F476064

General Info

Members Datasets Scaffolds Average Seq Length
699 386 1398 104

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728368998|2728752199
Length 100
Sequence LLPALAAIATFSIAAAAAAPVNYTLPEETAAFKPGPNLEVVQSNCSGCHSADYIKTQPPHDEKVKKDFWQAEVTKMKKVYGAPIDDADVSKIVEYLATTY

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
79 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
80 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
192 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
220 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
221 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
323 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
326 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
327 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
328 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
329 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
332 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
333 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
334 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
335 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
336 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
337 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
340 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
343 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
349 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
352 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
353 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
357 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
358 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
359 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
360 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
362 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
363 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
364 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
365 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
366 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
367 2643221651 Afipia sp. Root123D2 Isolate Unclassified
368 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
369 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
370 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
371 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
372 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
373 2904699407
374 2906610324
375 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
376 2922425934
377 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
378 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
379 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
380 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
381 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
382 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
383 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
384 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
385 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
386 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0.14
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.45
Nodule 3.58
Rhizoplane 7.44
Rhizosphere 67.81
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10131323 3300003215 Bacteria 554
2 JGI25404J52841_10061817 3300003659 Bacteria 784
3 Ga0070658_10407074 3300005327 Bacteria 1169
4 Ga0070683_100042499 3300005329 Bacteria 4185
5 Ga0070683_100056364 3300005329 Bacteria 3650
6 Ga0070690_100183738 3300005330 Bacteria 1446
7 Ga0070670_101176106 3300005331 Bacteria 700
8 Ga0070670_101450793 3300005331 Bacteria 629
9 Ga0068869_100053868 3300005334 Bacteria 2926
10 Ga0070680_100075097 3300005336 Bacteria 2783
11 Ga0070682_100059813 3300005337 Bacteria 2407
12 Ga0068868_100136957 3300005338 Bacteria 2007
13 Ga0068868_101700202 3300005338 Bacteria 595
14 Ga0068868_101873243 3300005338 Bacteria 568
15 Ga0070660_100566883 3300005339 Bacteria 948
16 Ga0070660_101356212 3300005339 Bacteria 604
17 Ga0070689_100534730 3300005340 Bacteria 1008
18 Ga0070661_100732584 3300005344 Bacteria 807
19 Ga0070668_100107696 3300005347 Bacteria 2215
20 Ga0070668_100382147 3300005347 Bacteria 1198
21 Ga0070668_100661387 3300005347 Bacteria 919
22 Ga0070668_101089689 3300005347 Bacteria 720
23 Ga0070669_100080985 3300005353 Bacteria 2418
24 Ga0070675_100161791 3300005354 Bacteria 1925
25 Ga0070671_100070986 3300005355 Bacteria 2906
26 Ga0070671_100148388 3300005355 Bacteria 1980
27 Ga0070671_100367453 3300005355 Bacteria 1229
28 Ga0070674_100103240 3300005356 Bacteria 2081
29 Ga0070673_100609202 3300005364 Bacteria 997
30 Ga0070673_101925155 3300005364 Bacteria 561
31 Ga0070673_102130187 3300005364 Bacteria 533
32 Ga0070659_101055899 3300005366 Bacteria 715
33 Ga0070667_100055692 3300005367 Bacteria 3339
34 Ga0070667_100462837 3300005367 Bacteria 1160
35 Ga0070703_10574108 3300005406 Bacteria 517
36 Ga0070709_10202394 3300005434 Bacteria 1407
37 Ga0070709_11810817 3300005434 Bacteria 500
38 Ga0070714_100383378 3300005435 Bacteria 1326
39 Ga0070714_100449817 3300005435 Bacteria 1223
40 Ga0070714_101648562 3300005435 Bacteria 626
41 Ga0070713_100028808 3300005436 Bacteria 4389
42 Ga0070713_100064887 3300005436 Bacteria 3065
43 Ga0070713_100316547 3300005436 Bacteria 1440
44 Ga0070713_101221750 3300005436 Bacteria 728
45 Ga0070710_10085655 3300005437 Bacteria 1849
46 Ga0070701_10857686 3300005438 Bacteria 624
47 Ga0070711_100313034 3300005439 Bacteria 1252
48 Ga0070711_100595140 3300005439 Bacteria 922
49 Ga0070711_100893270 3300005439 Bacteria 758
50 Ga0070711_101354672 3300005439 Bacteria 618
51 Ga0070711_101775693 3300005439 Bacteria 541
52 Ga0070700_100184163 3300005441 Bacteria 1456
53 Ga0070708_100151186 3300005445 Bacteria 2159
54 Ga0070663_100011621 3300005455 Bacteria 5534
55 Ga0070663_100108464 3300005455 Bacteria 2083
56 Ga0070663_100282495 3300005455 Bacteria 1323
57 Ga0070678_100021815 3300005456 Bacteria 4230
58 Ga0070678_100062650 3300005456 Bacteria 2747
59 Ga0070678_100651821 3300005456 Bacteria 945
60 Ga0070662_100441743 3300005457 Bacteria 1079
61 Ga0070662_101366652 3300005457 Bacteria 610
62 Ga0070681_10008235 3300005458 Bacteria 10202
63 Ga0070681_11669744 3300005458 Bacteria 563
64 Ga0070698_100133084 3300005471 Bacteria 2441
65 Ga0070679_100090647 3300005530 Bacteria 3045
66 Ga0070679_101791317 3300005530 Bacteria 562
67 Ga0070684_100008771 3300005535 Bacteria 7927
68 Ga0070684_100084879 3300005535 Bacteria 2808
69 Ga0070684_101011461 3300005535 Bacteria 780
70 Ga0070697_100125686 3300005536 Bacteria 2148
71 Ga0068853_100244167 3300005539 Bacteria 1646
72 Ga0068853_100284915 3300005539 Bacteria 1524
73 Ga0068853_101000637 3300005539 Bacteria 805
