ga0436361_0462490 Ga0436361_0462490_647_1099 132
488 3300041486 Ga0451807_0379536 Ga0451807_0379536_68_520 132
489 3300042876 Ga0451577_0526855 Ga0451577_0526855_249_701 132
490 3300044656 Ga0466969_0046836 Ga0466969_0046836_1233_1685 132
491 3300044683 Ga0466965_0038508 Ga0466965_0038508_1640_2092 132
492 3300044683 Ga0466965_0101389 Ga0466965_0101389_432_884 132
493 3300044693 Ga0466961_0009600 Ga0466961_0009600_1158_1610 132
494 3300045049 Ga0466959_0009776 Ga0466959_0009776_5329_5781 132
495 3300046539 Ga0495621_0038823 Ga0495621_0038823_802_1254 132
496 3300046681 Ga0495647_0252620 Ga0495647_0252620_186_638 132
497 3300048903 Ga0496100_0103604 Ga0496100_0103604_883_1335 132
498 3300048904 Ga0496101_0118882 Ga0496101_0118882_1533_1985 132
499 3300048904 Ga0496101_0900928 Ga0496101_0900928_43_495 132
500 3300048905 Ga0496102_0006121 Ga0496102_0006121_9542_9994 132
501 3300048905 Ga0496102_0225458 Ga0496102_0225458_1027_1479 132
502 3300048906 Ga0496103_0038791 Ga0496103_0038791_2059_2511 132
503 3300048907 Ga0496104_0025710 Ga0496104_0025710_1767_2219 132
504 3300048907 Ga0496104_0536474 Ga0496104_0536474_382_834 132
505 3300048908 Ga0496105_0017692 Ga0496105_0017692_2678_3130 132
506 3300048909 Ga0496106_0000409 Ga0496106_0000409_29335_29787 132
507 3300048909 Ga0496106_0233368 Ga0496106_0233368_746_1198 132
508 3300048911 Ga0496108_0001057 Ga0496108_0001057_12782_13234 132
509 3300048911 Ga0496108_0228885 Ga0496108_0228885_759_1211 132
510 3300048912 Ga0496109_0003127 Ga0496109_0003127_53_505 132
511 3300048912 Ga0496109_0154269 Ga0496109_0154269_697_1149 132
512 3300048913 Ga0496110_0116119 Ga0496110_0116119_1660_2112 132
513 3300048914 Ga0496111_0654617 Ga0496111_0654617_216_668 132
514 3300049570 Ga0501033_0044240 Ga0501033_0044240_661_1110 132
515 3300049572 Ga0501036_0007376 Ga0501036_0007376_7698_8147 132
516 3300049572 Ga0501036_1574176 Ga0501036_1574176_11_463 132
517 3300049574 Ga0501038_0013332 Ga0501038_0013332_123_572 132
518 3300049574 Ga0501038_0427332 Ga0501038_0427332_266_715 132
519 3300049575 Ga0501039_0272929 Ga0501039_0272929_486_935 132
520 3300049576 Ga0501040_0015955 Ga0501040_0015955_884_1333 132
521 3300049576 Ga0501040_0021361 Ga0501040_0021361_582_1031 132
522 3300049577 Ga0501041_0030161 Ga0501041_0030161_1471_1920 132
523 3300049578 Ga0501042_0024438 Ga0501042_0024438_13_462 132
524 3300049580 Ga0501046_0169672 Ga0501046_0169672_292_741 132
525 3300049580 Ga0501046_0170676 Ga0501046_0170676_660_1109 132
526 3300049584 Ga0501068_0147349 Ga0501068_0147349_657_1106 132
527 3300049587 Ga0501071_0065086 Ga0501071_0065086_2070_2519 132
528 3300049587 Ga0501071_0505689 Ga0501071_0505689_182_634 132
529 3300049588 Ga0501072_0005767 Ga0501072_0005767_6965_7414 132
530 3300049588 Ga0501072_0788366 Ga0501072_0788366_265_717 132
531 3300049591 Ga0501075_0000774 Ga0501075_0000774_2085_2534 132
532 3300049591 Ga0501075_0746996 Ga0501075_0746996_285_734 132
533 3300049591 Ga0501075_1012688 Ga0501075_1012688_48_497 132
534 3300049592 Ga0501076_0000617 Ga0501076_0000617_17400_17849 132
535 3300049592 Ga0501076_0338255 Ga0501076_0338255_70_519 132
536 3300049592 Ga0501076_0606429 Ga0501076_0606429_231_680 132
537 3300049593 Ga0501077_0024814 Ga0501077_0024814_2250_2699 132
538 3300049741 Ga0501079_0151202 Ga0501079_0151202_201_650 132
539 3300049741 Ga0501079_0161483 Ga0501079_0161483_870_1319 132
540 3300049742 Ga0501080_0043343 Ga0501080_0043343_3110_3559 132
541 3300049742 Ga0501080_0056792 Ga0501080_0056792_2891_3343 132
542 3300049743 Ga0501081_0003594 Ga0501081_0003594_6159_6608 132
543 3300049743 Ga0501081_0129377 Ga0501081_0129377_1328_1777 132
544 3300049743 Ga0501081_0280655 Ga0501081_0280655_214_663 132
