F475859

General Info

Members Datasets Scaffolds Average Seq Length
696 493 496 291

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0235458|Ga0495634_0235458_58_1029
Length 323
Sequence VISDCPVSPETWFPQNLANISKKNLQNRPFQRMKAAFLTDRGVVKVSGEDARDFLNGLVTTDVTLLRPGLGRFGALLTPQGKIIVDFLITEAPAGHGGGFLIDCPKPLAEGLATKLKFYKLRAKVTVDNLDLGVLAAWDGQLGAQPDLAFADPRNEHLGTRILIPEDLKQKLSDLIGAELVDAADYEAHRIALGVPRGGLDFMYSDAFPHETNMDRLAGVDFDKGCYVGQEVVSRMQHRGTARTRSVKVLLEDSSPEAGVSVMAGDKSVGTMGSSAQGKGIALVRIDRVADALDAGQPLTAGGLALKLAEPEIVRIPTKQPLA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
29 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
30 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
31 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
32 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
33 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
34 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
35 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
36 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
37 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
38 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
39 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
40 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
41 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
42 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
43 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
44 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
45 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
46 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
47 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
48 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
49 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
50 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
51 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
52 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
53 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
54 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
55 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
56 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
57 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
58 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
59 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
60 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
61 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
62 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
63 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
64 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
65 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
66 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
67 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
68 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
69 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
70 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
71 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
72 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
73 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
74 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
75 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
76 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
77 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
78 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
79 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
80 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
81 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
82 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
83 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
86 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
87 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
88 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
89 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
90 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
91 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
92 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
93 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
94 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
95 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
96 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
135 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
136 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
137 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
138 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
139 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
140 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
141 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
142 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
143 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
144 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
145 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
146 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
147 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
148 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
149 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
150 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
151 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
152 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
153 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
154 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
155 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
156 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
157 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
158 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
159 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
160 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
161 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
162 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
163 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
164 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
165 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
166 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
167 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
168 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
169 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
170 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
171 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
172 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
173 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
178 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
179 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
180 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
183 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
184 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
185 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
186 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
187 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
188 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
189 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
192 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
193 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
194 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
195 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
196 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
197 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
198 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
199 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
200 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
203 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
204 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
205 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
206 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
207 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
208 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
209 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
210 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
211 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
212 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
213 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
214 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
215 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
216 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
219 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
220 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
221 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
222 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
223 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
224 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
225 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
228 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
229 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
230 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
231 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
232 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
233 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
234 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
235 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
236 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
237 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
238 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
239 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
242 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
243 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
244 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
245 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
246 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
247 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
249 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
253 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
292 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
293 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
294 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
295 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
