F475859
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 696 | 493 | 496 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300046642|Ga0495634_0235458|Ga0495634_0235458_58_1029 |
| Length | 323 |
| Sequence | VISDCPVSPETWFPQNLANISKKNLQNRPFQRMKAAFLTDRGVVKVSGEDARDFLNGLVTTDVTLLRPGLGRFGALLTPQGKIIVDFLITEAPAGHGGGFLIDCPKPLAEGLATKLKFYKLRAKVTVDNLDLGVLAAWDGQLGAQPDLAFADPRNEHLGTRILIPEDLKQKLSDLIGAELVDAADYEAHRIALGVPRGGLDFMYSDAFPHETNMDRLAGVDFDKGCYVGQEVVSRMQHRGTARTRSVKVLLEDSSPEAGVSVMAGDKSVGTMGSSAQGKGIALVRIDRVADALDAGQPLTAGGLALKLAEPEIVRIPTKQPLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 24 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 25 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 26 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 27 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 28 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 29 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 30 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 31 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 32 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 33 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 34 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 35 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 36 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 37 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 38 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 39 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 44 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 45 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 46 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 47 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 48 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 49 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 50 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 51 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 52 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 53 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 54 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 55 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 56 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 57 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 58 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 59 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 60 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 61 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 62 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 63 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 64 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 65 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 66 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 67 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 68 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 69 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 70 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 71 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 72 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 73 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 74 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 75 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 76 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 77 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 78 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 79 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 80 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 81 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 82 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 83 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 86 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 87 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 88 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 89 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 90 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 91 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 92 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 93 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 94 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 95 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 96 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 97 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 98 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 99 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 100 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 101 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 102 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 103 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 104 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 105 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 106 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 107 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 108 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 109 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 110 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 111 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 112 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 113 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 114 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 115 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 116 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 117 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 118 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 119 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 120 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 121 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 122 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 123 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 124 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 125 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 126 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 127 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 128 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 129 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 130 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 131 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 132 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 133 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 134 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 135 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 136 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 137 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 138 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 