74 Ga0070672_100437106 3300005543 Bacteria 1126
75 Ga0070672_100466077 3300005543 Bacteria 1090
76 Ga0070672_100501887 3300005543 Bacteria 1050
77 Ga0070686_100508407 3300005544 Bacteria 936
78 Ga0070693_100061213 3300005547 Bacteria 2187
79 Ga0070665_100412826 3300005548 Bacteria 1358
80 Ga0070665_100518532 3300005548 Bacteria 1203
81 Ga0070665_100634445 3300005548 Bacteria 1081
82 Ga0070665_100736636 3300005548 Bacteria 999
83 Ga0070665_100819002 3300005548 Bacteria 944
84 Ga0070665_101603322 3300005548 Bacteria 659
85 Ga0068855_100022919 3300005563 Bacteria 7483
86 Ga0068855_100485355 3300005563 Bacteria 1344
87 Ga0068855_101476620 3300005563 Bacteria 699
88 Ga0070664_100105287 3300005564 Bacteria 2457
89 Ga0070664_100424938 3300005564 Bacteria 1217
90 Ga0068857_100430156 3300005577 Bacteria 1232
91 Ga0068854_100392749 3300005578 Bacteria 1146
92 Ga0068854_100570190 3300005578 Bacteria 963
93 Ga0068856_102382648 3300005614 Bacteria 537
94 Ga0070702_100025631 3300005615 Bacteria 3161
95 Ga0068852_100260652 3300005616 Bacteria 1664
96 Ga0068852_100431132 3300005616 Bacteria 1302
97 Ga0068852_101657979 3300005616 Bacteria 662
98 Ga0068852_102147104 3300005616 Bacteria 580
99 Ga0068859_100307203 3300005617 Bacteria 1679
100 Ga0068859_101612069 3300005617 Bacteria 717
101 Ga0068864_100053191 3300005618 Bacteria 3492
102 Ga0068864_100211139 3300005618 Bacteria 1787
103 Ga0068851_10164824 3300005834 Bacteria 1219
104 Ga0068851_10687349 3300005834 Bacteria 629
105 Ga0068851_10858219 3300005834 Bacteria 567
106 Ga0068870_10090642 3300005840 Bacteria 1708
107 Ga0068870_10511798 3300005840 Bacteria 802
108 Ga0068863_100121260 3300005841 Bacteria 2493
109 Ga0068863_100790677 3300005841 Bacteria 946
110 Ga0068863_101265942 3300005841 Bacteria 744
111 Ga0068863_102042851 3300005841 Bacteria 583
112 Ga0068858_100144196 3300005842 Bacteria 2236
113 Ga0068858_100231768 3300005842 Bacteria 1751
114 Ga0068860_100139579 3300005843 Bacteria 2328
115 Ga0068860_100471803 3300005843 Bacteria 1250
116 Ga0068862_100046278 3300005844 Bacteria 3712
117 Ga0068862_101378050 3300005844 Bacteria 708
118 Ga0068862_101787865 3300005844 Bacteria 624
119 Ga0081540_1002276 3300005983 Bacteria 15781
120 Ga0081540_1004490 3300005983 Bacteria 10610
121 Ga0081540_1006058 3300005983 Bacteria 8893
122 Ga0081540_1070029 3300005983 Bacteria 1627
123 Ga0070717_10005303 3300006028 Bacteria 9399
124 Ga0070717_10067889 3300006028 Bacteria 2968
125 Ga0075365_10081906 3300006038 Bacteria 2188
126 Ga0075365_10442064 3300006038 Bacteria 918
127 Ga0075368_10080951 3300006042 Bacteria 1321
128 Ga0075363_100054735 3300006048 Bacteria 2135
129 Ga0075363_100130463 3300006048 Bacteria 1409
130 Ga0075364_10603687 3300006051 Bacteria 750
131 Ga0075364_10904021 3300006051 Bacteria 601
132 Ga0075432_10353709 3300006058 Bacteria 623
133 Ga0070716_100215571 3300006173 Bacteria 1286
134 Ga0070716_100605093 3300006173 Bacteria 825
135 Ga0070712_100776231 3300006175 Unclassified 821
136 Ga0075362_10674674 3300006177 Bacteria 538
137 Ga0075367_10293896 3300006178 Bacteria 1022
138 Ga0075367_10388120 3300006178 Bacteria 882
139 Ga0075366_10418377 3300006195 Bacteria 825
140 Ga0075366_10895474 3300006195 Bacteria 553
141 Ga0097621_100073701 3300006237 Bacteria 2827
142 Ga0097621_100155850 3300006237 Bacteria 1960
143 Ga0097621_100429159 3300006237 Bacteria 1187
144 Ga0097621_100622226 3300006237 Bacteria 988
145 Ga0075370_10060580 3300006353 Bacteria 2156
146 Ga0075370_10114676 3300006353 Bacteria 1566
147 Ga0068871_100026822 3300006358 Bacteria 4499
148 Ga0068871_100599462 3300006358 Bacteria 1002
149 Ga0068871_100969036 3300006358 Bacteria 791
150 Ga0068871_101550777 3300006358 Bacteria 626
151 Ga0068871_101861822 3300006358 Bacteria 572
152 Ga0075428_102282967 3300006844 Bacteria 557
153 Ga0075433_10729797 3300006852 Bacteria 867
154 Ga0068865_100113968 3300006881 Bacteria 1999
155 Ga0068865_100529353 3300006881 Bacteria 987
156 Ga0097620_100307201 3300006931 Bacteria 1679
157 Ga0097620_101612024 3300006931 Bacteria 717
158 Ga0099825_1052548 3300006941 Bacteria 838
159 Ga0099824_1018832 3300006942 Bacteria 5555
160 Ga0099822_1000838 3300006943 Bacteria 32461
161 Ga0075435_100089011 3300007076 Bacteria 2545
162 Ga0099795_10065659 3300007788 Bacteria 1357
163 Ga0099795_10155070 3300007788 Bacteria 941
164 Ga0105240_10073201 3300009093 Bacteria 4231
165 Ga0105240_10211364 3300009093 Bacteria 2267
166 Ga0105240_12129954 3300009093 Bacteria 582
167 Ga0111539_11994172 3300009094 Bacteria 673
168 Ga0105245_10070905 3300009098 Bacteria 3164
169 Ga0105245_10074274 3300009098 Bacteria 3094
170 Ga0105245_10900043 3300009098 Bacteria 927
171 Ga0105245_11041888 3300009098 Bacteria 863
172 Ga0105245_12435539 3300009098 Bacteria 577
173 Ga0105247_10182598 3300009101 Bacteria 1401
174 Ga0105247_10209109 3300009101 Bacteria 1315
175 Ga0105247_10386982 3300009101 Bacteria 993
176 Ga0105247_11266367 3300009101 Bacteria 590
177 Ga0105247_11346337 3300009101 Bacteria 575
178 Ga0105243_10390532 3300009148 Bacteria 1290
179 Ga0105243_10598324 3300009148 Bacteria 1061
180 Ga0105241_11196229 3300009174 Bacteria 720
181 Ga0105242_10305234 3300009176 Bacteria 1454
182 Ga0105242_10777990 3300009176 Bacteria 945
183 Ga0105242_11638275 3300009176 Bacteria 678
184 Ga0105248_10127451 3300009177 Bacteria 2872
185 Ga0105248_10173880 3300009177 Bacteria 2428
186 Ga0105248_10516593 3300009177 Bacteria 1347
187 Ga0105248_10871609 3300009177 Bacteria 1016
188 Ga0105237_10020091 3300009545 Bacteria 6895
189 Ga0105237_10026866 3300009545 Bacteria 5882
190 Ga0105237_10158711 3300009545 Bacteria 2259
191 Ga0105237_10741546 3300009545 Bacteria 989
192 Ga0105237_10963100 3300009545 Bacteria 860
193 Ga0105238_11190304 3300009551 Bacteria 786
194 Ga0105249_12357818 3300009553 Bacteria 605
195 Ga0105249_12645319 3300009553 Bacteria 574
196 Ga0099796_10080942 3300010159 Bacteria 1191
197 Ga0099796_10293340 3300010159 Bacteria 687
198 Ga0105239_10063316 3300010375 Bacteria 4061
199 Ga0105239_10103929 3300010375 Bacteria 3145
200 Ga0105239_10147003 3300010375 Bacteria 2629
201 Ga0105239_11079308 3300010375 Bacteria 924
202 Ga0105239_11519318 3300010375 Bacteria 774
203 Ga0105246_10047348 3300011119 Bacteria 2936
204 Ga0105246_10145114 3300011119 Bacteria 1790
205 Ga0105246_10303846 3300011119 Bacteria 1289
206 Ga0105246_10404574 3300011119 Bacteria 1134
207 Ga0105246_12407841 3300011119 Bacteria 516
208 Ga0157328_1008654 3300012478 Bacteria 669
209 Ga0157371_10323694 3300013102 Bacteria 1119
210 Ga0157370_10094735 3300013104 Bacteria 2801
211 Ga0157374_10055751 3300013296 Bacteria 3689
212 Ga0157374_10512634 3300013296 Bacteria 1205
213 Ga0157378_10013088 3300013297 Bacteria 7258