545 3300049822 Ga0501035_0239450 Ga0501035_0239450_622_1071 132
546 3300049824 Ga0501045_1241874 Ga0501045_1241874_70_519 132
547 3300050507 nmdc:mga05p37_186212_c1 nmdc:mga05p37_186212_c1_1734_2183 132
548 3300050511 nmdc:mga08y16_21282_c1 nmdc:mga08y16_21282_c1_5930_6382 132
549 3300050513 nmdc:mga0rr50_201760_c1 nmdc:mga0rr50_201760_c1_898_1350 132
550 3300053139 Ga0500568_0008930 Ga0500568_0008930_1441_1893 132
551 3300054114 Ga0501084_0001469 Ga0501084_0001469_17359_17808 132
552 3300054114 Ga0501084_0230859 Ga0501084_0230859_927_1376 132
553 3300054114 Ga0501084_1758054 Ga0501084_1758054_47_496 132
554 3300060353 Ga0501082_0047446 Ga0501082_0047446_3211_3660 132
555 3300060353 Ga0501082_0410547 Ga0501082_0410547_220_669 132
556 3300061734 Ga0530510_0000010 Ga0530510_0000010_19737_20186 132
557 3300061734 Ga0530510_0038671 Ga0530510_0038671_2856_3305 132
558 3300061734 Ga0530510_0571148 Ga0530510_0571148_271_720 132
559 3300028556 Ga0265337_1060079 Ga0265337_10600792 133
560 3300028563 Ga0265319_1005556 Ga0265319_10055564 133
561 3300028563 Ga0265319_1029755 Ga0265319_10297553 133
562 3300028563 Ga0265319_1060175 Ga0265319_10601752 133
563 3300031240 Ga0265320_10002559 Ga0265320_100025595 133
564 3300031240 Ga0265320_10007847 Ga0265320_100078476 133
565 3300048925 Ga0496122_0000349 Ga0496122_0000349_1594_2049 133
566 3300048928 Ga0496125_0034014 Ga0496125_0034014_1439_1894 133
567 3300048929 Ga0496126_0000424 Ga0496126_0000424_5084_5539 133
568 3300049570 Ga0501033_0096269 Ga0501033_0096269_1257_1709 133
569 3300049572 Ga0501036_0208815 Ga0501036_0208815_592_1044 133
570 3300049573 Ga0501037_0265816 Ga0501037_0265816_394_846 133
571 3300049574 Ga0501038_0085251 Ga0501038_0085251_1989_2441 133
572 3300049575 Ga0501039_0073742 Ga0501039_0073742_617_1069 133
573 3300049576 Ga0501040_0137385 Ga0501040_0137385_1251_1703 133
574 3300049577 Ga0501041_0206623 Ga0501041_0206623_538_990 133
575 3300049578 Ga0501042_0030042 Ga0501042_0030042_2886_3338 133
576 3300049580 Ga0501046_0262263 Ga0501046_0262263_296_748 133
577 3300049584 Ga0501068_0632150 Ga0501068_0632150_32_484 133
578 3300049585 Ga0501069_0147501 Ga0501069_0147501_829_1281 133
579 3300049588 Ga0501072_0008319 Ga0501072_0008319_1149_1601 133
580 3300049590 Ga0501074_0028699 Ga0501074_0028699_1957_2409 133
581 3300049591 Ga0501075_0162074 Ga0501075_0162074_23_475 133
582 3300049592 Ga0501076_0228688 Ga0501076_0228688_603_1055 133
583 3300049741 Ga0501079_0024346 Ga0501079_0024346_398_850 133
584 3300049742 Ga0501080_0291724 Ga0501080_0291724_468_920 133
585 3300049743 Ga0501081_0017426 Ga0501081_0017426_508_960 133
586 3300049823 Ga0501044_0404732 Ga0501044_0404732_654_1106 133
587 3300049824 Ga0501045_0073879 Ga0501045_0073879_1439_1891 133
588 3300054114 Ga0501084_0018583 Ga0501084_0018583_3918_4370 133
589 3300009177 Ga0105248_10416251 Ga0105248_104162512 134
590 3300048929 Ga0496126_0385524 Ga0496126_0385524_273_752 134
591 iso_pu_bacteria 2843690924 2843694494 134
592 iso_pu_bacteria 2846037992 2846039008 134
593 3300005543 Ga0070672_100005198 Ga0070672_1000051983 135
594 3300005548 Ga0070665_100023907 Ga0070665_1000239072 135
595 3300005563 Ga0068855_100008652 Ga0068855_10000865211 135
596 3300005564 Ga0070664_100008495 Ga0070664_1000084952 135
597 3300005577 Ga0068857_100013373 Ga0068857_1000133733 135
598 3300005578 Ga0068854_100002906 Ga0068854_1000029062 135
599 3300005614 Ga0068856_100001740 Ga0068856_10000174010 135
600 3300005617 Ga0068859_100022430 Ga0068859_1000224307 135
601 3300005618 Ga0068864_100008701 Ga0068864_1000087013 135
602 3300005719 Ga0068861_100005622 Ga0068861_10000562210 135