298 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
299 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
300 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
301 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
302 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
303 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
304 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
305 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
306 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
307 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
308 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
309 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
310 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
311 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
312 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
313 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
314 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
315 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
317 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
318 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
319 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
320 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
321 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
325 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
326 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
329 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
334 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
335 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
336 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
337 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
338 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
339 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
340 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
341 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
342 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
343 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
344 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
345 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
346 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
347 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
348 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
349 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
366 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
369 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
370 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
375 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
376 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
377 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
380 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
381 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
382 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
383 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
384 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
385 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
386 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
387 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
388 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
389 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
390 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
391 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
392 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
393 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
394 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
395 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
403 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
406 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
424 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
425 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
426 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
427 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
428 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
429 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
430 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
440 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
441 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
444 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
445 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
446 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
447 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
448 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
449 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
450 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
451 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
452 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
453 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
454 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
455 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
456 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
457 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
458 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
459 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
460 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
461 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
462 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
463 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
464 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
465 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
466 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
467 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
468 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
469 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
470 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
471 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
472 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
473 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
474 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
475 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
476 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
477 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
478 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
479 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
480 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
481 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
482 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
483 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
484 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
485 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
486 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
487 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
488 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
489 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
490 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
491 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
492 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
493 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.24
Metatranscriptomes 0.43
Isolates 28.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.62
Nodule 22.84
Rhizoplane 4.74
Rhizosphere 50.43
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002451 3300003215 Bacteria 10699
2 JGI25153J46596_10003211 3300003215 Bacteria 9187
3 JGI25153J46596_10015442 3300003215 Bacteria 3111
4 JGI25160J50197_1000862 3300003354 Bacteria 16124
5 JGI25160J50197_1001471 3300003354 Bacteria 11739
6 JGI25160J50197_1021553 3300003354 Bacteria 1912
7 Ga0055542_1003091 3300003762 Bacteria 4775
8 Ga0065165_1002741 3300005262 Bacteria 14058
9 Ga0070658_10045549 3300005327 Bacteria 3547
10 Ga0070658_10055695 3300005327 Bacteria 3213
11 Ga0070683_100003848 3300005329 Bacteria 12266
12 Ga0070683_100409872 3300005329 Bacteria 1293
13 Ga0070670_100254612 3300005331 Bacteria 1530
14 Ga0070670_100429363 3300005331 Bacteria 1169
15 Ga0068869_100340874 3300005334 Bacteria 1220
16 Ga0070666_10167695 3300005335 Bacteria 1537
17 Ga0070680_100012456 3300005336 Bacteria 6610
18 Ga0070680_100042667 3300005336 Bacteria 3681
19 Ga0068868_100125005 3300005338 Bacteria 2100
20 Ga0068868_100145980 3300005338 Bacteria 1945
21 Ga0070660_100023176 3300005339 Bacteria 4598
22 Ga0070661_100220764 3300005344 Bacteria 1454
23 Ga0070661_100316723 3300005344 Bacteria 1217
24 Ga0070668_100075380 3300005347 Bacteria 2634
25 Ga0070669_100164962 3300005353 Bacteria 1724
26 Ga0070671_100023510 3300005355 Bacteria 5044
27 Ga0070659_100329839 3300005366 Bacteria 1277
28 Ga0070667_100043976 3300005367 Bacteria 3749
29 Ga0070709_10002036 3300005434 Bacteria 10969
30 Ga0070709_10004640 3300005434 Bacteria 7417
31 Ga0070714_100003949 3300005435 Bacteria 11146
32 Ga0070714_100034569 3300005435 Bacteria 4233
33 Ga0070713_100001936 3300005436 Bacteria 13367
34 Ga0070713_100003099 3300005436 Bacteria 10934
35 Ga0070713_100007442 3300005436 Bacteria 7686
36 Ga0070710_10000534 3300005437 Bacteria 17971
37 Ga0070710_10007272 3300005437 Bacteria 5355
38 Ga0070710_10203723 3300005437 Bacteria 1251
39 Ga0070711_100000548 3300005439 Bacteria 19604
40 Ga0070711_100007787 3300005439 Bacteria 6525
41 Ga0070711_100082260 3300005439 Bacteria 2297
42 Ga0070708_100114000 3300005445 Bacteria 2487
43 Ga0070663_100030869 3300005455 Bacteria 3676
44 Ga0070663_100057216 3300005455 Bacteria 2796
45 Ga0070662_100294473 3300005457 Bacteria 1316
46 Ga0070681_10132380 3300005458 Bacteria 2426
47 Ga0070681_10213535 3300005458 Bacteria 1845
48 Ga0070698_100571769 3300005471 Bacteria 1070
49 Ga0070679_100698797 3300005530 Bacteria 957
50 Ga0070684_100011240 3300005535 Bacteria 7127
51 Ga0070684_100032160 3300005535 Bacteria 4470
52 Ga0070684_100445957 3300005535 Bacteria 1196
53 Ga0070697_100313080 3300005536 Bacteria 1351
54 Ga0068853_100022837 3300005539 Bacteria 5228
55 Ga0068855_100718676 3300005563 Bacteria 1067
56 Ga0068857_100252100 3300005577 Bacteria 1618
57 Ga0068857_100322583 3300005577 Bacteria 1427
58 Ga0068857_100340443 3300005577 Bacteria 1388
59 Ga0068856_100165928 3300005614 Bacteria 2219
60 Ga0068856_100435945 3300005614 Bacteria 1330
61 Ga0068852_100317659 3300005616 Bacteria 1512