214 Ga0157378_10949310 3300013297 Bacteria 892
215 Ga0157378_13270753 3300013297 Bacteria 503
216 Ga0163162_10184920 3300013306 Bacteria 2210
217 Ga0163162_10400533 3300013306 Bacteria 1505
218 Ga0163162_10911776 3300013306 Bacteria 991
219 Ga0163162_11014683 3300013306 Bacteria 938
220 Ga0157375_10565643 3300013308 Bacteria 1298
221 Ga0157375_10568486 3300013308 Bacteria 1294
222 Ga0157375_11212103 3300013308 Bacteria 886
223 Ga0157375_13303599 3300013308 Bacteria 538
224 Ga0163163_10142478 3300014325 Bacteria 2439
225 Ga0163163_10224830 3300014325 Bacteria 1926
226 Ga0163163_11319173 3300014325 Bacteria 784
227 Ga0157380_10094656 3300014326 Bacteria 2473
228 Ga0157380_10394607 3300014326 Bacteria 1310
229 Ga0157377_10391588 3300014745 Bacteria 944
230 Ga0157379_10204693 3300014968 Bacteria 1785
231 Ga0157379_10471505 3300014968 Bacteria 1161
232 Ga0157379_10593082 3300014968 Bacteria 1034
233 Ga0157379_11144661 3300014968 Bacteria 747
234 Ga0157376_10011395 3300014969 Bacteria 6552
235 Ga0157376_10122918 3300014969 Bacteria 2304
236 Ga0157376_10189028 3300014969 Bacteria 1887
237 Ga0157376_10942176 3300014969 Bacteria 883
238 Ga0157376_12794176 3300014969 Bacteria 528
239 Ga0163161_10171181 3300017792 Bacteria 1661
240 Ga0213876_10031481 3300021384 Bacteria 2799
241 Ga0209233_1019117 3300025261 Bacteria 1827
242 Ga0209758_1002604 3300025297 Bacteria 18051
243 Ga0207426_1156950 3300025302 Bacteria 525
244 Ga0207697_10066469 3300025315 Bacteria 1507
245 Ga0207656_10526389 3300025321 Bacteria 601
246 Ga0207692_10445029 3300025898 Bacteria 815
247 Ga0207710_10142826 3300025900 Bacteria 1157
248 Ga0207710_10165652 3300025900 Bacteria 1079
249 Ga0207710_10720346 3300025900 Bacteria 524
250 Ga0207688_10010777 3300025901 Bacteria 4975
251 Ga0207688_10074554 3300025901 Bacteria 1930
252 Ga0207680_10629438 3300025903 Bacteria 768
253 Ga0207647_10107847 3300025904 Bacteria 1648
254 Ga0207699_10203456 3300025906 Bacteria 1343
255 Ga0207645_10907584 3300025907 Bacteria 598
256 Ga0207705_10505087 3300025909 Bacteria 939
257 Ga0207684_10060295 3300025910 Bacteria 3223
258 Ga0207707_10036020 3300025912 Bacteria 4327
259 Ga0207671_10069722 3300025914 Bacteria 2620
260 Ga0207671_10233362 3300025914 Bacteria 1444
261 Ga0207671_11115809 3300025914 Bacteria 619
262 Ga0207663_10673982 3300025916 Bacteria 817
263 Ga0207663_10754878 3300025916 Bacteria 773
264 Ga0207660_10034686 3300025917 Bacteria 3498
265 Ga0207657_11035617 3300025919 Bacteria 629
266 Ga0207649_10744728 3300025920 Bacteria 762
267 Ga0207652_10051300 3300025921 Bacteria 3537
268 Ga0207652_10053418 3300025921 Bacteria 3470
269 Ga0207646_10173681 3300025922 Bacteria 1946
270 Ga0207681_10234859 3300025923 Bacteria 1425
271 Ga0207650_11089957 3300025925 Bacteria 680
272 Ga0207650_11249186 3300025925 Bacteria 632
273 Ga0207659_10311190 3300025926 Bacteria 1297
274 Ga0207687_10478451 3300025927 Bacteria 1037
275 Ga0207687_10945502 3300025927 Bacteria 738
276 Ga0207700_10015790 3300025928 Bacteria 4994
277 Ga0207700_10065827 3300025928 Bacteria 2767
278 Ga0207700_10830083 3300025928 Bacteria 827
279 Ga0207664_10191238 3300025929 Bacteria 1762
280 Ga0207664_10328910 3300025929 Bacteria 1349
281 Ga0207644_10087799 3300025931 Bacteria 2312
282 Ga0207644_10141764 3300025931 Bacteria 1851
283 Ga0207644_10826325 3300025931 Bacteria 775
284 Ga0207644_11234904 3300025931 Bacteria 628
285 Ga0207690_11141533 3300025932 Bacteria 650
286 Ga0207690_11602309 3300025932 Bacteria 544
287 Ga0207706_10262589 3300025933 Bacteria 1507
288 Ga0207706_10555772 3300025933 Bacteria 988
289 Ga0207686_10248729 3300025934 Bacteria 1298
290 Ga0207686_10602832 3300025934 Bacteria 864
291 Ga0207686_11484161 3300025934 Bacteria 559
292 Ga0207709_10673644 3300025935 Bacteria 825
293 Ga0207670_10450495 3300025936 Bacteria 1038
294 Ga0207669_10641752 3300025937 Bacteria 867
295 Ga0207665_10008678 3300025939 Bacteria 6689
296 Ga0207665_10347395 3300025939 Bacteria 1119
297 Ga0207665_10558328 3300025939 Bacteria 890
298 Ga0207691_10167571 3300025940 Bacteria 1925
299 Ga0207691_10349559 3300025940 Bacteria 1265
300 Ga0207711_10075637 3300025941 Bacteria 2931
301 Ga0207711_10429240 3300025941 Bacteria 1229
302 Ga0207711_10635266 3300025941 Bacteria 996
303 Ga0207711_10722898 3300025941 Bacteria 928
304 Ga0207689_10082023 3300025942 Bacteria 2651
305 Ga0207661_10059687 3300025944 Bacteria 3075
306 Ga0207661_10371765 3300025944 Bacteria 1292
307 Ga0207679_10273974 3300025945 Bacteria 1444
308 Ga0207667_10017479 3300025949 Bacteria 8070
309 Ga0207667_10584481 3300025949 Bacteria 1127
310 Ga0207667_11990772 3300025949 Bacteria 541
311 Ga0207651_10626934 3300025960 Bacteria 942
312 Ga0207651_10627788 3300025960 Bacteria 942
313 Ga0207651_10847362 3300025960 Bacteria 812
314 Ga0207668_10065517 3300025972 Bacteria 2572
315 Ga0207668_10485543 3300025972 Bacteria 1060
316 Ga0207640_10192369 3300025981 Bacteria 1539
317 Ga0207658_10373586 3300025986 Bacteria 1247
318 Ga0207658_10396381 3300025986 Bacteria 1212
319 Ga0207658_10954757 3300025986 Bacteria 782
320 Ga0207658_11604635 3300025986 Bacteria 595
321 Ga0207677_10294854 3300026023 Bacteria 1337
322 Ga0207677_10354630 3300026023 Bacteria 1230
323 Ga0207677_11804987 3300026023 Bacteria 568
324 Ga0207703_10040864 3300026035 Bacteria 3713
325 Ga0207703_10085208 3300026035 Bacteria 2644
326 Ga0207703_10208891 3300026035 Bacteria 1739
327 Ga0207639_10207945 3300026041 Bacteria 1683
328 Ga0207639_11083048 3300026041 Bacteria 751
329 Ga0207639_11950597 3300026041 Bacteria 548
330 Ga0207678_10001548 3300026067 Bacteria 21107
331 Ga0207678_10097498 3300026067 Bacteria 2513
332 Ga0207678_10383056 3300026067 Bacteria 1216
333 Ga0207708_10244804 3300026075 Bacteria 1443
334 Ga0207702_10098243 3300026078 Bacteria 2579
335 Ga0207702_10353865 3300026078 Bacteria 1406
336 Ga0207702_10457888 3300026078 Bacteria 1239
337 Ga0207702_11032675 3300026078 Bacteria 816
338 Ga0207702_12108167 3300026078 Bacteria 553
339 Ga0207641_10687188 3300026088 Bacteria 1007
340 Ga0207641_10921094 3300026088 Bacteria 868
341 Ga0207648_10653927 3300026089 Bacteria 972
342 Ga0207676_10163116 3300026095 Bacteria 1933
343 Ga0207676_11960876 3300026095 Bacteria 584
344 Ga0207674_10091512 3300026116 Bacteria 3031
345 Ga0207675_100083520 3300026118 Bacteria 2996
346 Ga0207675_100793244 3300026118 Bacteria 960
347 Ga0207683_10053527 3300026121 Bacteria 3539
348 Ga0207683_10078233 3300026121 Bacteria 2930
349 Ga0207683_10715742 3300026121 Bacteria 928
350 Ga0207698_10119457 3300026142 Bacteria 2228
351 Ga0207698_10589317 3300026142 Bacteria 1095
352 Ga0207698_10629990 3300026142 Bacteria 1060
353 Ga0209589_1000007 3300027357 Bacteria 425699
354 Ga0209489_100008 3300027361 Bacteria 425699