603 3300005841 Ga0068863_100012970 Ga0068863_1000129703 135
604 3300005844 Ga0068862_100015292 Ga0068862_1000152923 135
605 3300006237 Ga0097621_100004430 Ga0097621_10000443011 135
606 3300006358 Ga0068871_100002845 Ga0068871_10000284511 135
607 3300006931 Ga0097620_100022428 Ga0097620_1000224282 135
608 3300009098 Ga0105245_10000551 Ga0105245_100005518 135
609 3300010375 Ga0105239_10002655 Ga0105239_100026554 135
610 3300011119 Ga0105246_10001327 Ga0105246_1000132716 135
611 3300013306 Ga0163162_10289644 Ga0163162_102896443 135
612 3300013307 Ga0157372_10006143 Ga0157372_100061432 135
613 3300013308 Ga0157375_12900002 Ga0157375_129000021 135
614 3300014326 Ga0157380_10054818 Ga0157380_100548186 135
615 3300014745 Ga0157377_10000845 Ga0157377_100008453 135
616 3300014969 Ga0157376_10001467 Ga0157376_1000146716 135
617 3300025315 Ga0207697_10000447 Ga0207697_1000044711 135
618 3300025901 Ga0207688_10000079 Ga0207688_1000007930 135
619 3300025904 Ga0207647_10023772 Ga0207647_100237726 135
620 3300025908 Ga0207643_10000010 Ga0207643_10000010103 135
621 3300025918 Ga0207662_10000127 Ga0207662_1000012726 135
622 3300025919 Ga0207657_10000060 Ga0207657_1000006027 135
623 3300025924 Ga0207694_10026321 Ga0207694_100263216 135
624 3300025925 Ga0207650_10000179 Ga0207650_1000017958 135
625 3300025926 Ga0207659_10002387 Ga0207659_1000238711 135
626 3300025927 Ga0207687_10001231 Ga0207687_1000123111 135
627 3300025932 Ga0207690_10002679 Ga0207690_1000267911 135
628 3300025933 Ga0207706_10000132 Ga0207706_1000013264 135
629 3300025935 Ga0207709_10038422 Ga0207709_100384222 135
630 3300025937 Ga0207669_10004470 Ga0207669_100044703 135
631 3300025938 Ga0207704_10000637 Ga0207704_100006373 135
632 3300025940 Ga0207691_10000011 Ga0207691_1000001123 135
633 3300025942 Ga0207689_10001249 Ga0207689_100012495 135
634 3300025945 Ga0207679_10003495 Ga0207679_1000349510 135
635 3300025949 Ga0207667_10011656 Ga0207667_100116563 135
636 3300025960 Ga0207651_10001846 Ga0207651_100018463 135
637 3300025961 Ga0207712_10008751 Ga0207712_100087513 135
638 3300025986 Ga0207658_10002750 Ga0207658_100027503 135
639 3300026035 Ga0207703_10002130 Ga0207703_1000213016 135
640 3300026041 Ga0207639_10025283 Ga0207639_100252832 135
641 3300026078 Ga0207702_10019353 Ga0207702_100193531 135
642 3300026088 Ga0207641_10017555 Ga0207641_100175552 135
643 3300026089 Ga0207648_10007280 Ga0207648_1000728011 135
644 3300026095 Ga0207676_10002785 Ga0207676_100027853 135
645 3300026116 Ga0207674_10001682 Ga0207674_1000168223 135
646 3300026118 Ga0207675_100000515 Ga0207675_1000005158 135
647 3300026142 Ga0207698_10108047 Ga0207698_101080473 135
648 3300028379 Ga0268266_10000550 Ga0268266_1000055036 135
649 3300048908 Ga0496105_0490047 Ga0496105_0490047_26_484 135
650 3300048911 Ga0496108_0362954 Ga0496108_0362954_748_1206 135
651 3300048912 Ga0496109_0092882 Ga0496109_0092882_144_602 135
652 3300049589 Ga0501073_0042806 Ga0501073_0042806_571_1044 135
653 3300049744 Ga0501083_0022447 Ga0501083_0022447_2377_2850 135
654 3300050513 nmdc:mga0rr50_1132969_c1 nmdc:mga0rr50_1132969_c1_141_602 135
655 3300001977 JGI24746J21847_1020640 JGI24746J21847_10206401 138
656 3300005290 Ga0065712_10090276 Ga0065712_100902762 138
657 3300005327 Ga0070658_10001881 Ga0070658_100018812 138
658 3300005328 Ga0070676_10000503 Ga0070676_100005037 138
659 3300005329 Ga0070683_100008459 Ga0070683_1000084597 138
660 3300005331 Ga0070670_100018216 Ga0070670_1000182162 138
661 3300005333 Ga0070677_10000200 Ga0070677_1000020010 138
662 3300005334 Ga0068869_100000368 Ga0068869_1000003683 138
663 3300005335 Ga0070666_10007930 Ga0070666_100079303 138
664 3300005337 Ga0070682_100515691 Ga0070682_1005156912 138