62 Ga0068864_100422286 3300005618 Bacteria 1271
63 Ga0068866_10092932 3300005718 Bacteria 1647
64 Ga0068863_100137455 3300005841 Bacteria 2335
65 Ga0068858_100078600 3300005842 Bacteria 3066
66 Ga0068860_100283127 3300005843 Bacteria 1621
67 Ga0081540_1013003 3300005983 Bacteria 5436
68 Ga0081540_1021486 3300005983 Bacteria 3840
69 Ga0070717_10001632 3300006028 Bacteria 15573
70 Ga0070717_10002923 3300006028 Bacteria 12133
71 Ga0070717_10051927 3300006028 Bacteria 3376
72 Ga0070717_10106505 3300006028 Bacteria 2387
73 Ga0075365_10008203 3300006038 Bacteria 5911
74 Ga0075365_10013543 3300006038 Bacteria 4883
75 Ga0075365_10049118 3300006038 Bacteria 2779
76 Ga0075363_100007746 3300006048 Bacteria 4960
77 Ga0075364_10032847 3300006051 Bacteria 3337
78 Ga0070715_10021767 3300006163 Bacteria 2491
79 Ga0070716_100020294 3300006173 Bacteria 3487
80 Ga0070716_100043367 3300006173 Bacteria 2515
81 Ga0070716_100066125 3300006173 Bacteria 2108
82 Ga0070712_100025875 3300006175 Bacteria 3904
83 Ga0070712_100060009 3300006175 Bacteria 2681
84 Ga0070712_100206403 3300006175 Bacteria 1547
85 Ga0075367_10058773 3300006178 Bacteria 2288
86 Ga0075366_10006253 3300006195 Bacteria 6510
87 Ga0075370_10099953 3300006353 Bacteria 1678
88 Ga0099825_1019063 3300006941 Bacteria 5183
89 Ga0099824_1029034 3300006942 Bacteria 2416
90 Ga0099823_1076012 3300006944 Bacteria 1389
91 Ga0099794_10018933 3300007265 Bacteria 3094
92 Ga0099795_10006504 3300007788 Bacteria 3193
93 Ga0099795_10028301 3300007788 Bacteria 1904
94 Ga0099795_10103511 3300007788 Bacteria 1120
95 Ga0105240_10007546 3300009093 Bacteria 15763
96 Ga0105240_10033152 3300009093 Bacteria 6675
97 Ga0105240_10182042 3300009093 Bacteria 2479
98 Ga0105240_10212180 3300009093 Bacteria 2261
99 Ga0105245_10083863 3300009098 Bacteria 2918
100 Ga0105245_10352837 3300009098 Bacteria 1458
101 Ga0105241_10138421 3300009174 Bacteria 1979
102 Ga0105241_10334209 3300009174 Bacteria 1310
103 Ga0105237_10002635 3300009545 Bacteria 22084
104 Ga0105237_10028914 3300009545 Bacteria 5641
105 Ga0105237_10166769 3300009545 Bacteria 2201
106 Ga0105237_10293677 3300009545 Bacteria 1628
107 Ga0105238_10003869 3300009551 Bacteria 14870
108 Ga0099796_10027409 3300010159 Bacteria 1819
109 Ga0105239_10018844 3300010375 Bacteria 7625
110 Ga0105239_10082874 3300010375 Bacteria 3532
111 Ga0105239_10208891 3300010375 Bacteria 2188
112 Ga0105246_10081307 3300011119 Bacteria 2309
113 Ga0157370_10040261 3300013104 Bacteria 4512
114 Ga0157369_10000685 3300013105 Bacteria 43830
115 Ga0157369_10007917 3300013105 Bacteria 12218
116 Ga0157369_10836450 3300013105 Bacteria 945
117 Ga0157375_10251135 3300013308 Bacteria 1929
118 Ga0163163_10260403 3300014325 Bacteria 1785
119 Ga0157379_10247644 3300014968 Bacteria 1617
120 Ga0163161_10230262 3300017792 Bacteria 1438
121 Ga0197907_11507651 3300020069 Bacteria 1007
122 Ga0206350_11404750 3300020080 Bacteria 1776
123 Ga0206353_11430012 3300020082 Bacteria 1045
124 Ga0214544_1000001 3300021320 Bacteria 783667
125 Ga0214544_1025712 3300021320 Bacteria 2765
126 Ga0214542_1000005 3300021321 Bacteria 389646
127 Ga0214545_1000003 3300021324 Bacteria 720274
128 Ga0214543_1000002 3300021327 Bacteria 712733
129 Ga0213872_10030128 3300021361 Bacteria 2488
130 Ga0213876_10064728 3300021384 Bacteria 1929
131 Ga0209148_1000654 3300025254 Bacteria 29905
132 Ga0209233_1009814 3300025261 Bacteria 2897
133 Ga0209455_1008424 3300025272 Bacteria 2804
134 Ga0209564_1009980 3300025295 Bacteria 4436
135 Ga0209758_1000320 3300025297 Bacteria 92649
136 Ga0209758_1001495 3300025297 Bacteria 27238
137 Ga0207426_1000746 3300025302 Bacteria 36609
138 Ga0207426_1001214 3300025302 Bacteria 22769
139 Ga0207426_1004351 3300025302 Bacteria 6962
140 Ga0207426_1028304 3300025302 Bacteria 1859
141 Ga0209257_1012298 3300025304 Bacteria 3979
142 Ga0207692_10000091 3300025898 Bacteria 26705
143 Ga0207692_10001475 3300025898 Bacteria 8812
144 Ga0207692_10111587 3300025898 Bacteria 1517
145 Ga0207710_10094440 3300025900 Bacteria 1404
146 Ga0207685_10012829 3300025905 Bacteria 2571
147 Ga0207685_10125208 3300025905 Bacteria 1134
148 Ga0207699_10000782 3300025906 Bacteria 15227
149 Ga0207699_10185077 3300025906 Bacteria 1402
150 Ga0207705_10032876 3300025909 Bacteria 3706
151 Ga0207705_10146047 3300025909 Bacteria 1769
152 Ga0207654_10010107 3300025911 Bacteria 4800
153 Ga0207654_10078650 3300025911 Bacteria 1979
154 Ga0207654_10106473 3300025911 Bacteria 1737
155 Ga0207707_10001881 3300025912 Bacteria 19162
156 Ga0207707_10094903 3300025912 Bacteria 2607
157 Ga0207695_10000503 3300025913 Bacteria 83026
158 Ga0207695_10320320 3300025913 Bacteria 1440
159 Ga0207695_10512624 3300025913 Bacteria 1081
160 Ga0207671_10001399 3300025914 Bacteria 28067
161 Ga0207671_10040110 3300025914 Bacteria 3466
162 Ga0207671_10199188 3300025914 Bacteria 1563
163 Ga0207671_10296628 3300025914 Bacteria 1277
164 Ga0207693_10000479 3300025915 Bacteria 36362
165 Ga0207693_10029076 3300025915 Bacteria 4368
166 Ga0207693_10111691 3300025915 Bacteria 2144
167 Ga0207693_10336961 3300025915 Bacteria 1180
168 Ga0207663_10023702 3300025916 Bacteria 3526
169 Ga0207663_10047322 3300025916 Bacteria 2655
170 Ga0207663_10051544 3300025916 Bacteria 2563
171 Ga0207660_10005375 3300025917 Bacteria 8316
172 Ga0207657_10005742 3300025919 Bacteria 12944
173 Ga0207657_10097086 3300025919 Bacteria 2450
174 Ga0207649_10242530 3300025920 Bacteria 1294
175 Ga0207652_10001649 3300025921 Bacteria 19585
176 Ga0207681_10098872 3300025923 Bacteria 2100
177 Ga0207694_10041393 3300025924 Bacteria 3550
178 Ga0207687_10095563 3300025927 Bacteria 2176
179 Ga0207687_10188571 3300025927 Bacteria 1603
180 Ga0207700_10001432 3300025928 Bacteria 13527
181 Ga0207700_10018197 3300025928 Bacteria 4715
182 Ga0207700_10083703 3300025928 Bacteria 2498
183 Ga0207700_10163042 3300025928 Bacteria 1853
184 Ga0207664_10023054 3300025929 Bacteria 4659
185 Ga0207664_10320258 3300025929 Bacteria 1368
186 Ga0207664_10397233 3300025929 Bacteria 1226
187 Ga0207644_10020693 3300025931 Bacteria 4476
188 Ga0207644_10314371 3300025931 Bacteria 1265
189 Ga0207690_10138022 3300025932 Bacteria 1793
190 Ga0207706_10111396 3300025933 Bacteria 2408
191 Ga0207665_10000090 3300025939 Bacteria 58962
192 Ga0207665_10038595 3300025939 Bacteria 3181
193 Ga0207665_10055097 3300025939 Bacteria 2682
194 Ga0207665_10240190 3300025939 Bacteria 1334
195 Ga0207691_10377591 3300025940 Bacteria 1210
196 Ga0207711_10121596 3300025941 Bacteria 2331
197 Ga0207661_10010365 3300025944 Bacteria 6707
198 Ga0207661_10121205 3300025944 Bacteria 2227
199 Ga0207667_10037563 3300025949 Bacteria 5176
200 Ga0207667_10373362 3300025949 Bacteria 1453
201 Ga0207668_10535684 3300025972 Bacteria 1012
202 Ga0207640_10059884 3300025981 Bacteria 2514
203 Ga0207640_10369449 3300025981 Bacteria 1159
204 Ga0207658_10236281 3300025986 Bacteria 1545
205 Ga0207639_10021282 3300026041 Bacteria 4656
206 Ga0207702_10040866 3300026078 Bacteria 3888
207 Ga0207676_10269952 3300026095 Bacteria 1540
208 Ga0207674_10023609 3300026116 Bacteria 6584
209 Ga0207683_10271120 3300026121 Bacteria 1550
210 Ga0207698_10005624 3300026142 Bacteria 7758
211 Ga0207698_10628552 3300026142 Bacteria 1061
212 Ga0209389_1000009 3300027296 Bacteria 226873
213 Ga0209389_1000212 3300027296 Bacteria 40932
214 Ga0209589_1001280 3300027357 Bacteria 40932
215 Ga0209489_100085 3300027361 Bacteria 126199
216 Ga0209489_100671 3300027361 Bacteria 66550
217 Ga0209700_100016 3300027363 Bacteria 252567
218 Ga0209588_1014517 3300027671 Bacteria 2413
219 Ga0268265_10149498 3300028380 Bacteria 1968
220 Ga0268265_10206812 3300028380 Bacteria 1707
221 Ga0307515_10035411 3300028794 Bacteria 8123
222 Ga0265328_10000003 3300031239 Bacteria 251251
223 Ga0265328_10000009 3300031239 Bacteria 179784
224 Ga0265329_10008765 3300031242 Bacteria 3816
225 Ga0265340_10047459 3300031247 Bacteria 2091
226 Ga0265339_10003778 3300031249 Bacteria 10553
227 Ga0265331_10002269 3300031250 Bacteria 13138
228 Ga0265327_10064914 3300031251 Bacteria 1848
229 Ga0265316_10001770 3300031344 Bacteria 22813
230 Ga0265316_10106910 3300031344 Bacteria 2122
231 Ga0307508_10179931 3300031616 Bacteria 1717
232 Ga0265314_10036676 3300031711 Bacteria 3559
233 Ga0265342_10012254 3300031712 Bacteria 5814
234 Ga0307516_10112249 3300031730 Bacteria 2526
235 Ga0307516_10152063 3300031730 Bacteria 2073
236 Ga0307413_10044248 3300031824 Bacteria 2630
237 Ga0307409_100654843 3300031995 Bacteria 1044
238 Ga0307411_10118895 3300032005 Bacteria 1907
239 Ga0307415_100298519 3300032126 Bacteria 1333
240 Ga0307510_10018893 3300033180 Bacteria 8091
241 Ga0307510_10133497 3300033180 Bacteria 2147
242 Ga0315911_1000010 3300033442 Bacteria 322197
243 Ga0373923_0031097 3300035111 Bacteria 2150
244 Ga0373932_0035778 3300035112 Bacteria 1406
245 Ga0373936_0011362 3300035113 Bacteria 3370
246 Ga0373943_0009282 3300035170 Bacteria 4408
247 Ga0373943_0016263 3300035170 Bacteria 3390
248 Ga0373946_0007518 3300035171 Bacteria 3985
249 Ga0373955_0004218 3300035172 Bacteria 6343
250 Ga0373931_0052031 3300035691 Bacteria 2182
251 Ga0373935_0001222 3300035692 Bacteria 14189
252 Ga0373935_0097514 3300035692 Bacteria 1934
253 Ga0373935_0453053 3300035692 Bacteria 927
254 Ga0373927_0001984 3300035695 Bacteria 15075
255 Ga0373927_0002079 3300035695 Bacteria 14787
256 Ga0373927_0027195 3300035695 Bacteria 3736
257 Ga0373927_0046825 3300035695 Bacteria 2797
258 Ga0373927_0054260 3300035695 Bacteria 2592
259 Ga0373933_0000038 3300035724 Bacteria 80976
260 Ga0373933_0105662 3300035724 Bacteria 1751
261 Ga0373947_0009808 3300035725 Bacteria 5493
262 Ga0373947_0040566 3300035725 Bacteria 2773
263 Ga0373937_0005511 3300036401 Bacteria 10850
264 Ga0373937_0016644 3300036401 Bacteria 6533
265 Ga0373925_0002028 3300037068 Bacteria 16732
266 Ga0373925_0020481 3300037068 Bacteria 4815
267 Ga0373925_0049703 3300037068 Bacteria 3126
268 Ga0395899_0043622 3300037312 Bacteria 3345
269 Ga0395900_0000134 3300037418 Bacteria 124444
270 Ga0395900_0022534 3300037418 Bacteria 6444
271 Ga0395900_0399569 3300037418 Bacteria 1339
272 Ga0395898_0036137 3300037466 Bacteria 4907
273 Ga0395898_0146261 3300037466 Bacteria 2262
274 Ga0395898_0252984 3300037466 Bacteria 1680
275 Ga0395905_0035844 3300037471 Bacteria 4659
276 Ga0395901_0054972 3300038443 Bacteria 4139
277 Ga0395901_0549710 3300038443 Bacteria 1170