355 Ga0209700_100009 3300027363 Bacteria 425699
356 Ga0209179_1064449 3300027512 Bacteria 798
357 Ga0207428_11040374 3300027907 Bacteria 574
358 Ga0268266_10047343 3300028379 Bacteria 3683
359 Ga0268266_10734540 3300028379 Bacteria 952
360 Ga0268266_10806374 3300028379 Bacteria 907
361 Ga0268266_11847617 3300028379 Bacteria 578
362 Ga0268265_10279740 3300028380 Bacteria 1492
363 Ga0268265_10382809 3300028380 Bacteria 1295
364 Ga0268264_10078188 3300028381 Bacteria 2820
365 Ga0268264_10981477 3300028381 Bacteria 851
366 Ga0307517_10265310 3300028786 Bacteria 993
367 Ga0265332_10016340 3300031238 Bacteria 3275
368 Ga0265329_10075874 3300031242 Bacteria 1064
369 Ga0265339_10146013 3300031249 Bacteria 1200
370 Ga0265339_10252571 3300031249 Bacteria 853
371 Ga0265331_10458451 3300031250 Bacteria 573
372 Ga0265316_10346514 3300031344 Bacteria 1076
373 Ga0307513_10069442 3300031456 Bacteria 3687
374 Ga0307513_10639872 3300031456 Bacteria 771
375 Ga0307509_10292684 3300031507 Bacteria 1382
376 Ga0307508_10016704 3300031616 Bacteria 6678
377 Ga0307508_10073343 3300031616 Bacteria 2999
378 Ga0307508_10760545 3300031616 Bacteria 583
379 Ga0265314_10064325 3300031711 Bacteria 2484
380 Ga0265314_10707810 3300031711 Bacteria 509
381 Ga0265342_10106445 3300031712 Bacteria 1592
382 Ga0307516_10701974 3300031730 Bacteria 669
383 Ga0307510_10016162 3300033180 Bacteria 8815
384 Ga0307510_10370937 3300033180 Bacteria 878
385 Ga0307510_10542227 3300033180 Bacteria 609
386 Ga0315911_1000007 3300033442 Bacteria 413725
387 Ga0373930_0012075 3300034816 Bacteria 1570
388 Ga0373958_0032158 3300034819 Bacteria 1035
389 Ga0373928_0073891 3300035084 Bacteria 848
390 Ga0373944_0066134 3300035089 Bacteria 1169
391 Ga0373949_0019276 3300035090 Bacteria 1553
392 Ga0373952_0004079 3300035092 Bacteria 2639
393 Ga0373936_0021127 3300035113 Bacteria 2531
394 Ga0373945_0401979 3300035116 Bacteria 600
395 Ga0373953_0313880 3300035117 Bacteria 685
396 Ga0373960_0042555 3300035121 Bacteria 1319
397 Ga0373946_0091158 3300035171 Bacteria 1351
398 Ga0373942_0114900 3300035207 Bacteria 836
399 Ga0373931_0045689 3300035691 Bacteria 2313
400 Ga0373927_0038034 3300035695 Bacteria 3126
401 Ga0373927_0114570 3300035695 Bacteria 1757
402 Ga0373937_0724451 3300036401 Bacteria 942
403 Ga0373925_0476915 3300037068 Bacteria 1023
404 Ga0395899_0011735 3300037312 Bacteria 6707
405 Ga0395900_0029270 3300037418 Bacteria 5650
406 Ga0395900_0180834 3300037418 Bacteria 2143
407 Ga0395900_0342994 3300037418 Bacteria 1469
408 Ga0395900_0533361 3300037418 Bacteria 1120
409 Ga0395898_0028926 3300037466 Bacteria 5554
410 Ga0395898_0177700 3300037466 Bacteria 2034
411 Ga0395898_0449571 3300037466 Bacteria 1227
412 Ga0395898_0560758 3300037466 Bacteria 1085
413 Ga0395905_0101770 3300037471 Bacteria 2697
414 Ga0436364_0768188 3300037853 Bacteria 940
415 Ga0395901_0258489 3300038443 Bacteria 1813
416 Ga0395901_0398482 3300038443 Bacteria 1414
417 Ga0395901_0673023 3300038443 Bacteria 1035
418 Ga0436365_0676661 3300039437 Bacteria 1928
419 Ga0436365_1500660 3300039437 Bacteria 1531
420 Ga0451789_1036429 3300041443 Bacteria 637
421 Ga0451793_0588977 3300041452 Bacteria 580
422 Ga0451795_1523887 3300041456 Bacteria 665
423 Ga0451807_2227185 3300041486 Bacteria 696
424 Ga0451833_0420824 3300041491 Bacteria 507
425 Ga0451833_1298259 3300041491 Bacteria 522
426 Ga0451845_0802660 3300041501 Bacteria 1165
427 Ga0451847_1009375 3300041503 Bacteria 541
428 Ga0451849_0294384 3300041505 Bacteria 1592
429 Ga0451843_0198983 3300041509 Bacteria 1664
430 Ga0451843_1691719 3300041509 Bacteria 671
431 Ga0451853_1678333 3300041512 Bacteria 560
432 Ga0466963_0145478 3300044694 Bacteria 1644
433 Ga0495617_107274 3300046452 Bacteria 905
434 Ga0495617_140348 3300046452 Bacteria 772
435 Ga0495592_0574041 3300046454 Bacteria 691
436 Ga0495603_0105357 3300046455 Bacteria 1645
437 Ga0495603_0489808 3300046455 Bacteria 704
438 Ga0495590_0028091 3300046457 Bacteria 1973
439 Ga0495629_0269534 3300046459 Bacteria 1170
440 Ga0495629_0330613 3300046459 Bacteria 1041
441 Ga0495638_0329817 3300046460 Bacteria 812
442 Ga0495582_0197566 3300046473 Bacteria 1148
443 Ga0495605_0054345 3300046474 Bacteria 1940
444 Ga0495605_0120838 3300046474 Bacteria 1188
445 Ga0495639_0337260 3300046475 Bacteria 756
446 Ga0495639_0373428 3300046475 Bacteria 718
447 Ga0495664_0041446 3300046477 Bacteria 2724
448 Ga0495664_0130471 3300046477 Bacteria 1522
449 Ga0495664_0286761 3300046477 Bacteria 994
450 Ga0495584_0270650 3300046491 Bacteria 863
451 Ga0495585_0352012 3300046492 Bacteria 715
452 Ga0495606_0307824 3300046507 Bacteria 856
453 Ga0495610_0223104 3300046512 Bacteria 760
454 Ga0495616_0391449 3300046513 Bacteria 572
455 Ga0495628_0683901 3300046516 Bacteria 726
456 Ga0495630_1102097 3300046517 Bacteria 602
457 Ga0495631_0070148 3300046518 Bacteria 1515
458 Ga0495631_0331341 3300046518 Bacteria 648
459 Ga0495632_0277723 3300046519 Bacteria 746
460 Ga0495632_0390434 3300046519 Bacteria 609
461 Ga0495632_0469302 3300046519 Bacteria 545
462 Ga0495648_0001814 3300046524 Bacteria 20579
463 Ga0495648_0360048 3300046524 Bacteria 662
464 Ga0495609_0100685 3300046538 Bacteria 1252
465 Ga0495597_0252359 3300046542 Bacteria 693
466 Ga0495645_0025138 3300046543 Bacteria 4321
467 Ga0495656_0718901 3300046615 Bacteria 538
468 Ga0495668_0167843 3300046616 Bacteria 1202
469 Ga0495668_0171245 3300046616 Bacteria 1189
470 Ga0495668_0322265 3300046616 Bacteria 848
471 Ga0495611_0013127 3300046648 Bacteria 3523
472 Ga0495611_0369195 3300046648 Bacteria 657
473 Ga0495625_0069787 3300046660 Bacteria 2468
474 Ga0495625_0257217 3300046660 Bacteria 1131
475 Ga0495635_0406563 3300046663 Bacteria 904
476 Ga0495635_1100178 3300046663 Bacteria 503
477 Ga0495599_0480810 3300046678 Bacteria 733
478 Ga0495669_0253117 3300046684 Bacteria 846
479 Ga0495669_0459690 3300046684 Bacteria 618
480 Ga0495613_0737621 3300046689 Bacteria 646
481 Ga0495671_0164710 3300046692 Bacteria 1078
482 Ga0495671_0554614 3300046692 Bacteria 547
483 Ga0495649_0360692 3300046694 Bacteria 733
484 Ga0495589_0145496 3300046794 Bacteria 1133
485 Ga0495581_0069399 3300047315 Bacteria 2038
486 Ga0495581_0229894 3300047315 Bacteria 1085
487 Ga0495581_0649275 3300047315 Bacteria 610
488 Ga0495636_0683595 3300047318 Bacteria 506
489 Ga0495674_0414662 3300047319 Bacteria 1086
490 Ga0495672_0026055 3300047320 Bacteria 3734
491 Ga0495672_0277294 3300047320 Bacteria 803
492 Ga0495683_0063517 3300047323 Bacteria 1824
493 Ga0495673_0045322 3300047469 Bacteria 1956
494 Ga0495673_0274224 3300047469 Bacteria 610
495 Ga0495673_0298270 3300047469 Bacteria 578
496 Ga0495593_0084864 3300047673 Bacteria 1634
497 Ga0495626_0085183 3300048091 Bacteria 1398