665 3300005338 Ga0068868_100186783 Ga0068868_1001867832 138
666 3300005339 Ga0070660_100003648 Ga0070660_1000036482 138
667 3300005340 Ga0070689_100010925 Ga0070689_1000109253 138
668 3300005343 Ga0070687_100000742 Ga0070687_10000074212 138
669 3300005345 Ga0070692_10021027 Ga0070692_100210274 138
670 3300005353 Ga0070669_100003827 Ga0070669_1000038272 138
671 3300005354 Ga0070675_100003536 Ga0070675_10000353614 138
672 3300005355 Ga0070671_100000911 Ga0070671_1000009118 138
673 3300005366 Ga0070659_100006412 Ga0070659_10000641210 138
674 3300005367 Ga0070667_100035229 Ga0070667_1000352296 138
675 3300005439 Ga0070711_100959901 Ga0070711_1009599011 138
676 3300005440 Ga0070705_100106328 Ga0070705_1001063282 138
677 3300005456 Ga0070678_100026328 Ga0070678_1000263283 138
678 3300005457 Ga0070662_100002848 Ga0070662_10000284812 138
679 3300005458 Ga0070681_10361374 Ga0070681_103613742 138
680 3300005459 Ga0068867_100010865 Ga0068867_1000108653 138
681 3300005535 Ga0070684_100051122 Ga0070684_1000511222 138
682 3300005539 Ga0068853_100004263 Ga0068853_1000042633 138
683 3300005544 Ga0070686_100019245 Ga0070686_1000192456 138
684 3300005546 Ga0070696_100291818 Ga0070696_1002918182 138
685 3300005547 Ga0070693_100032512 Ga0070693_1000325126 138
686 3300005718 Ga0068866_10004026 Ga0068866_100040264 138
687 3300005834 Ga0068851_10000243 Ga0068851_100002434 138
688 3300005843 Ga0068860_100007523 Ga0068860_1000075232 138
689 3300006358 Ga0068871_100175620 Ga0068871_1001756203 138
690 3300009545 Ga0105237_10005798 Ga0105237_1000579813 138
691 3300009553 Ga0105249_10000377 Ga0105249_1000037716 138
692 3300013105 Ga0157369_10002477 Ga0157369_1000247711 138
693 3300013296 Ga0157374_10004846 Ga0157374_1000484611 138
694 3300025290 Ga0207673_1015395 Ga0207673_10153952 138
695 3300025906 Ga0207699_10408739 Ga0207699_104087391 138
696 3300025923 Ga0207681_10581913 Ga0207681_105819132 138
697 3300025941 Ga0207711_10000671 Ga0207711_100006714 138
698 3300026121 Ga0207683_10000384 Ga0207683_1000038411 138
699 3300028381 Ga0268264_10000825 Ga0268264_100008257 138
700 3300048915 Ga0496112_0001083 Ga0496112_0001083_4999_5466 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

20

163

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.8776 4 130
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.8621 4 130
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.854 4 129
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.8376 4 130
2okv-assembly1.cif.gz_A c-myc dna unwinding element binding protein 0.8375 4 133
ID Description Score Start End Superfamily
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8621 4 130 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8596 4 130 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.854 4 129 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8515 4 131 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8408 4 130 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A2R8B3X3-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.8864 4 130 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A5B9M6L0-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.8854 5 129 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A2W5VTB9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.885 4 130 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A366W847-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.8838 4 130 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A455VHI7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.8834 3 129 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Feature Viewer

pLDDT pTM Quality
74.07 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map