278 Ga0395901_0655079 3300038443 Bacteria 1053
279 Ga0436365_0365623 3300039437 Bacteria 31548
280 Ga0436365_0458346 3300039437 Bacteria 1462
281 Ga0436365_1058288 3300039437 Bacteria 3286
282 Ga0436363_0840229 3300039450 Bacteria 1741
283 Ga0436362_0868242 3300039453 Bacteria 9788
284 Ga0451791_0429136 3300041451 Bacteria 1265
285 Ga0451797_0952982 3300041453 Bacteria 1562
286 Ga0466969_0038849 3300044656 Bacteria 2393
287 Ga0466969_0039662 3300044656 Bacteria 2364
288 Ga0466972_0000363 3300044658 Bacteria 24488
289 Ga0466966_0002193 3300044684 Bacteria 12682
290 Ga0466961_0000090 3300044693 Bacteria 57757
291 Ga0466963_0065260 3300044694 Bacteria 2440
292 Ga0466964_0163970 3300044706 Bacteria 1041
293 Ga0466970_0151726 3300044765 Bacteria 1279
294 Ga0466957_0183879 3300044842 Bacteria 1366
295 Ga0466960_0152502 3300044901 Bacteria 1235
296 Ga0466959_0010358 3300045049 Bacteria 6659
297 Ga0466958_0184661 3300045836 Bacteria 1324
298 Ga0466967_0150799 3300045976 Bacteria 2172
299 Ga0466967_0356655 3300045976 Bacteria 1416
300 Ga0495592_0077905 3300046454 Bacteria 2401
301 Ga0495592_0102177 3300046454 Bacteria 2041
302 Ga0495603_0001123 3300046455 Bacteria 15577
303 Ga0495603_0001668 3300046455 Bacteria 13022
304 Ga0495629_0000316 3300046459 Bacteria 41262
305 Ga0495629_0000900 3300046459 Bacteria 23863
306 Ga0495638_0003425 3300046460 Bacteria 12493
307 Ga0495641_0003654 3300046461 Bacteria 11359
308 Ga0495651_0008870 3300046462 Bacteria 7721
309 Ga0495651_0021715 3300046462 Bacteria 4989
310 Ga0495651_0051135 3300046462 Bacteria 3187
311 Ga0495653_0022549 3300046463 Bacteria 5093
312 Ga0495653_0320618 3300046463 Bacteria 1004
313 Ga0495650_0116042 3300046471 Bacteria 989
314 Ga0495580_0004684 3300046472 Bacteria 11472
315 Ga0495580_0068041 3300046472 Bacteria 2491
316 Ga0495580_0329920 3300046472 Bacteria 1036
317 Ga0495582_0000038 3300046473 Bacteria 67536
318 Ga0495605_0051914 3300046474 Bacteria 1995
319 Ga0495639_0000050 3300046475 Bacteria 52004
320 Ga0495639_0121931 3300046475 Bacteria 1244
321 Ga0495662_0001679 3300046476 Bacteria 11042
322 Ga0495664_0022812 3300046477 Bacteria 3630
323 Ga0495664_0072782 3300046477 Bacteria 2054
324 Ga0495594_0000658 3300046499 Bacteria 17863
325 Ga0495594_0073885 3300046499 Bacteria 1899
326 Ga0495594_0089452 3300046499 Bacteria 1724
327 Ga0495606_0023497 3300046507 Bacteria 4464
328 Ga0495606_0035170 3300046507 Bacteria 3428
329 Ga0495606_0194593 3300046507 Bacteria 1160
330 Ga0495608_0052028 3300046511 Bacteria 2712
331 Ga0495616_0023053 3300046513 Bacteria 3354
332 Ga0495616_0064887 3300046513 Bacteria 1781
333 Ga0495620_0100323 3300046515 Bacteria 1155
334 Ga0495628_0037210 3300046516 Bacteria 3902
335 Ga0495628_0040123 3300046516 Bacteria 3742
336 Ga0495630_0002603 3300046517 Bacteria 12502
337 Ga0495631_0120051 3300046518 Bacteria 1131
338 Ga0495643_0005438 3300046522 Bacteria 8618
339 Ga0495648_0044876 3300046524 Bacteria 2755
340 Ga0495666_0110841 3300046526 Bacteria 1289
341 Ga0495666_0129561 3300046526 Bacteria 1179
342 Ga0495666_0165031 3300046526 Bacteria 1026
343 Ga0495652_0027943 3300046529 Bacteria 4968
344 Ga0495652_0151590 3300046529 Bacteria 1810
345 Ga0495665_0000732 3300046531 Bacteria 16988
346 Ga0495640_0004317 3300046533 Bacteria 11356
347 Ga0495640_0038743 3300046533 Bacteria 3351
348 Ga0495587_0016459 3300046536 Bacteria 4599
349 Ga0495645_0020249 3300046543 Bacteria 4797
350 Ga0495622_0007054 3300046557 Bacteria 5217
351 Ga0495622_0030034 3300046557 Bacteria 2539
352 Ga0495667_0044118 3300046559 Bacteria 2953
353 Ga0495667_0054691 3300046559 Bacteria 2626
354 Ga0495668_0020048 3300046616 Bacteria 3846
355 Ga0495634_0000931 3300046642 Bacteria 27727
356 Ga0495634_0235458 3300046642 Bacteria 1125
357 Ga0495611_0041916 3300046648 Bacteria 2043
358 Ga0495635_0000415 3300046663 Bacteria 27018
359 Ga0495635_0006765 3300046663 Bacteria 8010
360 Ga0495588_0028455 3300046674 Bacteria 2797
361 Ga0495588_0031715 3300046674 Bacteria 2661
362 Ga0495657_0006673 3300046675 Bacteria 9015
363 Ga0495599_0050345 3300046678 Bacteria 2610
364 Ga0495599_0059742 3300046678 Bacteria 2384
365 Ga0495623_0029798 3300046679 Bacteria 3511
366 Ga0495646_0005444 3300046680 Bacteria 8046
367 Ga0495646_0065851 3300046680 Bacteria 2144
368 Ga0495646_0098079 3300046680 Bacteria 1683
369 Ga0495647_0000195 3300046681 Bacteria 16130
370 Ga0495658_0000802 3300046683 Bacteria 16866
371 Ga0495658_0168872 3300046683 Bacteria 1353
372 Ga0495613_0002073 3300046689 Bacteria 15236
373 Ga0495613_0036466 3300046689 Bacteria 3646
374 Ga0495613_0108789 3300046689 Bacteria 1999
375 Ga0495613_0230663 3300046689 Bacteria 1297
376 Ga0495624_0013276 3300046690 Bacteria 5615
377 Ga0495624_0097188 3300046690 Bacteria 1814
378 Ga0495589_0129931 3300046794 Bacteria 1210
379 Ga0495600_0007520 3300046809 Bacteria 6669
380 Ga0495600_0048237 3300046809 Bacteria 2778
381 Ga0495581_0005552 3300047315 Bacteria 7306
382 Ga0495581_0025276 3300047315 Bacteria 3444
383 Ga0495581_0091925 3300047315 Bacteria 1761
384 Ga0495581_0137962 3300047315 Bacteria 1422
385 Ga0495604_0006276 3300047317 Bacteria 9434
386 Ga0495604_0040819 3300047317 Bacteria 3641
387 Ga0495674_0013016 3300047319 Bacteria 7831
388 Ga0495676_0178340 3300047321 Bacteria 1491
389 Ga0495680_0007943 3300047322 Bacteria 9680
390 Ga0495683_0133210 3300047323 Bacteria 1170
391 Ga0495687_020454 3300047443 Bacteria 3224
392 Ga0495675_0003949 3300047444 Bacteria 8991
393 Ga0495673_0018019 3300047469 Bacteria 3571
394 Ga0495684_0007203 3300047471 Bacteria 8634
395 Ga0495684_0053921 3300047471 Bacteria 3067
396 Ga0495593_0000291 3300047673 Bacteria 27242
397 Ga0495602_0013244 3300048088 Bacteria 8434
398 Ga0495602_0089560 3300048088 Bacteria 2558
399 Ga0495602_0182140 3300048088 Bacteria 1619
400 Ga0495602_0216323 3300048088 Bacteria 1450
401 Ga0496100_0420916 3300048903 Bacteria 1020
402 Ga0496101_0016399 3300048904 Bacteria 5004
403 Ga0496101_0093709 3300048904 Bacteria 2237
404 Ga0496101_0201487 3300048904 Bacteria 1539
405 Ga0496102_0364182 3300048905 Bacteria 1361
406 Ga0496103_0007433 3300048906 Bacteria 6530
407 Ga0496104_0002707 3300048907 Bacteria 15254
408 Ga0496104_0033366 3300048907 Bacteria 4794
409 Ga0496104_0151185 3300048907 Bacteria 2228
410 Ga0496105_0003571 3300048908 Bacteria 11538
411 Ga0496105_0055582 3300048908 Bacteria 3268
412 Ga0496105_0098375 3300048908 Bacteria 2416
413 Ga0496107_0185189 3300048910 Bacteria 1546
414 Ga0496107_0247923 3300048910 Bacteria 1325
415 Ga0496108_0034095 3300048911 Bacteria 4229
416 Ga0496108_0159285 3300048911 Bacteria 1950
417 Ga0496109_0062374 3300048912 Bacteria 3408
418 Ga0496110_0138945 3300048913 Bacteria 2196
419 Ga0496110_0595633 3300048913 Bacteria 1003
420 Ga0496112_0052736 3300048915 Bacteria 3992
421 Ga0496112_0203106 3300048915 Bacteria 1940
422 Ga0496112_0205840 3300048915 Bacteria 1926
423 Ga0496113_0295209 3300048916 Bacteria 1297
424 Ga0496114_0026045 3300048917 Bacteria 4785
425 Ga0496114_0219475 3300048917 Bacteria 1669
426 Ga0496115_0014957 3300048918 Bacteria 5882
427 Ga0496115_0020501 3300048918 Bacteria 5101
428 Ga0496115_0063096 3300048918 Bacteria 2989
429 Ga0496115_0115536 3300048918 Bacteria 2207
430 Ga0496115_0189441 3300048918 Bacteria 1699
431 Ga0496116_0043348 3300048919 Bacteria 3066
432 Ga0496116_0086484 3300048919 Bacteria 1923
433 Ga0496117_0053075 3300048920 Bacteria 2851
434 Ga0496118_0094901 3300048921 Bacteria 2038
435 Ga0496118_0123848 3300048921 Bacteria 1678
436 Ga0496118_0239225 3300048921 Bacteria 1041
437 Ga0496119_0053771 3300048922 Bacteria 2457
438 Ga0496119_0068638 3300048922 Bacteria 2086
439 Ga0496120_0023635 3300048923 Bacteria 3844
440 Ga0496120_0134452 3300048923 Bacteria 1262
441 Ga0496120_0185687 3300048923 Bacteria 1017
442 Ga0496121_0004381 3300048924 Bacteria 19069
443 Ga0496121_0093712 3300048924 Bacteria 2337
444 Ga0496121_0115231 3300048924 Bacteria 2041
445 Ga0496121_0121330 3300048924 Bacteria 1974
446 Ga0496121_0182565 3300048924 Bacteria 1512
447 Ga0496121_0227800 3300048924 Bacteria 1307
448 Ga0496122_0031165 3300048925 Bacteria 4446
449 Ga0496122_0166606 3300048925 Bacteria 1335
450 Ga0496124_0165758 3300048927 Bacteria 1717
451 Ga0496124_0169879 3300048927 Bacteria 1690
452 Ga0496126_0011094 3300048929 Bacteria 9362
453 Ga0496126_0020402 3300048929 Bacteria 6498
454 Ga0496126_0041687 3300048929 Bacteria 4246
455 Ga0496126_0046829 3300048929 Bacteria 3962
456 Ga0496126_0141572 3300048929 Bacteria 2070
457 Ga0496126_0180251 3300048929 Bacteria 1795
458 Ga0496126_0356276 3300048929 Bacteria 1196
459 Ga0495682_0063244 3300049460 Bacteria 1335
460 Ga0501044_0168504 3300049823 Bacteria 2163
461 nmdc:mga00v17_28031_c1 3300050491 Bacteria 3294
462 nmdc:mga0yw44_12366_c1 3300050492 Bacteria 4446
463 nmdc:mga0yw44_9102_c1 3300050492 Bacteria 4995
464 nmdc:mga06z11_18221_c1 3300050494 Bacteria 3203
465 nmdc:mga04h51_8605_c1 3300050495 Bacteria 2734
466 nmdc:mga07m45_12697_c1 3300050496 Bacteria 4454
467 nmdc:mga07m45_14394_c1 3300050496 Bacteria 4213
468 nmdc:mga0sz30_48285_c1 3300050516 Bacteria 1801
469 nmdc:mga0sz30_91389_c1 3300050516 Bacteria 1325
470 Ga0500610_0086510 3300053079 Bacteria 1631
471 Ga0495655_0064603 3300053083 Bacteria 1008
472 Ga0495619_0072419 3300053085 Bacteria 2308
473 Ga0495619_0128440 3300053085 Bacteria 1741
474 Ga0500578_0252381 3300053086 Bacteria 1062
475 Ga0500643_000047 3300053087 Bacteria 148938
476 Ga0500566_0027227 3300053094 Bacteria 3345
477 Ga0500641_0107328 3300053096 Bacteria 1200
478 Ga0500555_007180 3300053103 Bacteria 3165
479 Ga0500556_0004374 3300053104 Bacteria 4025
480 Ga0500557_000078 3300053105 Bacteria 36522
481 Ga0500572_001844 3300053111 Bacteria 5368
482 Ga0500595_002149 3300053119 Bacteria 10038
483 Ga0500607_061424 3300053121 Bacteria 1967
484 Ga0500621_050726 3300053126 Bacteria 1680
485 Ga0500642_0005047 3300053130 Bacteria 4212
486 Ga0500642_0008914 3300053130 Bacteria 3456
487 Ga0500652_021783 3300053131 Bacteria 2418
488 Ga0500559_0000226 3300053136 Bacteria 45182
489 Ga0500559_0015797 3300053136 Bacteria 3189
490 Ga0500639_022150 3300053163 Bacteria 3356
491 Ga0500636_0000024 3300053177 Bacteria 86744
492 Ga0500625_014244 3300053729 Bacteria 3671
493 Ga0500609_002803 3300053731 Bacteria 2484
494 Ga0500552_002622 3300053733 Bacteria 1766
495 Ga0500596_002085 3300053735 Bacteria 3977