498 Ga0496100_0006638 3300048903 Bacteria 6325
499 Ga0496100_0028338 3300048903 Bacteria 3454
500 Ga0496100_0956776 3300048903 Bacteria 673
501 Ga0496100_0974031 3300048903 Bacteria 667
502 Ga0496101_0007920 3300048904 Bacteria 6919
503 Ga0496101_0046771 3300048904 Bacteria 3104
504 Ga0496101_0117756 3300048904 Bacteria 2006
505 Ga0496101_0193827 3300048904 Bacteria 1569
506 Ga0496102_0043565 3300048905 Bacteria 4070
507 Ga0496103_0176866 3300048906 Bacteria 1371
508 Ga0496103_0502303 3300048906 Bacteria 776
509 Ga0496103_0507638 3300048906 Bacteria 771
510 Ga0496104_0043943 3300048907 Bacteria 4197
511 Ga0496104_0081674 3300048907 Bacteria 3082
512 Ga0496104_1517263 3300048907 Bacteria 573
513 Ga0496105_0156482 3300048908 Bacteria 1871
514 Ga0496105_0189607 3300048908 Bacteria 1681
515 Ga0496106_0045000 3300048909 Bacteria 3315
516 Ga0496106_0061300 3300048909 Bacteria 2853
517 Ga0496107_0018548 3300048910 Bacteria 4900
518 Ga0496107_0021634 3300048910 Bacteria 4546
519 Ga0496108_0021262 3300048911 Bacteria 5332
520 Ga0496108_0029675 3300048911 Bacteria 4531
521 Ga0496109_0042706 3300048912 Bacteria 4108
522 Ga0496109_0052111 3300048912 Bacteria 3729
523 Ga0496109_0555614 3300048912 Bacteria 1083
524 Ga0496109_1593284 3300048912 Bacteria 587
525 Ga0496110_0064725 3300048913 Bacteria 3232
526 Ga0496110_0102438 3300048913 Bacteria 2567
527 Ga0496110_0186136 3300048913 Bacteria 1885
528 Ga0496111_0018698 3300048914 Bacteria 4803
529 Ga0496111_0082724 3300048914 Bacteria 2345
530 Ga0496111_0173492 3300048914 Bacteria 1602
531 Ga0496112_0037494 3300048915 Bacteria 4730
532 Ga0496112_0100823 3300048915 Bacteria 2857
533 Ga0496112_0119589 3300048915 Bacteria 2604
534 Ga0496113_0081275 3300048916 Bacteria 2483
535 Ga0496113_0187597 3300048916 Bacteria 1641
536 Ga0496113_0462124 3300048916 Bacteria 1020
537 Ga0496114_0029791 3300048917 Bacteria 4487
538 Ga0496114_0038345 3300048917 Bacteria 3964
539 Ga0496114_0620769 3300048917 Bacteria 952
540 Ga0496114_1388524 3300048917 Unclassified 590
541 Ga0496114_1593974 3300048917 Bacteria 541
542 Ga0496115_0006984 3300048918 Bacteria 8292
543 Ga0496115_0042384 3300048918 Bacteria 3626
544 Ga0496115_0066495 3300048918 Bacteria 2913
545 Ga0496117_0175055 3300048920 Bacteria 1241
546 Ga0496117_0273179 3300048920 Bacteria 909
547 Ga0496118_0054755 3300048921 Bacteria 3018
548 Ga0496118_0410854 3300048921 Bacteria 700
549 Ga0496119_0048095 3300048922 Bacteria 2648
550 Ga0496119_0411729 3300048922 Bacteria 643
551 Ga0496119_0568329 3300048922 Bacteria 519
552 Ga0496120_0160270 3300048923 Bacteria 1122
553 Ga0496121_0000694 3300048924 Bacteria 62818
554 Ga0496121_0021658 3300048924 Bacteria 6285
555 Ga0496121_0028340 3300048924 Bacteria 5215
556 Ga0496121_0117643 3300048924 Bacteria 2013
557 Ga0496121_0174105 3300048924 Bacteria 1560
558 Ga0496121_0408454 3300048924 Bacteria 887
559 Ga0496121_0679932 3300048924 Bacteria 622
560 Ga0496124_0315908 3300048927 Bacteria 1121
561 Ga0496125_0001356 3300048928 Bacteria 36075
562 Ga0496126_0011721 3300048929 Bacteria 9035
563 Ga0496126_0044078 3300048929 Bacteria 4111
564 Ga0496126_0069609 3300048929 Bacteria 3138
565 Ga0496126_0085753 3300048929 Bacteria 2776
566 Ga0496126_0409988 3300048929 Bacteria 1097
567 Ga0496126_0627339 3300048929 Bacteria 844
568 Ga0496126_0867442 3300048929 Bacteria 687
569 Ga0495682_0030141 3300049460 Bacteria 2008
570 Ga0501032_0039634 3300049569 Bacteria 3204
571 Ga0501033_0444201 3300049570 Bacteria 901
572 Ga0501034_0392672 3300049571 Bacteria 1311
573 Ga0501034_0409873 3300049571 Bacteria 1277
574 Ga0501036_0091284 3300049572 Bacteria 2573
575 Ga0501036_0413952 3300049572 Bacteria 1124
576 Ga0501037_0095528 3300049573 Bacteria 2149
577 Ga0501038_0022226 3300049574 Bacteria 5685
578 Ga0501039_0351247 3300049575 Bacteria 1159
579 Ga0501046_0047335 3300049580 Bacteria 3409
580 Ga0501047_0267343 3300049581 Bacteria 1556
581 Ga0501047_0625175 3300049581 Bacteria 897
582 Ga0501073_0453273 3300049589 Bacteria 887
583 Ga0501035_0040123 3300049822 Bacteria 4232
584 Ga0501044_0388754 3300049823 Bacteria 1309
585 Ga0501044_0457054 3300049823 Bacteria 1183
586 Ga0501044_0725695 3300049823 Bacteria 877
587 nmdc:mga03n38_105660_c1 3300050490 Bacteria 1364
588 nmdc:mga03n38_371691_c1 3300050490 Bacteria 782
589 nmdc:mga00v17_340410_c1 3300050491 Bacteria 975
590 nmdc:mga0yw44_660010_c1 3300050492 Bacteria 711
591 nmdc:mga0k408_385760_c1 3300050493 Bacteria 834
592 nmdc:mga06z11_314855_c1 3300050494 Bacteria 933
593 nmdc:mga06z11_945079_c1 3300050494 Bacteria 525
594 nmdc:mga07m45_115850_c1 3300050496 Bacteria 1545
595 nmdc:mga07m45_164237_c1 3300050496 Bacteria 1290
596 nmdc:mga0n895_57360_c1 3300050512 Bacteria 3838
597 nmdc:mga0sz30_500911_c1 3300050516 Bacteria 546
598 Ga0495601_0052277 3300053077 Bacteria 2579
599 Ga0495601_0955951 3300053077 Unclassified 540
600 Ga0495612_0010804 3300053078 Bacteria 3688
601 Ga0495612_0027732 3300053078 Bacteria 2278
602 Ga0495612_0195190 3300053078 Bacteria 892
603 Ga0500610_0136100 3300053079 Bacteria 1245
604 Ga0495655_0308442 3300053083 Bacteria 545
605 Ga0495595_0020207 3300053084 Bacteria 2897
606 Ga0495595_0176010 3300053084 Bacteria 1060
607 Ga0495619_0550298 3300053085 Unclassified 792
608 Ga0500643_021133 3300053087 Bacteria 2115
609 Ga0500583_0180428 3300053092 Bacteria 1051
610 Ga0500651_0003169 3300053093 Bacteria 8925
611 Ga0500651_0080416 3300053093 Bacteria 2018
612 Ga0500651_0610471 3300053093 Bacteria 591
613 Ga0500566_0000227 3300053094 Bacteria 30040
614 Ga0500566_0092665 3300053094 Bacteria 1668
615 Ga0500566_0175019 3300053094 Bacteria 1106
616 Ga0500640_053596 3300053095 Bacteria 1760
617 Ga0500641_0005301 3300053096 Bacteria 4567
618 Ga0500650_0114433 3300053098 Bacteria 1259
619 Ga0500554_001458 3300053102 Bacteria 4573
620 Ga0500554_047736 3300053102 Bacteria 1337
621 Ga0500556_0129434 3300053104 Bacteria 989
622 Ga0500562_113385 3300053108 Bacteria 738
623 Ga0500569_010672 3300053109 Bacteria 2173
624 Ga0500572_001007 3300053111 Bacteria 8500
625 Ga0500591_049612 3300053115 Bacteria 1971
626 Ga0500594_0093606 3300053118 Bacteria 916
627 Ga0500595_009636 3300053119 Bacteria 3889
628 Ga0500595_019154 3300053119 Bacteria 2488
629 Ga0500595_131433 3300053119 Bacteria 704
630 Ga0500608_005463 3300053122 Bacteria 5054
631 Ga0500614_000333 3300053123 Bacteria 12176
632 Ga0500642_0046031 3300053130 Bacteria 1906
633 Ga0500642_0101179 3300053130 Bacteria 1340
634 Ga0500655_021201 3300053133 Bacteria 1218
635 Ga0500658_0081775 3300053134 Bacteria 1382
636 Ga0500559_0009933 3300053136 Bacteria 4099
637 Ga0500561_0034062 3300053137 Bacteria 1305
638 Ga0500568_0085276 3300053139 Bacteria 1196
639 Ga0500568_0150151 3300053139 Bacteria 862