139 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 140 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 141 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 142 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 143 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 144 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 145 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 146 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 147 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 148 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 149 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 150 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 151 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 152 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 153 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 154 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 155 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 156 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 157 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 158 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 159 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 160 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 161 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 162 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 163 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 164 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 165 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 166 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 167 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 168 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 169 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 170 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 171 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 175 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 178 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 194 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 196 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 197 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 199 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 200 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 201 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 202 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 203 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 204 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 205 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 206 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 207 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 208 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 209 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 211 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 212 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 213 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 217 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 218 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 219 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 220 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 221 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 222 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 223 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 224 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 230 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 239 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 240 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 241 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 242 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 243 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 244 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 245 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 246 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 247 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 251 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 292 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 294 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 298 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 299 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 301 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 302 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 303 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 305 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 306 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 308 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 309 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 310 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 311 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 312 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 313 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 314 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 315 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 318 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 319 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 320 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 325 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 329 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 334 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 335 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 336 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 338 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 339 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 340 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 341 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 342 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 343 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 344 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 345 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 346 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 347 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 348 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 349 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 350 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 412 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 413 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 414 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 415 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 416 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 419 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 420 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 421 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 422 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 423 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 424 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 425 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 426 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 427 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 428 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 429 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 430 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 431 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 432 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 435 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 436 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 438 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 439 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 441 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 444 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 445 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 448 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 450 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 452 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 453 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 454 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 456 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 457 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 458 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 460 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 462 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 463 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 464 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 465 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 466 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 467 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 468 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 469 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 470 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 471 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 472 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 473 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 474 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 475 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 476 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 477 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 478 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 479 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 480 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 481 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 482 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 483 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 484 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 485 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 486 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 487 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 488 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 489 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 490 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 491 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 492 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 493 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.24 |
| Metatranscriptomes | 0.43 |
| Isolates | 28.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.62 |
| Nodule | 22.84 |
| Rhizoplane | 4.74 |
| Rhizosphere | 50.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002451 | 3300003215 | Bacteria | 10699 |
| 2 | JGI25153J46596_10003211 | 3300003215 | Bacteria | 9187 |
| 3 | JGI25153J46596_10015442 | 3300003215 | Bacteria | 3111 |
| 4 | JGI25160J50197_1000862 | 3300003354 | Bacteria | 16124 |
| 5 | JGI25160J50197_1001471 | 3300003354 | Bacteria | 11739 |
| 6 | JGI25160J50197_1021553 | 3300003354 | Bacteria | 1912 |
| 7 | Ga0055542_1003091 | 3300003762 | Bacteria | 4775 |
| 8 | Ga0065165_1002741 | 3300005262 | Bacteria | 14058 |
| 9 | Ga0070658_10045549 | 3300005327 | Bacteria | 3547 |
| 10 | Ga0070658_10055695 | 3300005327 | Bacteria | 3213 |
| 11 | Ga0070683_100003848 | 3300005329 | Bacteria | 12266 |
| 12 | Ga0070683_100409872 | 3300005329 | Bacteria | 1293 |
| 13 | Ga0070670_100254612 | 3300005331 | Bacteria | 1530 |
| 14 | Ga0070670_100429363 | 3300005331 | Bacteria | 1169 |
| 15 | Ga0068869_100340874 | 3300005334 | Bacteria | 1220 |
| 16 | Ga0070666_10167695 | 3300005335 | Bacteria | 1537 |
| 17 | Ga0070680_100012456 | 3300005336 | Bacteria | 6610 |
| 18 | Ga0070680_100042667 | 3300005336 | Bacteria | 3681 |
| 19 | Ga0068868_100125005 | 3300005338 | Bacteria | 2100 |
| 20 | Ga0068868_100145980 | 3300005338 | Bacteria | 1945 |
| 21 | Ga0070660_100023176 | 3300005339 | Bacteria | 4598 |
| 22 | Ga0070661_100220764 | 3300005344 | Bacteria | 1454 |
| 23 | Ga0070661_100316723 | 3300005344 | Bacteria | 1217 |
| 24 | Ga0070668_100075380 | 3300005347 | Bacteria | 2634 |
| 25 | Ga0070669_100164962 | 3300005353 | Bacteria | 1724 |
| 26 | Ga0070671_100023510 | 3300005355 | Bacteria | 5044 |
| 27 | Ga0070659_100329839 | 3300005366 | Bacteria | 1277 |
| 28 | Ga0070667_100043976 | 3300005367 | Bacteria | 3749 |
| 29 | Ga0070709_10002036 | 3300005434 | Bacteria | 10969 |
| 30 | Ga0070709_10004640 | 3300005434 | Bacteria | 7417 |
| 31 | Ga0070714_100003949 | 3300005435 | Bacteria | 11146 |
| 32 | Ga0070714_100034569 | 3300005435 | Bacteria | 4233 |
| 33 | Ga0070713_100001936 | 3300005436 | Bacteria | 13367 |
| 34 | Ga0070713_100003099 | 3300005436 | Bacteria | 10934 |
| 35 | Ga0070713_100007442 | 3300005436 | Bacteria | 7686 |
| 36 | Ga0070710_10000534 | 3300005437 | Bacteria | 17971 |
| 37 | Ga0070710_10007272 | 3300005437 | Bacteria | 5355 |
| 38 | Ga0070710_10203723 | 3300005437 | Bacteria | 1251 |
| 39 | Ga0070711_100000548 | 3300005439 | Bacteria | 19604 |
| 40 | Ga0070711_100007787 | 3300005439 | Bacteria | 6525 |
| 41 | Ga0070711_100082260 | 3300005439 | Bacteria | 2297 |
| 42 | Ga0070708_100114000 | 3300005445 | Bacteria | 2487 |
| 43 | Ga0070663_100030869 | 3300005455 | Bacteria | 3676 |
| 44 | Ga0070663_100057216 | 3300005455 | Bacteria | 2796 |
| 45 | Ga0070662_100294473 | 3300005457 | Bacteria | 1316 |
| 46 | Ga0070681_10132380 | 3300005458 | Bacteria | 2426 |
| 47 | Ga0070681_10213535 | 3300005458 | Bacteria | 1845 |
| 48 | Ga0070698_100571769 | 3300005471 | Bacteria | 1070 |
| 49 | Ga0070679_100698797 | 3300005530 | Bacteria | 957 |
| 50 | Ga0070684_100011240 | 3300005535 | Bacteria | 7127 |
| 51 | Ga0070684_100032160 | 3300005535 | Bacteria | 4470 |
| 52 | Ga0070684_100445957 | 3300005535 | Bacteria | 1196 |
| 53 | Ga0070697_100313080 | 3300005536 | Bacteria | 1351 |
| 54 | Ga0068853_100022837 | 3300005539 | Bacteria | 5228 |