496 Ga0500601_000078 3300053737 Bacteria 20015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0168504 Ga0501044_0168504_489_1370 258
2 3300031239 Ga0265328_10000003 Ga0265328_10000003186 272
3 3300031242 Ga0265329_10008765 Ga0265329_100087654 272
4 3300031250 Ga0265331_10002269 Ga0265331_100022695 272
5 3300031251 Ga0265327_10064914 Ga0265327_100649143 272
6 3300031344 Ga0265316_10001770 Ga0265316_1000177011 272
7 iso_pu_bacteria 2906635258 2906642408 276
8 iso_pu_bacteria 2906660503 2906660715 276
9 3300031239 Ga0265328_10000009 Ga0265328_1000000974 277
10 iso_pu_bacteria 2885374607 2885379779 277
11 iso_pu_bacteria 2904690495 2904697817 277
12 iso_pu_bacteria 2906610324 2906611559 277
13 iso_pu_bacteria 2908739725 2908745139 277
14 iso_pu_bacteria 2908756301 2908762809 277
15 iso_pu_bacteria 2922425934 2922427790 277
16 3300039437 Ga0436365_0365623 Ga0436365_0365623_19132_20010 278
17 3300039450 Ga0436363_0840229 Ga0436363_0840229_188_1066 278
18 3300039453 Ga0436362_0868242 Ga0436362_0868242_626_1504 278
19 3300046794 Ga0495589_0129931 Ga0495589_0129931_161_1003 278
20 3300007265 Ga0099794_10018933 Ga0099794_100189331 281
21 3300017792 Ga0163161_10230262 Ga0163161_102302622 281
22 3300035692 Ga0373935_0453053 Ga0373935_0453053_60_911 281
23 3300046526 Ga0495666_0165031 Ga0495666_0165031_169_1014 281
24 3300046690 Ga0495624_0097188 Ga0495624_0097188_26_871 281
25 3300048918 Ga0496115_0189441 Ga0496115_0189441_27_872 281
26 3300053096 Ga0500641_0107328 Ga0500641_0107328_345_1190 281
27 3300053126 Ga0500621_050726 Ga0500621_050726_20_865 281
28 iso_pu_bacteria 2507262055 2507507280 287
29 iso_pu_bacteria 2508501009 2508541336 287
30 iso_pu_bacteria 2508501042 2508693334 287
31 iso_pu_bacteria 2511231028 2511401369 287
32 iso_pu_bacteria 2513237092 2513626379 287
33 iso_pu_bacteria 2513237094 2513637090 287
34 iso_pu_bacteria 2513237095 2513652527 287
35 iso_pu_bacteria 2513237096 2513655110 287
36 iso_pu_bacteria 2513237102 2513705956 287
37 iso_pu_bacteria 2513237137 2513863245 287
38 iso_pu_bacteria 2513237139 2513876657 287
39 iso_pu_bacteria 2513237141 2513887409 287
40 iso_pu_bacteria 2513237145 2513915867 287
41 iso_pu_bacteria 2513237161 2514012298 287
42 iso_pu_bacteria 2515154112 2515631416 287
43 iso_pu_bacteria 2517093001 2517104792 287
44 iso_pu_bacteria 2517572143 2517894829 287
45 iso_pu_bacteria 2524023205 2524440600 287
46 iso_pu_bacteria 2524023228 2524534594 287
47 iso_pu_bacteria 2528768022 2528855365 287
48 iso_pu_bacteria 2617270735 2617354210 287
49 iso_pu_bacteria 2617270741 2617373119 287
50 iso_pu_bacteria 2667528175 2671119244 287
51 iso_pu_bacteria 2744054633 2745079312 287
52 iso_pu_bacteria 2791355196 2793061264 287
53 iso_pu_bacteria 2791355197 2793071916 287
54 iso_pu_bacteria 2802429603 2805918637 287
55 iso_pu_bacteria 2816332527 2818236973 287
56 iso_pu_bacteria 2824600985 2824608559 287
57 iso_pu_bacteria 2824609381 2824613723 287
58 iso_pu_bacteria 2824617872 2824625790 287
59 iso_pu_bacteria 2824626560 2824633808 287
60 iso_pu_bacteria 2824635225 2824642187 287
61 iso_pu_bacteria 2824644064 2824649591 287
62 iso_pu_bacteria 2824653114 2824660277 287
63 iso_pu_bacteria 2824661429 2824670338 287
64 iso_pu_bacteria 2824671348 2824678118 287
65 iso_pu_bacteria 2824679649 2824686636 287
66 iso_pu_bacteria 2824687955 2824694250 287
67 iso_pu_bacteria 2824696289 2824703080 287
68 iso_pu_bacteria 2824704595 2824711778 287
69 iso_pu_bacteria 2824714736 2824719550 287
70 iso_pu_bacteria 2824723954 2824729983 287
71 iso_pu_bacteria 2824732956 2824739099 287
72 iso_pu_bacteria 2824746037 2824751972 287
73 iso_pu_bacteria 2824753945 2824763103 287
74 iso_pu_bacteria 2824763712 2824772897 287
75 iso_pu_bacteria 2824773399 2824779679 287
76 iso_pu_bacteria 2838122688 2838127125 287
77 iso_pu_bacteria 2841941048 2841947362 287
78 iso_pu_bacteria 2841949485 2841955849 287
79 iso_pu_bacteria 2841957949 2841961704 287
80 iso_pu_bacteria 2841966195 2841974318 287
81 iso_pu_bacteria 2841974524 2841981022 287
82 iso_pu_bacteria 2841983080 2841987225 287
83 iso_pu_bacteria 2842038055 2842041145 287
84 iso_pu_bacteria 2842045827 2842045910 287
85 iso_pu_bacteria 2844315083 2844320393 287
86 iso_pu_bacteria 2847930680 2847937928 287
87 iso_pu_bacteria 2847939898 2847948162 287
88 iso_pu_bacteria 2849076700 2849077930 287
89 iso_pu_bacteria 2857509624 2857511124 287
90 iso_pu_bacteria 2874590934 2874595982 287
91 iso_pu_bacteria 2874612657 2874618502 287
92 iso_pu_bacteria 2874620515 2874625738 287
93 iso_pu_bacteria 2874628541 2874632922 287
94 iso_pu_bacteria 2874645413 2874650806 287
95 iso_pu_bacteria 2876761206 2876768677 287
96 iso_pu_bacteria 2876771140 2876776190 287
97 iso_pu_bacteria 2876818435 2876822150 287
98 iso_pu_bacteria 2879074833 2879080279 287
99 iso_pu_bacteria 2879083081 2879084209 287
100 iso_pu_bacteria 2879099564 2879105410 287
101 iso_pu_bacteria 2879127579 2879129123 287
102 iso_pu_bacteria 2879142872 2879143753 287
103 iso_pu_bacteria 2881364244 2881370346 287
104 iso_pu_bacteria 2881665667 2881673596 287
105 iso_pu_bacteria 2885366525 2885368354 287
106 iso_pu_bacteria 2885409591 2885409952 287
107 iso_pu_bacteria 2888378607 2888385898 287
108 iso_pu_bacteria 2888419890 2888426004 287
109 iso_pu_bacteria 2903727486 2903732946 287
110 iso_pu_bacteria 2904666416 2904673901 287
111 iso_pu_bacteria 2904699407 2904705994 287
112 iso_pu_bacteria 2904711408 2904711493 287
113 iso_pu_bacteria 2906602504 2906607278 287
114 iso_pu_bacteria 2906626472 2906630217 287
115 iso_pu_bacteria 2906643746 2906651277 287
116 iso_pu_bacteria 2908775508 2908781571 287
117 iso_pu_bacteria 2922368715 2922376206 287
118 iso_pu_bacteria 2922393267 2922393590 287
119 iso_pu_bacteria 2929615660 2929622984 287
120 iso_pu_bacteria 2929624759 2929631579 287
121 iso_pu_bacteria 2932784394 2932789369 287
122 iso_pu_bacteria 2932794094 2932797711 287
123 iso_pu_bacteria 2932801729 2932804229 287
124 iso_pu_bacteria 2932809354 2932816415 287
125 iso_pu_bacteria 2932818245 2932821998 287
126 iso_pu_bacteria 2932828146 2932831976 287
127 iso_pu_bacteria 2933577622 2933584812 287
128 iso_pu_bacteria 2935608549 2935610341 287
129 iso_pu_bacteria 2935616580 2935621915 287
130 iso_pu_bacteria 2935638405 2935644076 287
131 iso_pu_bacteria 2935648319 2935651315 287
132 iso_pu_bacteria 2935656913 2935659495 287
133 iso_pu_bacteria 2935665750 2935669010 287
134 iso_pu_bacteria 2935675223 2935683684 287
135 iso_pu_bacteria 2935684952 2935692376 287
136 iso_pu_bacteria 2935694250 2935700456 287
137 iso_pu_bacteria 2935703347 2935708916 287
138 iso_pu_bacteria 2935713505 2935720386 287
139 iso_pu_bacteria 2935722832 2935729667 287
140 iso_pu_bacteria 2935732158 2935739351 287
141 iso_pu_bacteria 2935741537 2935748108 287
142 iso_pu_bacteria 2935750917 2935758311 287
143 iso_pu_bacteria 2935760218 2935767390 287
144 iso_pu_bacteria 2935769743 2935771124 287
145 iso_pu_bacteria 2935777560 2935781293 287
146 iso_pu_bacteria 2935785616 2935786175 287
147 iso_pu_bacteria 2935793552 2935794028 287
148 iso_pu_bacteria 2935801545 2935805726 287
149 iso_pu_bacteria 2935810662 2935815718 287
150 iso_pu_bacteria 2935819856 2935823502 287
151 iso_pu_bacteria 2935827899 2935833327 287
152 iso_pu_bacteria 2935837841 2935842030 287
153 iso_pu_bacteria 2935847175 2935849027 287
154 iso_pu_bacteria 2935855204 2935860162 287
155 iso_pu_bacteria 2935864058 2935867558 287
156 iso_pu_bacteria 2935873716 2935878631 287
157 iso_pu_bacteria 2935883170 2935890414 287
158 iso_pu_bacteria 2935908558 2935912883 287
159 iso_pu_bacteria 2935916978 2935922798 287
160 iso_pu_bacteria 2935926038 2935930223 287
161 iso_pu_bacteria 2935934488 2935939124 287
162 iso_pu_bacteria 2935942939 2935946071 287
163 iso_pu_bacteria 2935951376 2935955408 287
164 iso_pu_bacteria 2935959822 2935965237 287
165 iso_pu_bacteria 2935967501 2935972221 287
166 iso_pu_bacteria 2935975950 2935976148 287
167 iso_pu_bacteria 2935984226 2935986355 287
168 iso_pu_bacteria 2935992306 2935998091 287
169 iso_pu_bacteria 2936002035 2936006792 287
170 iso_pu_bacteria 2936011229 2936013910 287
171 iso_pu_bacteria 2936019824 2936022566 287
172 iso_pu_bacteria 2936028420 2936035515 287
173 iso_pu_bacteria 2936037263 2936040956 287
174 iso_pu_bacteria 2936046547 2936049016 287
175 iso_pu_bacteria 2936055302 2936060406 287
176 iso_pu_bacteria 2940556831 2940564215 287
177 iso_pu_bacteria 2941507105 2941508216 287
178 iso_pu_bacteria 2941515067 2941515278 287
179 iso_pu_bacteria 2941523033 2941524147 287
180 iso_pu_bacteria 2941531003 2941531584 287
181 iso_pu_bacteria 2941538514 2941546577 287
182 iso_pu_bacteria 3005474847 3005477502 287
183 iso_pu_bacteria 3005483717 3005486211 287
184 iso_pu_bacteria 3005506211 3005511635 287
185 iso_pu_bacteria 3005587118 3005588472 287
186 iso_pu_bacteria 3005594810 3005600772 287
187 iso_pu_bacteria 3005710791 3005716187 287
188 iso_pu_bacteria 3005718088 3005723562 287
189 iso_pu_bacteria 8006926726 8006927238 287
190 iso_pu_bacteria 8006933436 8006933727 287
191 iso_pu_bacteria 8006973647 8006983399 287
192 iso_pu_bacteria 8016511872 8016520200 287
193 iso_pu_bacteria 8016522445 8016528105 287
194 iso_pu_bacteria 8016539877 8016546474 287
195 iso_pu_bacteria 8016557553 8016564007 287
196 iso_pu_bacteria 8016566248 8016571558 287
197 iso_pu_bacteria 8016575299 8016575804 287
198 iso_pu_bacteria 8016583857 8016594877 287
199 iso_pu_bacteria 8016595262 8016601718 287
200 iso_pu_bacteria 8016622563 8016624805 287
201 iso_pu_bacteria 8016630954 8016638305 287
202 iso_pu_bacteria 8017057580 8017065361 287
203 iso_pu_bacteria 8019538911 8019546822 287
204 iso_pu_bacteria 8019565922 8019569764 287
205 iso_pu_bacteria 8019586578 8019592696 287
206 iso_pu_bacteria 8019597564 8019598756 287
207 iso_pu_bacteria 8019608314 8019609618 287
208 iso_pu_bacteria 8019619141 8019620216 287
209 iso_pu_bacteria 8019629233 8019632884 287
210 iso_pu_bacteria 8019638758 8019647042 287
211 iso_pu_bacteria 8019648815 8019655655 287
212 iso_pu_bacteria 8019659431 8019660745 287
213 iso_pu_bacteria 8019668869 8019670157 287
214 iso_pu_bacteria 8019687851 8019692101 287
215 iso_pu_bacteria 8055742211 8055744654 287
216 iso_pu_bacteria 8056681323 8056682244 287
217 iso_pu_bacteria 8056689827 8056695244 287
218 iso_pu_bacteria 8056967851 8056974662 287
219 3300005434 Ga0070709_10004640 Ga0070709_100046406 290