640 Ga0500577_0021348 3300053142 Bacteria 2132
641 Ga0500603_000146 3300053150 Bacteria 17086
642 Ga0500603_000677 3300053150 Bacteria 8300
643 Ga0500603_021211 3300053150 Bacteria 1595
644 Ga0500604_0034127 3300053151 Bacteria 1508
645 Ga0500616_0000048 3300053153 Bacteria 313108
646 Ga0500616_0387382 3300053153 Bacteria 561
647 Ga0500622_0041207 3300053156 Bacteria 2404
648 Ga0500622_0121599 3300053156 Bacteria 1265
649 Ga0500627_0135337 3300053158 Bacteria 1113
650 Ga0500627_0208300 3300053158 Bacteria 875
651 Ga0500627_0270079 3300053158 Bacteria 749
652 Ga0500630_000387 3300053159 Bacteria 18759
653 Ga0500633_0126610 3300053160 Bacteria 952
654 Ga0500634_0040459 3300053161 Bacteria 2533
655 Ga0500634_0095689 3300053161 Bacteria 1497
656 Ga0500634_0119442 3300053161 Bacteria 1286
657 Ga0500638_010285 3300053162 Bacteria 4089
658 Ga0500638_041227 3300053162 Bacteria 2242
659 Ga0500638_119584 3300053162 Bacteria 1207
660 Ga0500639_000022 3300053163 Bacteria 87814
661 Ga0500639_179006 3300053163 Bacteria 940
662 Ga0500639_255049 3300053163 Bacteria 699
663 Ga0500636_0045778 3300053177 Bacteria 2580
664 Ga0500637_0000490 3300053178 Bacteria 15336
665 Ga0500637_0004706 3300053178 Bacteria 6521
666 Ga0500637_0011647 3300053178 Bacteria 4555
667 Ga0500637_0626331 3300053178 Bacteria 504
668 Ga0500645_065697 3300053730 Bacteria 1045
669 Ga0500609_021050 3300053731 Bacteria 890
670 Ga0500596_000113 3300053735 Bacteria 11428
671 Ga0500601_003314 3300053737 Bacteria 1749
672 Ga0500661_000389 3300055283 Bacteria 8086
673 Ga0587072_124152 3300059643 Bacteria 601
674 2728752199 2728368998 Bacteria 8720350
675 2513657803 2513237096 Bacteria 8722461
676 2513861516 2513237137 Bacteria 9558895
677 2513919801 2513237145 Bacteria 8979722
678 2517895188 2517572143 Bacteria 9484767
679 2524536313 2524023228 Bacteria 10118060
680 2644291252 2643221651 Bacteria 4798932
681 2671121788 2667528175 Bacteria 7532676
682 2793069135 2791355197 Bacteria 8420563
683 2885379186 2885374607 Bacteria 8927485
684 2903754260 2903748898 Bacteria 9972761
685 2903773837 2903768456 Bacteria 9749579
686 2904699975
687 2906611856
688 2908740622 2908739725 Bacteria 8628932
689 2922427442
690 2935637145 2935630451 Bacteria 8169952
691 2941513768 2941507105 Bacteria 8166816
692 2941521730 2941515067 Bacteria 8166720
693 2941529660 2941523033 Bacteria 8169134
694 3005477157 3005474847 Bacteria 9259049
695 8006938368 8006933436 Bacteria 10410654
696 8006978445 8006973647 Bacteria 10679141
697 8019560662 8019555841 Bacteria 9642137
698 8019570744 8019565922 Bacteria 9639779
699 8056691545 8056689827 Bacteria 6712655
700 JGI25153J46596_10131323
701 JGI25404J52841_10061817
702 Ga0070658_10407074
703 Ga0070683_100042499
704 Ga0070683_100056364
705 Ga0070690_100183738
706 Ga0070670_101176106
707 Ga0070670_101450793
708 Ga0068869_100053868
709 Ga0070680_100075097
710 Ga0070682_100059813
711 Ga0068868_100136957
712 Ga0068868_101700202
713 Ga0068868_101873243
714 Ga0070660_100566883
715 Ga0070660_101356212
716 Ga0070689_100534730
717 Ga0070661_100732584
718 Ga0070668_100107696
719 Ga0070668_100382147
720 Ga0070668_100661387
721 Ga0070668_101089689
722 Ga0070669_100080985
723 Ga0070675_100161791
724 Ga0070671_100070986
725 Ga0070671_100148388
726 Ga0070671_100367453
727 Ga0070674_100103240
728 Ga0070673_100609202
729 Ga0070673_101925155
730 Ga0070673_102130187
731 Ga0070659_101055899
732 Ga0070667_100055692
733 Ga0070667_100462837
734 Ga0070703_10574108
735 Ga0070709_10202394
736 Ga0070709_11810817
737 Ga0070714_100383378
738 Ga0070714_100449817
739 Ga0070714_101648562
740 Ga0070713_100028808
741 Ga0070713_100064887
742 Ga0070713_100316547
743 Ga0070713_101221750
744 Ga0070710_10085655
745 Ga0070701_10857686
746 Ga0070711_100313034
747 Ga0070711_100595140
748 Ga0070711_100893270
749 Ga0070711_101354672
750 Ga0070711_101775693
751 Ga0070700_100184163
752 Ga0070708_100151186
753 Ga0070663_100011621
754 Ga0070663_100108464
755 Ga0070663_100282495
756 Ga0070678_100021815
757 Ga0070678_100062650
758 Ga0070678_100651821
759 Ga0070662_100441743
760 Ga0070662_101366652
761 Ga0070681_10008235
762 Ga0070681_11669744
763 Ga0070698_100133084
764 Ga0070679_100090647
765 Ga0070679_101791317
766 Ga0070684_100008771
767 Ga0070684_100084879
768 Ga0070684_101011461
769 Ga0070697_100125686
770 Ga0068853_100244167
771 Ga0068853_100284915
772 Ga0068853_101000637
773 Ga0070672_100437106
774 Ga0070672_100466077
775 Ga0070672_100501887
776 Ga0070686_100508407
777 Ga0070693_100061213
778 Ga0070665_100412826
779 Ga0070665_100518532
780 Ga0070665_100634445
781 Ga0070665_100736636
782 Ga0070665_100819002
783 Ga0070665_101603322
784 Ga0068855_100022919
785 Ga0068855_100485355
786 Ga0068855_101476620
787 Ga0070664_100105287
788 Ga0070664_100424938
789 Ga0068857_100430156
790 Ga0068854_100392749
791 Ga0068854_100570190
792 Ga0068856_102382648
793 Ga0070702_100025631
794 Ga0068852_100260652
795 Ga0068852_100431132
796 Ga0068852_101657979
797 Ga0068852_102147104
798 Ga0068859_100307203
799 Ga0068859_101612069
800 Ga0068864_100053191
801 Ga0068864_100211139
802 Ga0068851_10164824
803 Ga0068851_10687349
804 Ga0068851_10858219
805 Ga0068870_10090642
806 Ga0068870_10511798
807 Ga0068863_100121260
808 Ga0068863_100790677
809 Ga0068863_101265942
810 Ga0068863_102042851
811 Ga0068858_100144196
812 Ga0068858_100231768
813 Ga0068860_100139579
814 Ga0068860_100471803
815 Ga0068862_100046278
816 Ga0068862_101378050
817 Ga0068862_101787865
818 Ga0081540_1002276
819 Ga0081540_1004490
820 Ga0081540_1006058
821 Ga0081540_1070029
822 Ga0070717_10005303
823 Ga0070717_10067889
824 Ga0075365_10081906
825 Ga0075365_10442064
826 Ga0075368_10080951
827 Ga0075363_100054735
828 Ga0075363_100130463
829 Ga0075364_10603687
830 Ga0075364_10904021
831 Ga0075432_10353709
832 Ga0070716_100215571
833 Ga0070716_100605093
834 Ga0070712_100776231
835 Ga0075362_10674674
836 Ga0075367_10293896
837 Ga0075367_10388120
838 Ga0075366_10418377
839 Ga0075366_10895474
840 Ga0097621_100073701
841 Ga0097621_100155850
842 Ga0097621_100429159
843 Ga0097621_100622226
844 Ga0075370_10060580
845 Ga0075370_10114676
846 Ga0068871_100026822
847 Ga0068871_100599462
848 Ga0068871_100969036
849 Ga0068871_101550777
850 Ga0068871_101861822
851 Ga0075428_102282967
852 Ga0075433_10729797
853 Ga0068865_100113968
854 Ga0068865_100529353
855 Ga0097620_100307201
856 Ga0097620_101612024
857 Ga0099825_1052548
858 Ga0099824_1018832
859 Ga0099822_1000838
860 Ga0075435_100089011
861 Ga0099795_10065659
862 Ga0099795_10155070
863 Ga0105240_10073201
864 Ga0105240_10211364
865 Ga0105240_12129954
866 Ga0111539_11994172
867 Ga0105245_10070905
868 Ga0105245_10074274
869 Ga0105245_10900043
870 Ga0105245_11041888
871 Ga0105245_12435539
872 Ga0105247_10182598
873 Ga0105247_10209109
874 Ga0105247_10386982
875 Ga0105247_11266367
876 Ga0105247_11346337
877 Ga0105243_10390532
878 Ga0105243_10598324
879 Ga0105241_11196229
880 Ga0105242_10305234
881 Ga0105242_10777990
882 Ga0105242_11638275
883 Ga0105248_10127451
884 Ga0105248_10173880
885 Ga0105248_10516593
886 Ga0105248_10871609
887 Ga0105237_10020091
888 Ga0105237_10026866
889 Ga0105237_10158711
890 Ga0105237_10741546
891 Ga0105237_10963100
892 Ga0105238_11190304
893 Ga0105249_12357818
894 Ga0105249_12645319
895 Ga0099796_10080942
896 Ga0099796_10293340
897 Ga0105239_10063316
898 Ga0105239_10103929
899 Ga0105239_10147003
900 Ga0105239_11079308
901 Ga0105239_11519318
902 Ga0105246_10047348
903 Ga0105246_10145114
904 Ga0105246_10303846
905 Ga0105246_10404574
906 Ga0105246_12407841
907 Ga0157328_1008654
908 Ga0157371_10323694
909 Ga0157370_10094735
910 Ga0157374_10055751
911 Ga0157374_10512634
912 Ga0157378_10013088
913 Ga0157378_10949310
914 Ga0157378_13270753
915 Ga0163162_10184920
916 Ga0163162_10400533
917 Ga0163162_10911776
918 Ga0163162_11014683
919 Ga0157375_10565643
920 Ga0157375_10568486
921 Ga0157375_11212103
922 Ga0157375_13303599
923 Ga0163163_10142478
924 Ga0163163_10224830
925 Ga0163163_11319173
926 Ga0157380_10094656
927 Ga0157380_10394607
928 Ga0157377_10391588
929 Ga0157379_10204693
930 Ga0157379_10471505
931 Ga0157379_10593082
932 Ga0157379_11144661
933 Ga0157376_10011395
934 Ga0157376_10122918
935 Ga0157376_10189028
936 Ga0157376_10942176
937 Ga0157376_12794176
938 Ga0163161_10171181
939 Ga0213876_10031481
940 Ga0209233_1019117
941 Ga0209758_1002604
942 Ga0207426_1156950
943 Ga0207697_10066469
944 Ga0207656_10526389
945 Ga0207692_10445029
946 Ga0207710_10142826
947 Ga0207710_10165652
948 Ga0207710_10720346
949 Ga0207688_10010777
950 Ga0207688_10074554
951 Ga0207680_10629438
952 Ga0207647_10107847
953 Ga0207699_10203456
954 Ga0207645_10907584
955 Ga0207705_10505087
956 Ga0207684_10060295
957 Ga0207707_10036020
958 Ga0207671_10069722
959 Ga0207671_10233362
960 Ga0207671_11115809
961 Ga0207663_10673982
962 Ga0207663_10754878
963 Ga0207660_10034686
964 Ga0207657_11035617
965 Ga0207649_10744728
966 Ga0207652_10051300
967 Ga0207652_10053418
968 Ga0207646_10173681
969 Ga0207681_10234859
970 Ga0207650_11089957
971 Ga0207650_11249186
972 Ga0207659_10311190
973 Ga0207687_10478451
974 Ga0207687_10945502
975 Ga0207700_10015790
976 Ga0207700_10065827
977 Ga0207700_10830083
978 Ga0207664_10191238
979 Ga0207664_10328910
980 Ga0207644_10087799
981 Ga0207644_10141764
982 Ga0207644_10826325
983 Ga0207644_11234904
984 Ga0207690_11141533
985 Ga0207690_11602309
986 Ga0207706_10262589
987 Ga0207706_10555772
988 Ga0207686_10248729
989 Ga0207686_10602832
990 Ga0207686_11484161
991 Ga0207709_10673644
992 Ga0207670_10450495
993 Ga0207669_10641752
994 Ga0207665_10008678
995 Ga0207665_10347395
996 Ga0207665_10558328
997 Ga0207691_10167571
998 Ga0207691_10349559
999 Ga0207711_10075637
1000 Ga0207711_10429240
1001 Ga0207711_10635266
1002 Ga0207711_10722898
1003 Ga0207689_10082023
1004 Ga0207661_10059687
1005 Ga0207661_10371765
1006 Ga0207679_10273974
1007 Ga0207667_10017479
1008 Ga0207667_10584481
1009 Ga0207667_11990772
1010 Ga0207651_10626934
1011 Ga0207651_10627788
1012 Ga0207651_10847362
1013 Ga0207668_10065517
1014 Ga0207668_10485543
1015 Ga0207640_10192369
1016 Ga0207658_10373586
1017 Ga0207658_10396381
1018 Ga0207658_10954757
1019 Ga0207658_11604635
1020 Ga0207677_10294854
1021 Ga0207677_10354630
1022 Ga0207677_11804987
1023 Ga0207703_10040864
1024 Ga0207703_10085208
1025 Ga0207703_10208891
1026 Ga0207639_10207945
1027 Ga0207639_11083048
1028 Ga0207639_11950597
1029 Ga0207678_10001548
1030 Ga0207678_10097498
1031 Ga0207678_10383056
1032 Ga0207708_10244804
1033 Ga0207702_10098243
1034 Ga0207702_10353865
1035 Ga0207702_10457888
1036 Ga0207702_11032675
1037 Ga0207702_12108167
1038 Ga0207641_10687188
1039 Ga0207641_10921094
1040 Ga0207648_10653927
1041 Ga0207676_10163116
1042 Ga0207676_11960876
1043 Ga0207674_10091512
1044 Ga0207675_100083520
1045 Ga0207675_100793244
1046 Ga0207683_10053527
1047 Ga0207683_10078233
1048 Ga0207683_10715742
1049 Ga0207698_10119457
1050 Ga0207698_10589317
1051 Ga0207698_10629990
1052 Ga0209589_1000007
1053 Ga0209489_100008
1054 Ga0209700_100009
1055 Ga0209179_1064449
1056 Ga0207428_11040374
1057 Ga0268266_10047343
1058 Ga0268266_10734540
1059 Ga0268266_10806374
1060 Ga0268266_11847617
1061 Ga0268265_10279740
1062 Ga0268265_10382809
1063 Ga0268264_10078188
1064 Ga0268264_10981477
1065 Ga0307517_10265310
1066 Ga0265332_10016340
1067 Ga0265329_10075874
1068 Ga0265339_10146013
1069 Ga0265339_10252571
1070 Ga0265331_10458451
1071 Ga0265316_10346514
1072 Ga0307513_10069442
1073 Ga0307513_10639872
1074 Ga0307509_10292684
1075 Ga0307508_10016704
1076 Ga0307508_10073343
1077 Ga0307508_10760545
1078 Ga0265314_10064325
1079 Ga0265314_10707810
1080 Ga0265342_10106445
1081 Ga0307516_10701974
1082 Ga0307510_10016162
1083 Ga0307510_10370937
1084 Ga0307510_10542227
1085 Ga0315911_1000007
1086 Ga0373930_0012075
1087 Ga0373958_0032158
1088 Ga0373928_0073891
1089 Ga0373944_0066134
1090 Ga0373949_0019276
1091 Ga0373952_0004079
1092 Ga0373936_0021127
1093 Ga0373945_0401979
1094 Ga0373953_0313880
1095 Ga0373960_0042555
1096 Ga0373946_0091158
1097 Ga0373942_0114900
1098 Ga0373931_0045689
1099 Ga0373927_0038034
1100 Ga0373927_0114570
1101 Ga0373937_0724451
1102 Ga0373925_0476915
1103 Ga0395899_0011735
1104 Ga0395900_0029270
1105 Ga0395900_0180834
1106 Ga0395900_0342994
1107 Ga0395900_0533361
1108 Ga0395898_0028926
1109 Ga0395898_0177700
1110 Ga0395898_0449571
1111 Ga0395898_0560758
1112 Ga0395905_0101770
1113 Ga0436364_0768188
1114 Ga0395901_0258489
1115 Ga0395901_0398482
1116 Ga0395901_0673023
1117 Ga0436365_0676661
1118 Ga0436365_1500660
1119 Ga0451789_1036429
1120 Ga0451793_0588977
1121 Ga0451795_1523887
1122 Ga0451807_2227185
1123 Ga0451833_0420824
1124 Ga0451833_1298259
1125 Ga0451845_0802660
1126 Ga0451847_1009375
1127 Ga0451849_0294384
1128 Ga0451843_0198983
1129 Ga0451843_1691719
1130 Ga0451853_1678333
1131 Ga0466963_0145478
1132 Ga0495617_107274
1133 Ga0495617_140348
1134 Ga0495592_0574041
1135 Ga0495603_0105357
1136 Ga0495603_0489808
1137 Ga0495590_0028091
1138 Ga0495629_0269534
1139 Ga0495629_0330613
1140 Ga0495638_0329817
1141 Ga0495582_0197566
1142 Ga0495605_0054345
1143 Ga0495605_0120838
1144 Ga0495639_0337260
1145 Ga0495639_0373428
1146 Ga0495664_0041446
1147 Ga0495664_0130471
1148 Ga0495664_0286761
1149 Ga0495584_0270650
1150 Ga0495585_0352012
1151 Ga0495606_0307824
1152 Ga0495610_0223104
1153 Ga0495616_0391449
1154 Ga0495628_0683901
1155 Ga0495630_1102097
1156 Ga0495631_0070148
1157 Ga0495631_0331341
1158 Ga0495632_0277723
1159 Ga0495632_0390434