220 3300005436 Ga0070713_100007442 Ga0070713_1000074422 290
221 3300005437 Ga0070710_10000534 Ga0070710_1000053416 290
222 3300005439 Ga0070711_100000548 Ga0070711_1000005486 290
223 3300005530 Ga0070679_100698797 Ga0070679_1006987971 290
224 3300006163 Ga0070715_10021767 Ga0070715_100217673 290
225 3300006173 Ga0070716_100043367 Ga0070716_1000433672 290
226 3300006175 Ga0070712_100060009 Ga0070712_1000600093 290
227 3300025898 Ga0207692_10000091 Ga0207692_1000009116 290
228 3300025905 Ga0207685_10012829 Ga0207685_100128293 290
229 3300025906 Ga0207699_10000782 Ga0207699_1000078214 290
230 3300025915 Ga0207693_10029076 Ga0207693_100290763 290
231 3300025916 Ga0207663_10047322 Ga0207663_100473224 290
232 3300025928 Ga0207700_10018197 Ga0207700_100181976 290
233 3300025929 Ga0207664_10023054 Ga0207664_100230542 290
234 3300025939 Ga0207665_10055097 Ga0207665_100550972 290
235 3300031711 Ga0265314_10036676 Ga0265314_100366763 290
236 3300031712 Ga0265342_10012254 Ga0265342_100122544 290
237 3300031730 Ga0307516_10112249 Ga0307516_101122492 290
238 3300048921 Ga0496118_0239225 Ga0496118_0239225_145_1026 290
239 3300053111 Ga0500572_001844 Ga0500572_001844_2957_3850 290
240 3300053136 Ga0500559_0000226 Ga0500559_0000226_32209_33102 290
241 3300053163 Ga0500639_022150 Ga0500639_022150_1544_2437 290
242 3300053735 Ga0500596_002085 Ga0500596_002085_1591_2484 290
243 3300003215 JGI25153J46596_10002451 JGI25153J46596_100024516 291
244 3300003215 JGI25153J46596_10003211 JGI25153J46596_100032112 291
245 3300003215 JGI25153J46596_10015442 JGI25153J46596_100154422 291
246 3300003354 JGI25160J50197_1000862 JGI25160J50197_100086213 291
247 3300003354 JGI25160J50197_1001471 JGI25160J50197_10014718 291
248 3300003354 JGI25160J50197_1021553 JGI25160J50197_10215532 291
249 3300003762 Ga0055542_1003091 Ga0055542_10030916 291
250 3300005262 Ga0065165_1002741 Ga0065165_100274114 291
251 3300005327 Ga0070658_10045549 Ga0070658_100455492 291
252 3300005327 Ga0070658_10055695 Ga0070658_100556954 291
253 3300005329 Ga0070683_100003848 Ga0070683_1000038485 291
254 3300005329 Ga0070683_100409872 Ga0070683_1004098721 291
255 3300005331 Ga0070670_100254612 Ga0070670_1002546122 291
256 3300005331 Ga0070670_100429363 Ga0070670_1004293631 291
257 3300005334 Ga0068869_100340874 Ga0068869_1003408741 291
258 3300005335 Ga0070666_10167695 Ga0070666_101676952 291
259 3300005336 Ga0070680_100012456 Ga0070680_1000124564 291
260 3300005336 Ga0070680_100042667 Ga0070680_1000426674 291
261 3300005338 Ga0068868_100125005 Ga0068868_1001250053 291
262 3300005338 Ga0068868_100145980 Ga0068868_1001459802 291
263 3300005339 Ga0070660_100023176 Ga0070660_1000231762 291
264 3300005344 Ga0070661_100220764 Ga0070661_1002207642 291
265 3300005344 Ga0070661_100316723 Ga0070661_1003167232 291
266 3300005347 Ga0070668_100075380 Ga0070668_1000753802 291
267 3300005353 Ga0070669_100164962 Ga0070669_1001649622 291
268 3300005355 Ga0070671_100023510 Ga0070671_1000235105 291
269 3300005366 Ga0070659_100329839 Ga0070659_1003298391 291
270 3300005367 Ga0070667_100043976 Ga0070667_1000439763 291
271 3300005434 Ga0070709_10002036 Ga0070709_100020363 291
272 3300005435 Ga0070714_100003949 Ga0070714_1000039493 291
273 3300005435 Ga0070714_100034569 Ga0070714_1000345696 291
274 3300005436 Ga0070713_100001936 Ga0070713_1000019364 291
275 3300005436 Ga0070713_100003099 Ga0070713_1000030996 291
276 3300005437 Ga0070710_10007272 Ga0070710_100072723 291
277 3300005437 Ga0070710_10203723 Ga0070710_102037232 291
278 3300005439 Ga0070711_100007787 Ga0070711_1000077874 291
279 3300005439 Ga0070711_100082260 Ga0070711_1000822601 291
280 3300005445 Ga0070708_100114000 Ga0070708_1001140001 291
281 3300005455 Ga0070663_100030869 Ga0070663_1000308692 291
282 3300005455 Ga0070663_100057216 Ga0070663_1000572162 291
283 3300005457 Ga0070662_100294473 Ga0070662_1002944731 291
284 3300005458 Ga0070681_10132380 Ga0070681_101323802 291
285 3300005458 Ga0070681_10213535 Ga0070681_102135352 291
286 3300005471 Ga0070698_100571769 Ga0070698_1005717691 291
287 3300005535 Ga0070684_100011240 Ga0070684_10001124010 291
288 3300005535 Ga0070684_100032160 Ga0070684_1000321601 291
289 3300005535 Ga0070684_100445957 Ga0070684_1004459571 291
290 3300005536 Ga0070697_100313080 Ga0070697_1003130802 291
291 3300005539 Ga0068853_100022837 Ga0068853_1000228372 291
292 3300005563 Ga0068855_100718676 Ga0068855_1007186761 291
293 3300005577 Ga0068857_100252100 Ga0068857_1002521002 291
294 3300005577 Ga0068857_100322583 Ga0068857_1003225832 291
295 3300005577 Ga0068857_100340443 Ga0068857_1003404432 291
296 3300005614 Ga0068856_100165928 Ga0068856_1001659282 291
297 3300005614 Ga0068856_100435945 Ga0068856_1004359452 291
298 3300005616 Ga0068852_100317659 Ga0068852_1003176592 291
299 3300005618 Ga0068864_100422286 Ga0068864_1004222862 291
300 3300005718 Ga0068866_10092932 Ga0068866_100929322 291
301 3300005841 Ga0068863_100137455 Ga0068863_1001374552 291
302 3300005842 Ga0068858_100078600 Ga0068858_1000786002 291
303 3300005843 Ga0068860_100283127 Ga0068860_1002831272 291
304 3300005983 Ga0081540_1013003 Ga0081540_10130032 291
305 3300005983 Ga0081540_1021486 Ga0081540_10214862 291
306 3300006028 Ga0070717_10001632 Ga0070717_100016328 291
307 3300006028 Ga0070717_10002923 Ga0070717_1000292313 291
308 3300006028 Ga0070717_10051927 Ga0070717_100519275 291
309 3300006028 Ga0070717_10106505 Ga0070717_101065052 291
310 3300006038 Ga0075365_10008203 Ga0075365_100082033 291
311 3300006038 Ga0075365_10013543 Ga0075365_100135432 291
312 3300006038 Ga0075365_10049118 Ga0075365_100491183 291
313 3300006048 Ga0075363_100007746 Ga0075363_1000077461 291
314 3300006051 Ga0075364_10032847 Ga0075364_100328472 291
315 3300006173 Ga0070716_100020294 Ga0070716_1000202942 291
316 3300006173 Ga0070716_100066125 Ga0070716_1000661252 291
317 3300006175 Ga0070712_100025875 Ga0070712_1000258755 291
318 3300006175 Ga0070712_100206403 Ga0070712_1002064032 291
319 3300006178 Ga0075367_10058773 Ga0075367_100587732 291
320 3300006195 Ga0075366_10006253 Ga0075366_100062532 291
321 3300006353 Ga0075370_10099953 Ga0075370_100999532 291
322 3300006941 Ga0099825_1019063 Ga0099825_10190632 291
323 3300006942 Ga0099824_1029034 Ga0099824_10290344 291
324 3300006944 Ga0099823_1076012 Ga0099823_10760122 291
325 3300007788 Ga0099795_10006504 Ga0099795_100065042 291
326 3300007788 Ga0099795_10028301 Ga0099795_100283012 291
327 3300007788 Ga0099795_10103511 Ga0099795_101035111 291
328 3300009093 Ga0105240_10007546 Ga0105240_1000754617 291
329 3300009093 Ga0105240_10033152 Ga0105240_100331527 291
330 3300009093 Ga0105240_10182042 Ga0105240_101820423 291
331 3300009093 Ga0105240_10212180 Ga0105240_102121803 291
332 3300009098 Ga0105245_10083863 Ga0105245_100838632 291
333 3300009098 Ga0105245_10352837 Ga0105245_103528372 291
334 3300009174 Ga0105241_10138421 Ga0105241_101384213 291
335 3300009174 Ga0105241_10334209 Ga0105241_103342092 291
336 3300009545 Ga0105237_10002635 Ga0105237_1000263513 291
337 3300009545 Ga0105237_10028914 Ga0105237_100289142 291
338 3300009545 Ga0105237_10166769 Ga0105237_101667692 291
339 3300009545 Ga0105237_10293677 Ga0105237_102936771 291
340 3300009551 Ga0105238_10003869 Ga0105238_100038696 291
341 3300010159 Ga0099796_10027409 Ga0099796_100274092 291
342 3300010375 Ga0105239_10018844 Ga0105239_100188442 291
343 3300010375 Ga0105239_10082874 Ga0105239_100828745 291
344 3300010375 Ga0105239_10208891 Ga0105239_102088913 291
345 3300011119 Ga0105246_10081307 Ga0105246_100813072 291
346 3300013104 Ga0157370_10040261 Ga0157370_100402614 291
347 3300013105 Ga0157369_10000685 Ga0157369_100006856 291
348 3300013105 Ga0157369_10007917 Ga0157369_1000791711 291
349 3300013105 Ga0157369_10836450 Ga0157369_108364501 291
350 3300013308 Ga0157375_10251135 Ga0157375_102511352 291
351 3300014325 Ga0163163_10260403 Ga0163163_102604032 291
352 3300014968 Ga0157379_10247644 Ga0157379_102476441 291
353 3300020069 Ga0197907_11507651 Ga0197907_115076511 291
354 3300020080 Ga0206350_11404750 Ga0206350_114047503 291
355 3300020082 Ga0206353_11430012 Ga0206353_114300121 291
356 3300021320 Ga0214544_1000001 Ga0214544_1000001357 291
357 3300021320 Ga0214544_1025712 Ga0214544_10257122 291
358 3300021321 Ga0214542_1000005 Ga0214542_1000005357 291
359 3300021324 Ga0214545_1000003 Ga0214545_1000003407 291
360 3300021327 Ga0214543_1000002 Ga0214543_1000002360 291
361 3300021361 Ga0213872_10030128 Ga0213872_100301281 291
362 3300021384 Ga0213876_10064728 Ga0213876_100647281 291
363 3300025254 Ga0209148_1000654 Ga0209148_100065422 291
364 3300025261 Ga0209233_1009814 Ga0209233_10098142 291
365 3300025272 Ga0209455_1008424 Ga0209455_10084243 291
366 3300025295 Ga0209564_1009980 Ga0209564_10099804 291
367 3300025297 Ga0209758_1000320 Ga0209758_100032080 291
368 3300025297 Ga0209758_1001495 Ga0209758_10014955 291
369 3300025302 Ga0207426_1000746 Ga0207426_100074614 291
370 3300025302 Ga0207426_1001214 Ga0207426_100121423 291
371 3300025302 Ga0207426_1004351 Ga0207426_10043516 291
372 3300025302 Ga0207426_1028304 Ga0207426_10283042 291
373 3300025304 Ga0209257_1012298 Ga0209257_10122982 291
374 3300025898 Ga0207692_10001475 Ga0207692_100014758 291
375 3300025898 Ga0207692_10111587 Ga0207692_101115872 291
376 3300025900 Ga0207710_10094440 Ga0207710_100944402 291
377 3300025905 Ga0207685_10125208 Ga0207685_101252081 291
378 3300025906 Ga0207699_10185077 Ga0207699_101850772 291
379 3300025909 Ga0207705_10032876 Ga0207705_100328765 291
380 3300025909 Ga0207705_10146047 Ga0207705_101460472 291
381 3300025911 Ga0207654_10010107 Ga0207654_100101072 291
382 3300025911 Ga0207654_10078650 Ga0207654_100786502 291
383 3300025911 Ga0207654_10106473 Ga0207654_101064732 291
384 3300025912 Ga0207707_10001881 Ga0207707_1000188114 291
385 3300025912 Ga0207707_10094903 Ga0207707_100949032 291
386 3300025913 Ga0207695_10000503 Ga0207695_1000050320 291
387 3300025913 Ga0207695_10320320 Ga0207695_103203202 291
388 3300025913 Ga0207695_10512624 Ga0207695_105126242 291
389 3300025914 Ga0207671_10001399 Ga0207671_100013996 291
390 3300025914 Ga0207671_10040110 Ga0207671_100401102 291
391 3300025914 Ga0207671_10199188 Ga0207671_101991882 291
392 3300025914 Ga0207671_10296628 Ga0207671_102966282 291
393 3300025915 Ga0207693_10000479 Ga0207693_1000047924 291
394 3300025915 Ga0207693_10111691 Ga0207693_101116913 291
395 3300025915 Ga0207693_10336961 Ga0207693_103369611 291
396 3300025916 Ga0207663_10023702 Ga0207663_100237022 291
397 3300025916 Ga0207663_10051544 Ga0207663_100515443 291
398 3300025917 Ga0207660_10005375 Ga0207660_100053757 291
399 3300025919 Ga0207657_10005742 Ga0207657_100057422 291
400 3300025919 Ga0207657_10097086 Ga0207657_100970863 291
401 3300025920 Ga0207649_10242530 Ga0207649_102425302 291
402 3300025921 Ga0207652_10001649 Ga0207652_1000164915 291
403 3300025923 Ga0207681_10098872 Ga0207681_100988722 291
404 3300025924 Ga0207694_10041393 Ga0207694_100413934 291
405 3300025927 Ga0207687_10095563 Ga0207687_100955633 291
406 3300025927 Ga0207687_10188571 Ga0207687_101885712 291
407 3300025928 Ga0207700_10001432 Ga0207700_100014324 291
408 3300025928 Ga0207700_10083703 Ga0207700_100837031 291
409 3300025928 Ga0207700_10163042 Ga0207700_101630423 291
410 3300025929 Ga0207664_10320258 Ga0207664_103202582 291
411 3300025929 Ga0207664_10397233 Ga0207664_103972332 291
412 3300025931 Ga0207644_10020693 Ga0207644_100206932 291
413 3300025931 Ga0207644_10314371 Ga0207644_103143712 291
414 3300025932 Ga0207690_10138022 Ga0207690_101380221 291
415 3300025933 Ga0207706_10111396 Ga0207706_101113963 291
416 3300025939 Ga0207665_10000090 Ga0207665_1000009013 291
417 3300025939 Ga0207665_10038595 Ga0207665_100385954 291
418 3300025939 Ga0207665_10240190 Ga0207665_102401902 291
419 3300025940 Ga0207691_10377591 Ga0207691_103775912 291
420 3300025941 Ga0207711_10121596 Ga0207711_101215963 291
421 3300025944 Ga0207661_10010365 Ga0207661_1001036511 291
422 3300025944 Ga0207661_10121205 Ga0207661_101212052 291
423 3300025949 Ga0207667_10037563 Ga0207667_100375635 291
424 3300025949 Ga0207667_10373362 Ga0207667_103733622 291
425 3300025972 Ga0207668_10535684 Ga0207668_105356841 291
426 3300025981 Ga0207640_10059884 Ga0207640_100598842 291
427 3300025981 Ga0207640_10369449 Ga0207640_103694492 291
428 3300025986 Ga0207658_10236281 Ga0207658_102362812 291
429 3300026041 Ga0207639_10021282 Ga0207639_100212825 291
430 3300026078 Ga0207702_10040866 Ga0207702_100408665 291
431 3300026095 Ga0207676_10269952 Ga0207676_102699521 291
432 3300026116 Ga0207674_10023609 Ga0207674_100236094 291
433 3300026121 Ga0207683_10271120 Ga0207683_102711202 291
434 3300026142 Ga0207698_10005624 Ga0207698_100056241 291
435 3300026142 Ga0207698_10628552 Ga0207698_106285521 291
436 3300027296 Ga0209389_1000009 Ga0209389_1000009142 291
437 3300027296 Ga0209389_1000212 Ga0209389_100021234 291
438 3300027357 Ga0209589_1001280 Ga0209589_10012806 291
439 3300027361 Ga0209489_100085 Ga0209489_1000857 291
440 3300027361 Ga0209489_100671 Ga0209489_10067112 291
441 3300027363 Ga0209700_100016 Ga0209700_10001692 291
442 3300027671 Ga0209588_1014517 Ga0209588_10145174 291
443 3300028380 Ga0268265_10149498 Ga0268265_101494982 291
444 3300028380 Ga0268265_10206812 Ga0268265_102068122 291
445 3300028794 Ga0307515_10035411 Ga0307515_1003541112 291
446 3300031247 Ga0265340_10047459 Ga0265340_100474592 291
447 3300031249 Ga0265339_10003778 Ga0265339_100037784 291
448 3300031344 Ga0265316_10106910 Ga0265316_101069102 291
449 3300031616 Ga0307508_10179931 Ga0307508_101799312 291
450 3300031730 Ga0307516_10152063 Ga0307516_101520632 291
451 3300031824 Ga0307413_10044248 Ga0307413_100442482 291
452 3300031995 Ga0307409_100654843 Ga0307409_1006548431 291
453 3300032005 Ga0307411_10118895 Ga0307411_101188952 291
454 3300032126 Ga0307415_100298519 Ga0307415_1002985192 291
455 3300033180 Ga0307510_10018893 Ga0307510_100188933 291
456 3300033180 Ga0307510_10133497 Ga0307510_101334972 291
457 3300033442 Ga0315911_1000010 Ga0315911_100001064 291
458 3300035111 Ga0373923_0031097 Ga0373923_0031097_908_1804 291
459 3300035112 Ga0373932_0035778 Ga0373932_0035778_295_1176 291
460 3300035113 Ga0373936_0011362 Ga0373936_0011362_887_1783 291
461 3300035170 Ga0373943_0009282 Ga0373943_0009282_3248_4144 291
462 3300035170 Ga0373943_0016263 Ga0373943_0016263_1273_2154 291
463 3300035171 Ga0373946_0007518 Ga0373946_0007518_1397_2293 291
464 3300035172 Ga0373955_0004218 Ga0373955_0004218_3914_4810 291
465 3300035691 Ga0373931_0052031 Ga0373931_0052031_124_1005 291
466 3300035692 Ga0373935_0001222 Ga0373935_0001222_5521_6417 291
467 3300035692 Ga0373935_0097514 Ga0373935_0097514_666_1547 291
468 3300035695 Ga0373927_0001984 Ga0373927_0001984_4745_5626 291
469 3300035695 Ga0373927_0002079 Ga0373927_0002079_7716_8612 291
470 3300035695 Ga0373927_0027195 Ga0373927_0027195_998_1879 291
471 3300035695 Ga0373927_0046825 Ga0373927_0046825_1537_2418 291
472 3300035695 Ga0373927_0054260 Ga0373927_0054260_1594_2475 291
473 3300035724 Ga0373933_0000038 Ga0373933_0000038_71863_72744 291
474 3300035724 Ga0373933_0105662 Ga0373933_0105662_158_1054 291
475 3300035725 Ga0373947_0009808 Ga0373947_0009808_3116_4012 291
476 3300035725 Ga0373947_0040566 Ga0373947_0040566_1060_1941 291
477 3300036401 Ga0373937_0005511 Ga0373937_0005511_6834_7730 291
478 3300036401 Ga0373937_0016644 Ga0373937_0016644_2165_3061 291
479 3300037068 Ga0373925_0002028 Ga0373925_0002028_13296_14192 291
480 3300037068 Ga0373925_0020481 Ga0373925_0020481_3107_3988 291
481 3300037068 Ga0373925_0049703 Ga0373925_0049703_2096_2977 291
482 3300037312 Ga0395899_0043622 Ga0395899_0043622_2035_2916 291
483 3300037418 Ga0395900_0000134 Ga0395900_0000134_8283_9161 291
484 3300037418 Ga0395900_0022534 Ga0395900_0022534_120_1001 291
485 3300037418 Ga0395900_0399569 Ga0395900_0399569_153_1034 291
486 3300037466 Ga0395898_0036137 Ga0395898_0036137_876_1757 291
487 3300037466 Ga0395898_0146261 Ga0395898_0146261_775_1656 291
488 3300037466 Ga0395898_0252984 Ga0395898_0252984_588_1469 291
489 3300037471 Ga0395905_0035844 Ga0395905_0035844_881_1762 291
490 3300038443 Ga0395901_0054972 Ga0395901_0054972_687_1565 291
491 3300038443 Ga0395901_0549710 Ga0395901_0549710_192_1073 291
492 3300038443 Ga0395901_0655079 Ga0395901_0655079_45_920 291
493 3300039437 Ga0436365_0458346 Ga0436365_0458346_563_1444 291
494 3300039437 Ga0436365_1058288 Ga0436365_1058288_240_1154 291
495 3300041451 Ga0451791_0429136 Ga0451791_0429136_331_1212 291
496 3300041453 Ga0451797_0952982 Ga0451797_0952982_440_1321 291
497 3300044656 Ga0466969_0038849 Ga0466969_0038849_490_1371 291
498 3300044656 Ga0466969_0039662 Ga0466969_0039662_812_1741 291
499 3300044658 Ga0466972_0000363 Ga0466972_0000363_14565_15446 291
500 3300044684 Ga0466966_0002193 Ga0466966_0002193_3618_4499 291
501 3300044693 Ga0466961_0000090 Ga0466961_0000090_35848_36729 291
502 3300044694 Ga0466963_0065260 Ga0466963_0065260_262_1191 291
503 3300044706 Ga0466964_0163970 Ga0466964_0163970_50_931 291
504 3300044765 Ga0466970_0151726 Ga0466970_0151726_104_985 291
505 3300044842 Ga0466957_0183879 Ga0466957_0183879_154_1035 291
506 3300044901 Ga0466960_0152502 Ga0466960_0152502_49_924 291
507 3300045049 Ga0466959_0010358 Ga0466959_0010358_820_1701 291
508 3300045836 Ga0466958_0184661 Ga0466958_0184661_276_1157 291
509 3300045976 Ga0466967_0150799 Ga0466967_0150799_952_1827 291
510 3300045976 Ga0466967_0356655 Ga0466967_0356655_131_1012 291
511 3300046454 Ga0495592_0077905 Ga0495592_0077905_1276_2172 291
512 3300046454 Ga0495592_0102177 Ga0495592_0102177_743_1624 291
513 3300046455 Ga0495603_0001123 Ga0495603_0001123_14303_15199 291
514 3300046455 Ga0495603_0001668 Ga0495603_0001668_9676_10557 291
515 3300046459 Ga0495629_0000316 Ga0495629_0000316_10385_11281 291
516 3300046459 Ga0495629_0000900 Ga0495629_0000900_21520_22395 291
517 3300046460 Ga0495638_0003425 Ga0495638_0003425_10479_11354 291
518 3300046461 Ga0495641_0003654 Ga0495641_0003654_5594_6490 291
519 3300046462 Ga0495651_0008870 Ga0495651_0008870_4124_5020 291
520 3300046462 Ga0495651_0021715 Ga0495651_0021715_1453_2334 291
521 3300046462 Ga0495651_0051135 Ga0495651_0051135_1443_2318 291
522 3300046463 Ga0495653_0022549 Ga0495653_0022549_4135_5016 291
523 3300046463 Ga0495653_0320618 Ga0495653_0320618_19_894 291
524 3300046471 Ga0495650_0116042 Ga0495650_0116042_10_891 291
525 3300046472 Ga0495580_0004684 Ga0495580_0004684_5255_6151 291
526 3300046472 Ga0495580_0068041 Ga0495580_0068041_577_1458 291
527 3300046472 Ga0495580_0329920 Ga0495580_0329920_136_1017 291
528 3300046473 Ga0495582_0000038 Ga0495582_0000038_55091_55987 291
529 3300046474 Ga0495605_0051914 Ga0495605_0051914_791_1666 291
530 3300046475 Ga0495639_0000050 Ga0495639_0000050_9980_10876 291
531 3300046475 Ga0495639_0121931 Ga0495639_0121931_157_1032 291
532 3300046476 Ga0495662_0001679 Ga0495662_0001679_4113_5009 291
533 3300046477 Ga0495664_0022812 Ga0495664_0022812_34_930 291
534 3300046477 Ga0495664_0072782 Ga0495664_0072782_282_1163 291
535 3300046499 Ga0495594_0000658 Ga0495594_0000658_6606_7502 291
536 3300046499 Ga0495594_0073885 Ga0495594_0073885_396_1277 291
537 3300046499 Ga0495594_0089452 Ga0495594_0089452_170_1051 291
538 3300046507 Ga0495606_0023497 Ga0495606_0023497_2226_3101 291
539 3300046507 Ga0495606_0035170 Ga0495606_0035170_979_1860 291
540 3300046507 Ga0495606_0194593 Ga0495606_0194593_96_977 291
541 3300046511 Ga0495608_0052028 Ga0495608_0052028_790_1671 291
542 3300046513 Ga0495616_0023053 Ga0495616_0023053_1480_2361 291
543 3300046513 Ga0495616_0064887 Ga0495616_0064887_494_1369 291
544 3300046515 Ga0495620_0100323 Ga0495620_0100323_11_892 291
545 3300046516 Ga0495628_0037210 Ga0495628_0037210_2960_3856 291
546 3300046516 Ga0495628_0040123 Ga0495628_0040123_2562_3443 291
547 3300046517 Ga0495630_0002603 Ga0495630_0002603_1583_2479 291
548 3300046518 Ga0495631_0120051 Ga0495631_0120051_162_1043 291
549 3300046522 Ga0495643_0005438 Ga0495643_0005438_4196_5077 291
550 3300046524 Ga0495648_0044876 Ga0495648_0044876_775_1650 291
551 3300046526 Ga0495666_0110841 Ga0495666_0110841_131_1012 291
552 3300046526 Ga0495666_0129561 Ga0495666_0129561_233_1129 291
553 3300046529 Ga0495652_0027943 Ga0495652_0027943_1457_2338 291
554 3300046529 Ga0495652_0151590 Ga0495652_0151590_82_978 291
555 3300046531 Ga0495665_0000732 Ga0495665_0000732_10311_11207 291
556 3300046533 Ga0495640_0004317 Ga0495640_0004317_10083_10979 291
557 3300046533 Ga0495640_0038743 Ga0495640_0038743_490_1365 291
558 3300046536 Ga0495587_0016459 Ga0495587_0016459_2989_3870 291
559 3300046543 Ga0495645_0020249 Ga0495645_0020249_3035_3916 291
560 3300046557 Ga0495622_0007054 Ga0495622_0007054_1011_1907 291
561 3300046557 Ga0495622_0030034 Ga0495622_0030034_1416_2291 291