1160 Ga0495632_0469302
1161 Ga0495648_0001814
1162 Ga0495648_0360048
1163 Ga0495609_0100685
1164 Ga0495597_0252359
1165 Ga0495645_0025138
1166 Ga0495656_0718901
1167 Ga0495668_0167843
1168 Ga0495668_0171245
1169 Ga0495668_0322265
1170 Ga0495611_0013127
1171 Ga0495611_0369195
1172 Ga0495625_0069787
1173 Ga0495625_0257217
1174 Ga0495635_0406563
1175 Ga0495635_1100178
1176 Ga0495599_0480810
1177 Ga0495669_0253117
1178 Ga0495669_0459690
1179 Ga0495613_0737621
1180 Ga0495671_0164710
1181 Ga0495671_0554614
1182 Ga0495649_0360692
1183 Ga0495589_0145496
1184 Ga0495581_0069399
1185 Ga0495581_0229894
1186 Ga0495581_0649275
1187 Ga0495636_0683595
1188 Ga0495674_0414662
1189 Ga0495672_0026055
1190 Ga0495672_0277294
1191 Ga0495683_0063517
1192 Ga0495673_0045322
1193 Ga0495673_0274224
1194 Ga0495673_0298270
1195 Ga0495593_0084864
1196 Ga0495626_0085183
1197 Ga0496100_0006638
1198 Ga0496100_0028338
1199 Ga0496100_0956776
1200 Ga0496100_0974031
1201 Ga0496101_0007920
1202 Ga0496101_0046771
1203 Ga0496101_0117756
1204 Ga0496101_0193827
1205 Ga0496102_0043565
1206 Ga0496103_0176866
1207 Ga0496103_0502303
1208 Ga0496103_0507638
1209 Ga0496104_0043943
1210 Ga0496104_0081674
1211 Ga0496104_1517263
1212 Ga0496105_0156482
1213 Ga0496105_0189607
1214 Ga0496106_0045000
1215 Ga0496106_0061300
1216 Ga0496107_0018548
1217 Ga0496107_0021634
1218 Ga0496108_0021262
1219 Ga0496108_0029675
1220 Ga0496109_0042706
1221 Ga0496109_0052111
1222 Ga0496109_0555614
1223 Ga0496109_1593284
1224 Ga0496110_0064725
1225 Ga0496110_0102438
1226 Ga0496110_0186136
1227 Ga0496111_0018698
1228 Ga0496111_0082724
1229 Ga0496111_0173492
1230 Ga0496112_0037494
1231 Ga0496112_0100823
1232 Ga0496112_0119589
1233 Ga0496113_0081275
1234 Ga0496113_0187597
1235 Ga0496113_0462124
1236 Ga0496114_0029791
1237 Ga0496114_0038345
1238 Ga0496114_0620769
1239 Ga0496114_1388524
1240 Ga0496114_1593974
1241 Ga0496115_0006984
1242 Ga0496115_0042384
1243 Ga0496115_0066495
1244 Ga0496117_0175055
1245 Ga0496117_0273179
1246 Ga0496118_0054755
1247 Ga0496118_0410854
1248 Ga0496119_0048095
1249 Ga0496119_0411729
1250 Ga0496119_0568329
1251 Ga0496120_0160270
1252 Ga0496121_0000694
1253 Ga0496121_0021658
1254 Ga0496121_0028340
1255 Ga0496121_0117643
1256 Ga0496121_0174105
1257 Ga0496121_0408454
1258 Ga0496121_0679932
1259 Ga0496124_0315908
1260 Ga0496125_0001356
1261 Ga0496126_0011721
1262 Ga0496126_0044078
1263 Ga0496126_0069609
1264 Ga0496126_0085753
1265 Ga0496126_0409988
1266 Ga0496126_0627339
1267 Ga0496126_0867442
1268 Ga0495682_0030141
1269 Ga0501032_0039634
1270 Ga0501033_0444201
1271 Ga0501034_0392672
1272 Ga0501034_0409873
1273 Ga0501036_0091284
1274 Ga0501036_0413952
1275 Ga0501037_0095528
1276 Ga0501038_0022226
1277 Ga0501039_0351247
1278 Ga0501046_0047335
1279 Ga0501047_0267343
1280 Ga0501047_0625175
1281 Ga0501073_0453273
1282 Ga0501035_0040123
1283 Ga0501044_0388754
1284 Ga0501044_0457054
1285 Ga0501044_0725695
1286 nmdc:mga03n38_105660_c1
1287 nmdc:mga03n38_371691_c1
1288 nmdc:mga00v17_340410_c1
1289 nmdc:mga0yw44_660010_c1
1290 nmdc:mga0k408_385760_c1
1291 nmdc:mga06z11_314855_c1
1292 nmdc:mga06z11_945079_c1
1293 nmdc:mga07m45_115850_c1
1294 nmdc:mga07m45_164237_c1
1295 nmdc:mga0n895_57360_c1
1296 nmdc:mga0sz30_500911_c1
1297 Ga0495601_0052277
1298 Ga0495601_0955951
1299 Ga0495612_0010804
1300 Ga0495612_0027732
1301 Ga0495612_0195190
1302 Ga0500610_0136100
1303 Ga0495655_0308442
1304 Ga0495595_0020207
1305 Ga0495595_0176010
1306 Ga0495619_0550298
1307 Ga0500643_021133
1308 Ga0500583_0180428
1309 Ga0500651_0003169
1310 Ga0500651_0080416
1311 Ga0500651_0610471
1312 Ga0500566_0000227
1313 Ga0500566_0092665
1314 Ga0500566_0175019
1315 Ga0500640_053596
1316 Ga0500641_0005301
1317 Ga0500650_0114433
1318 Ga0500554_001458
1319 Ga0500554_047736
1320 Ga0500556_0129434
1321 Ga0500562_113385
1322 Ga0500569_010672
1323 Ga0500572_001007
1324 Ga0500591_049612
1325 Ga0500594_0093606
1326 Ga0500595_009636
1327 Ga0500595_019154
1328 Ga0500595_131433
1329 Ga0500608_005463
1330 Ga0500614_000333
1331 Ga0500642_0046031
1332 Ga0500642_0101179
1333 Ga0500655_021201
1334 Ga0500658_0081775
1335 Ga0500559_0009933
1336 Ga0500561_0034062
1337 Ga0500568_0085276
1338 Ga0500568_0150151
1339 Ga0500577_0021348
1340 Ga0500603_000146
1341 Ga0500603_000677
1342 Ga0500603_021211
1343 Ga0500604_0034127
1344 Ga0500616_0000048
1345 Ga0500616_0387382
1346 Ga0500622_0041207
1347 Ga0500622_0121599
1348 Ga0500627_0135337
1349 Ga0500627_0208300
1350 Ga0500627_0270079
1351 Ga0500630_000387
1352 Ga0500633_0126610
1353 Ga0500634_0040459
1354 Ga0500634_0095689
1355 Ga0500634_0119442
1356 Ga0500638_010285
1357 Ga0500638_041227
1358 Ga0500638_119584
1359 Ga0500639_000022
1360 Ga0500639_179006
1361 Ga0500639_255049
1362 Ga0500636_0045778
1363 Ga0500637_0000490
1364 Ga0500637_0004706
1365 Ga0500637_0011647
1366 Ga0500637_0626331
1367 Ga0500645_065697
1368 Ga0500609_021050
1369 Ga0500596_000113
1370 Ga0500601_003314
1371 Ga0500661_000389
1372 Ga0587072_124152
1373 2728752199
1374 2513657803
1375 2513861516
1376 2513919801
1377 2517895188
1378 2524536313
1379 2644291252
1380 2671121788
1381 2793069135
1382 2885379186
1383 2903754260
1384 2903773837
1385 2904699975
1386 2906611856
1387 2908740622
1388 2922427442
1389 2935637145
1390 2941513768
1391 2941521730
1392 2941529660
1393 3005477157
1394 8006938368
1395 8006978445
1396 8019560662
1397 8019570744
1398 8056691545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca4-assembly1.cif.gz_B sulfite dehydrogenase from starkeya novella mutant 0.8648 25 105
2ca4-assembly1.cif.gz_B sulfite dehydrogenase from starkeya novella mutant 0.855 25 105
1jmx-assembly1.cif.gz_A crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida 0.6853 45 101
1pby-assembly1.cif.gz_A structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution 0.6703 41 101
3a9f-assembly2.cif.gz_B crystal structure of the c-terminal domain of cytochrome cz from chlorobium tepidum 0.6191 31 105
ID Description Score Start End Superfamily
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9218 43 105 1.10.760.10
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8816 43 105 1.10.760.10
3a9fA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7122 43 105 1.10.760.10
3a9fB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7049 43 105 1.10.760.10
3a9fA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.658 43 105 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A023XAN8-F1-model_v4 deleted 0.9209 24 105
AF-A0A525KDH0-F1-model_v4 Cytochrome c 0.9032 24 105 GO:0009055
GO:0020037
AF-A0A1F9C114-F1-model_v4 Sulfide dehydrogenase 0.8815 26 105 GO:0009055
GO:0020037
AF-A0A0J5ZY70-F1-model_v4 Cytochrome c 0.8776 24 104 GO:0009055
GO:0020037
AF-A0A023XAN8-F1-model_v4 deleted 0.87 24 105

Map