562 3300046559 Ga0495667_0044118 Ga0495667_0044118_626_1507 291
563 3300046559 Ga0495667_0054691 Ga0495667_0054691_1513_2409 291
564 3300046616 Ga0495668_0020048 Ga0495668_0020048_102_983 291
565 3300046642 Ga0495634_0000931 Ga0495634_0000931_8746_9642 291
566 3300046642 Ga0495634_0235458 Ga0495634_0235458_58_1029 291
567 3300046648 Ga0495611_0041916 Ga0495611_0041916_722_1597 291
568 3300046663 Ga0495635_0000415 Ga0495635_0000415_8776_9672 291
569 3300046663 Ga0495635_0006765 Ga0495635_0006765_5825_6700 291
570 3300046674 Ga0495588_0028455 Ga0495588_0028455_301_1182 291
571 3300046674 Ga0495588_0031715 Ga0495588_0031715_1262_2158 291
572 3300046675 Ga0495657_0006673 Ga0495657_0006673_1282_2163 291
573 3300046678 Ga0495599_0050345 Ga0495599_0050345_277_1158 291
574 3300046678 Ga0495599_0059742 Ga0495599_0059742_1228_2124 291
575 3300046679 Ga0495623_0029798 Ga0495623_0029798_1274_2155 291
576 3300046680 Ga0495646_0005444 Ga0495646_0005444_1557_2453 291
577 3300046680 Ga0495646_0065851 Ga0495646_0065851_635_1516 291
578 3300046680 Ga0495646_0098079 Ga0495646_0098079_561_1436 291
579 3300046681 Ga0495647_0000195 Ga0495647_0000195_5192_6088 291
580 3300046683 Ga0495658_0000802 Ga0495658_0000802_5758_6654 291
581 3300046683 Ga0495658_0168872 Ga0495658_0168872_213_1094 291
582 3300046689 Ga0495613_0002073 Ga0495613_0002073_4030_4926 291
583 3300046689 Ga0495613_0036466 Ga0495613_0036466_1710_2585 291
584 3300046689 Ga0495613_0108789 Ga0495613_0108789_792_1673 291
585 3300046689 Ga0495613_0230663 Ga0495613_0230663_311_1192 291
586 3300046690 Ga0495624_0013276 Ga0495624_0013276_520_1416 291
587 3300046809 Ga0495600_0007520 Ga0495600_0007520_107_988 291
588 3300046809 Ga0495600_0048237 Ga0495600_0048237_1855_2730 291
589 3300047315 Ga0495581_0005552 Ga0495581_0005552_6177_7073 291
590 3300047315 Ga0495581_0025276 Ga0495581_0025276_782_1657 291
591 3300047315 Ga0495581_0091925 Ga0495581_0091925_818_1699 291
592 3300047315 Ga0495581_0137962 Ga0495581_0137962_287_1168 291
593 3300047317 Ga0495604_0006276 Ga0495604_0006276_1489_2370 291
594 3300047317 Ga0495604_0040819 Ga0495604_0040819_527_1402 291
595 3300047319 Ga0495674_0013016 Ga0495674_0013016_6499_7380 291
596 3300047321 Ga0495676_0178340 Ga0495676_0178340_563_1444 291
597 3300047322 Ga0495680_0007943 Ga0495680_0007943_7978_8859 291
598 3300047323 Ga0495683_0133210 Ga0495683_0133210_275_1156 291
599 3300047443 Ga0495687_020454 Ga0495687_020454_1051_1932 291
600 3300047444 Ga0495675_0003949 Ga0495675_0003949_7304_8185 291
601 3300047469 Ga0495673_0018019 Ga0495673_0018019_729_1610 291
602 3300047471 Ga0495684_0007203 Ga0495684_0007203_4323_5219 291
603 3300047471 Ga0495684_0053921 Ga0495684_0053921_675_1556 291
604 3300047673 Ga0495593_0000291 Ga0495593_0000291_10266_11162 291
605 3300048088 Ga0495602_0013244 Ga0495602_0013244_6282_7163 291
606 3300048088 Ga0495602_0089560 Ga0495602_0089560_1051_1926 291
607 3300048088 Ga0495602_0182140 Ga0495602_0182140_606_1502 291
608 3300048088 Ga0495602_0216323 Ga0495602_0216323_497_1378 291
609 3300048903 Ga0496100_0420916 Ga0496100_0420916_34_915 291
610 3300048904 Ga0496101_0016399 Ga0496101_0016399_1912_2793 291
611 3300048904 Ga0496101_0093709 Ga0496101_0093709_1053_1928 291
612 3300048904 Ga0496101_0201487 Ga0496101_0201487_483_1364 291
613 3300048905 Ga0496102_0364182 Ga0496102_0364182_128_1009 291
614 3300048906 Ga0496103_0007433 Ga0496103_0007433_2140_3021 291
615 3300048907 Ga0496104_0002707 Ga0496104_0002707_12486_13361 291
616 3300048907 Ga0496104_0033366 Ga0496104_0033366_2330_3211 291
617 3300048907 Ga0496104_0151185 Ga0496104_0151185_268_1149 291
618 3300048908 Ga0496105_0003571 Ga0496105_0003571_9889_10764 291
619 3300048908 Ga0496105_0055582 Ga0496105_0055582_1810_2685 291
620 3300048908 Ga0496105_0098375 Ga0496105_0098375_451_1332 291
621 3300048910 Ga0496107_0185189 Ga0496107_0185189_481_1362 291
622 3300048910 Ga0496107_0247923 Ga0496107_0247923_38_919 291
623 3300048911 Ga0496108_0034095 Ga0496108_0034095_448_1329 291
624 3300048911 Ga0496108_0159285 Ga0496108_0159285_37_912 291
625 3300048912 Ga0496109_0062374 Ga0496109_0062374_1494_2375 291
626 3300048913 Ga0496110_0138945 Ga0496110_0138945_748_1629 291
627 3300048913 Ga0496110_0595633 Ga0496110_0595633_112_993 291
628 3300048915 Ga0496112_0052736 Ga0496112_0052736_1322_2203 291
629 3300048915 Ga0496112_0203106 Ga0496112_0203106_198_1079 291
630 3300048915 Ga0496112_0205840 Ga0496112_0205840_810_1691 291
631 3300048916 Ga0496113_0295209 Ga0496113_0295209_45_920 291
632 3300048917 Ga0496114_0026045 Ga0496114_0026045_3451_4326 291
633 3300048917 Ga0496114_0219475 Ga0496114_0219475_583_1464 291
634 3300048918 Ga0496115_0014957 Ga0496115_0014957_3177_4058 291
635 3300048918 Ga0496115_0020501 Ga0496115_0020501_1912_2793 291
636 3300048918 Ga0496115_0063096 Ga0496115_0063096_1237_2118 291
637 3300048918 Ga0496115_0115536 Ga0496115_0115536_32_967 291
638 3300048919 Ga0496116_0043348 Ga0496116_0043348_645_1520 291
639 3300048919 Ga0496116_0086484 Ga0496116_0086484_336_1217 291
640 3300048920 Ga0496117_0053075 Ga0496117_0053075_861_1736 291
641 3300048921 Ga0496118_0094901 Ga0496118_0094901_469_1350 291
642 3300048921 Ga0496118_0123848 Ga0496118_0123848_359_1234 291
643 3300048922 Ga0496119_0053771 Ga0496119_0053771_497_1378 291
644 3300048922 Ga0496119_0068638 Ga0496119_0068638_338_1213 291
645 3300048923 Ga0496120_0023635 Ga0496120_0023635_1679_2554 291
646 3300048923 Ga0496120_0134452 Ga0496120_0134452_235_1110 291
647 3300048923 Ga0496120_0185687 Ga0496120_0185687_121_1002 291
648 3300048924 Ga0496121_0004381 Ga0496121_0004381_12083_12958 291
649 3300048924 Ga0496121_0093712 Ga0496121_0093712_122_997 291
650 3300048924 Ga0496121_0115231 Ga0496121_0115231_129_1016 291
651 3300048924 Ga0496121_0121330 Ga0496121_0121330_690_1571 291
652 3300048924 Ga0496121_0182565 Ga0496121_0182565_363_1244 291
653 3300048924 Ga0496121_0227800 Ga0496121_0227800_119_994 291
654 3300048925 Ga0496122_0031165 Ga0496122_0031165_74_955 291
655 3300048925 Ga0496122_0166606 Ga0496122_0166606_350_1231 291
656 3300048927 Ga0496124_0165758 Ga0496124_0165758_91_972 291
657 3300048927 Ga0496124_0169879 Ga0496124_0169879_189_1064 291
658 3300048929 Ga0496126_0011094 Ga0496126_0011094_7775_8656 291
659 3300048929 Ga0496126_0020402 Ga0496126_0020402_4599_5480 291
660 3300048929 Ga0496126_0041687 Ga0496126_0041687_1807_2682 291
661 3300048929 Ga0496126_0046829 Ga0496126_0046829_1025_1906 291
662 3300048929 Ga0496126_0141572 Ga0496126_0141572_1044_1925 291
663 3300048929 Ga0496126_0180251 Ga0496126_0180251_388_1269 291
664 3300048929 Ga0496126_0356276 Ga0496126_0356276_237_1112 291
665 3300049460 Ga0495682_0063244 Ga0495682_0063244_276_1151 291
666 3300050491 nmdc:mga00v17_28031_c1 nmdc:mga00v17_28031_c1_1235_2116 291
667 3300050492 nmdc:mga0yw44_12366_c1 nmdc:mga0yw44_12366_c1_541_1422 291
668 3300050492 nmdc:mga0yw44_9102_c1 nmdc:mga0yw44_9102_c1_1610_2485 291
669 3300050494 nmdc:mga06z11_18221_c1 nmdc:mga06z11_18221_c1_1390_2271 291
670 3300050495 nmdc:mga04h51_8605_c1 nmdc:mga04h51_8605_c1_1662_2543 291
671 3300050496 nmdc:mga07m45_12697_c1 nmdc:mga07m45_12697_c1_2500_3375 291
672 3300050496 nmdc:mga07m45_14394_c1 nmdc:mga07m45_14394_c1_993_1874 291
673 3300050516 nmdc:mga0sz30_48285_c1 nmdc:mga0sz30_48285_c1_579_1454 291
674 3300050516 nmdc:mga0sz30_91389_c1 nmdc:mga0sz30_91389_c1_210_1091 291
675 3300053079 Ga0500610_0086510 Ga0500610_0086510_331_1206 291
676 3300053083 Ga0495655_0064603 Ga0495655_0064603_69_950 291
677 3300053085 Ga0495619_0072419 Ga0495619_0072419_1382_2263 291
678 3300053085 Ga0495619_0128440 Ga0495619_0128440_226_1101 291
679 3300053086 Ga0500578_0252381 Ga0500578_0252381_127_1002 291
680 3300053087 Ga0500643_000047 Ga0500643_000047_34105_34980 291
681 3300053094 Ga0500566_0027227 Ga0500566_0027227_824_1699 291
682 3300053103 Ga0500555_007180 Ga0500555_007180_1779_2654 291
683 3300053104 Ga0500556_0004374 Ga0500556_0004374_184_1059 291
684 3300053105 Ga0500557_000078 Ga0500557_000078_34108_34989 291
685 3300053119 Ga0500595_002149 Ga0500595_002149_4012_4893 291
686 3300053121 Ga0500607_061424 Ga0500607_061424_924_1799 291
687 3300053130 Ga0500642_0005047 Ga0500642_0005047_1631_2512 291
688 3300053130 Ga0500642_0008914 Ga0500642_0008914_1531_2406 291
689 3300053131 Ga0500652_021783 Ga0500652_021783_364_1239 291
690 3300053136 Ga0500559_0015797 Ga0500559_0015797_1127_2002 291
691 3300053177 Ga0500636_0000024 Ga0500636_0000024_28972_29853 291
692 3300053729 Ga0500625_014244 Ga0500625_014244_1277_2158 291
693 3300053731 Ga0500609_002803 Ga0500609_002803_967_1842 291
694 3300053733 Ga0500552_002622 Ga0500552_002622_228_1103 291
695 3300053737 Ga0500601_000078 Ga0500601_000078_12047_12922 291
696 iso_pu_bacteria 2513237104 2513719095 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

32

101

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z3h-assembly3.cif.gz_C crystal structure of iba57 from chaetomium thermophilum 0.8326 2 283
7z3h-assembly5.cif.gz_E crystal structure of iba57 from chaetomium thermophilum 0.8302 2 283
7z3h-assembly6.cif.gz_F crystal structure of iba57 from chaetomium thermophilum 0.8203 2 283
7z3h-assembly2.cif.gz_B crystal structure of iba57 from chaetomium thermophilum 0.8191 2 283
7z3h-assembly3.cif.gz_C crystal structure of iba57 from chaetomium thermophilum 0.8089 2 283
ID Description Score Start End Superfamily
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9376 10 99 3.30.70.1400
af_G5EE11_2_112_3.30.70.1400 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9236 1 103 3.30.70.1400
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9167 10 99 3.30.70.1400
3girA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9063 11 95 3.30.70.1400
af_E9AH81_4_151_3.30.70.1400 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9005 3 111 3.30.70.1400
ID Description Score Start End GO Terms
AF-A0A7C9VHB0-F1-model_v4 Folate-binding protein 0.991 1 94 GO:0016226
AF-X0XDU6-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.983 1 110 GO:0016226
AF-A0A7C9VHB0-F1-model_v4 Folate-binding protein 0.9806 1 94 GO:0016226
AF-X0XDU6-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9572 1 110 GO:0016226
AF-A0A164AMH0-F1-model_v4 Folate-binding protein 0.9534 1 283 GO:0016226

Feature Viewer

pLDDT pTM Quality
86.44 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map