| 55 | Ga0068855_100718676 | 3300005563 | Bacteria | 1067 |
| 56 | Ga0068857_100252100 | 3300005577 | Bacteria | 1618 |
| 57 | Ga0068857_100322583 | 3300005577 | Bacteria | 1427 |
| 58 | Ga0068857_100340443 | 3300005577 | Bacteria | 1388 |
| 59 | Ga0068856_100165928 | 3300005614 | Bacteria | 2219 |
| 60 | Ga0068856_100435945 | 3300005614 | Bacteria | 1330 |
| 61 | Ga0068852_100317659 | 3300005616 | Bacteria | 1512 |
| 62 | Ga0068864_100422286 | 3300005618 | Bacteria | 1271 |
| 63 | Ga0068866_10092932 | 3300005718 | Bacteria | 1647 |
| 64 | Ga0068863_100137455 | 3300005841 | Bacteria | 2335 |
| 65 | Ga0068858_100078600 | 3300005842 | Bacteria | 3066 |
| 66 | Ga0068860_100283127 | 3300005843 | Bacteria | 1621 |
| 67 | Ga0081540_1013003 | 3300005983 | Bacteria | 5436 |
| 68 | Ga0081540_1021486 | 3300005983 | Bacteria | 3840 |
| 69 | Ga0070717_10001632 | 3300006028 | Bacteria | 15573 |
| 70 | Ga0070717_10002923 | 3300006028 | Bacteria | 12133 |
| 71 | Ga0070717_10051927 | 3300006028 | Bacteria | 3376 |
| 72 | Ga0070717_10106505 | 3300006028 | Bacteria | 2387 |
| 73 | Ga0075365_10008203 | 3300006038 | Bacteria | 5911 |
| 74 | Ga0075365_10013543 | 3300006038 | Bacteria | 4883 |
| 75 | Ga0075365_10049118 | 3300006038 | Bacteria | 2779 |
| 76 | Ga0075363_100007746 | 3300006048 | Bacteria | 4960 |
| 77 | Ga0075364_10032847 | 3300006051 | Bacteria | 3337 |
| 78 | Ga0070715_10021767 | 3300006163 | Bacteria | 2491 |
| 79 | Ga0070716_100020294 | 3300006173 | Bacteria | 3487 |
| 80 | Ga0070716_100043367 | 3300006173 | Bacteria | 2515 |
| 81 | Ga0070716_100066125 | 3300006173 | Bacteria | 2108 |
| 82 | Ga0070712_100025875 | 3300006175 | Bacteria | 3904 |
| 83 | Ga0070712_100060009 | 3300006175 | Bacteria | 2681 |
| 84 | Ga0070712_100206403 | 3300006175 | Bacteria | 1547 |
| 85 | Ga0075367_10058773 | 3300006178 | Bacteria | 2288 |
| 86 | Ga0075366_10006253 | 3300006195 | Bacteria | 6510 |
| 87 | Ga0075370_10099953 | 3300006353 | Bacteria | 1678 |
| 88 | Ga0099825_1019063 | 3300006941 | Bacteria | 5183 |
| 89 | Ga0099824_1029034 | 3300006942 | Bacteria | 2416 |
| 90 | Ga0099823_1076012 | 3300006944 | Bacteria | 1389 |
| 91 | Ga0099794_10018933 | 3300007265 | Bacteria | 3094 |
| 92 | Ga0099795_10006504 | 3300007788 | Bacteria | 3193 |
| 93 | Ga0099795_10028301 | 3300007788 | Bacteria | 1904 |
| 94 | Ga0099795_10103511 | 3300007788 | Bacteria | 1120 |
| 95 | Ga0105240_10007546 | 3300009093 | Bacteria | 15763 |
| 96 | Ga0105240_10033152 | 3300009093 | Bacteria | 6675 |
| 97 | Ga0105240_10182042 | 3300009093 | Bacteria | 2479 |
| 98 | Ga0105240_10212180 | 3300009093 | Bacteria | 2261 |
| 99 | Ga0105245_10083863 | 3300009098 | Bacteria | 2918 |
| 100 | Ga0105245_10352837 | 3300009098 | Bacteria | 1458 |
| 101 | Ga0105241_10138421 | 3300009174 | Bacteria | 1979 |
| 102 | Ga0105241_10334209 | 3300009174 | Bacteria | 1310 |
| 103 | Ga0105237_10002635 | 3300009545 | Bacteria | 22084 |
| 104 | Ga0105237_10028914 | 3300009545 | Bacteria | 5641 |
| 105 | Ga0105237_10166769 | 3300009545 | Bacteria | 2201 |
| 106 | Ga0105237_10293677 | 3300009545 | Bacteria | 1628 |
| 107 | Ga0105238_10003869 | 3300009551 | Bacteria | 14870 |
| 108 | Ga0099796_10027409 | 3300010159 | Bacteria | 1819 |
| 109 | Ga0105239_10018844 | 3300010375 | Bacteria | 7625 |
| 110 | Ga0105239_10082874 | 3300010375 | Bacteria | 3532 |
| 111 | Ga0105239_10208891 | 3300010375 | Bacteria | 2188 |
| 112 | Ga0105246_10081307 | 3300011119 | Bacteria | 2309 |
| 113 | Ga0157370_10040261 | 3300013104 | Bacteria | 4512 |
| 114 | Ga0157369_10000685 | 3300013105 | Bacteria | 43830 |
| 115 | Ga0157369_10007917 | 3300013105 | Bacteria | 12218 |
| 116 | Ga0157369_10836450 | 3300013105 | Bacteria | 945 |
| 117 | Ga0157375_10251135 | 3300013308 | Bacteria | 1929 |
| 118 | Ga0163163_10260403 | 3300014325 | Bacteria | 1785 |
| 119 | Ga0157379_10247644 | 3300014968 | Bacteria | 1617 |
| 120 | Ga0163161_10230262 | 3300017792 | Bacteria | 1438 |
| 121 | Ga0197907_11507651 | 3300020069 | Bacteria | 1007 |
| 122 | Ga0206350_11404750 | 3300020080 | Bacteria | 1776 |
| 123 | Ga0206353_11430012 | 3300020082 | Bacteria | 1045 |
| 124 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 125 | Ga0214544_1025712 | 3300021320 | Bacteria | 2765 |
| 126 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 127 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 128 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 129 | Ga0213872_10030128 | 3300021361 | Bacteria | 2488 |
| 130 | Ga0213876_10064728 | 3300021384 | Bacteria | 1929 |
| 131 | Ga0209148_1000654 | 3300025254 | Bacteria | 29905 |
| 132 | Ga0209233_1009814 | 3300025261 | Bacteria | 2897 |
| 133 | Ga0209455_1008424 | 3300025272 | Bacteria | 2804 |
| 134 | Ga0209564_1009980 | 3300025295 | Bacteria | 4436 |
| 135 | Ga0209758_1000320 | 3300025297 | Bacteria | 92649 |
| 136 | Ga0209758_1001495 | 3300025297 | Bacteria | 27238 |
| 137 | Ga0207426_1000746 | 3300025302 | Bacteria | 36609 |
| 138 | Ga0207426_1001214 | 3300025302 | Bacteria | 22769 |
| 139 | Ga0207426_1004351 | 3300025302 | Bacteria | 6962 |
| 140 | Ga0207426_1028304 | 3300025302 | Bacteria | 1859 |
| 141 | Ga0209257_1012298 | 3300025304 | Bacteria | 3979 |
| 142 | Ga0207692_10000091 | 3300025898 | Bacteria | 26705 |
| 143 | Ga0207692_10001475 | 3300025898 | Bacteria | 8812 |
| 144 | Ga0207692_10111587 | 3300025898 | Bacteria | 1517 |
| 145 | Ga0207710_10094440 | 3300025900 | Bacteria | 1404 |
| 146 | Ga0207685_10012829 | 3300025905 | Bacteria | 2571 |
| 147 | Ga0207685_10125208 | 3300025905 | Bacteria | 1134 |
| 148 | Ga0207699_10000782 | 3300025906 | Bacteria | 15227 |
| 149 | Ga0207699_10185077 | 3300025906 | Bacteria | 1402 |
| 150 | Ga0207705_10032876 | 3300025909 | Bacteria | 3706 |
| 151 | Ga0207705_10146047 | 3300025909 | Bacteria | 1769 |
| 152 | Ga0207654_10010107 | 3300025911 | Bacteria | 4800 |
| 153 | Ga0207654_10078650 | 3300025911 | Bacteria | 1979 |
| 154 | Ga0207654_10106473 | 3300025911 | Bacteria | 1737 |
| 155 | Ga0207707_10001881 | 3300025912 | Bacteria | 19162 |
| 156 | Ga0207707_10094903 | 3300025912 | Bacteria | 2607 |
| 157 | Ga0207695_10000503 | 3300025913 | Bacteria | 83026 |
| 158 | Ga0207695_10320320 | 3300025913 | Bacteria | 1440 |
| 159 | Ga0207695_10512624 | 3300025913 | Bacteria | 1081 |
| 160 | Ga0207671_10001399 | 3300025914 | Bacteria | 28067 |
| 161 | Ga0207671_10040110 | 3300025914 | Bacteria | 3466 |
| 162 | Ga0207671_10199188 | 3300025914 | Bacteria | 1563 |
| 163 | Ga0207671_10296628 | 3300025914 | Bacteria | 1277 |
| 164 | Ga0207693_10000479 | 3300025915 | Bacteria | 36362 |
| 165 | Ga0207693_10029076 | 3300025915 | Bacteria | 4368 |
| 166 | Ga0207693_10111691 | 3300025915 | Bacteria | 2144 |
| 167 | Ga0207693_10336961 | 3300025915 | Bacteria | 1180 |
| 168 | Ga0207663_10023702 | 3300025916 | Bacteria | 3526 |
| 169 | Ga0207663_10047322 | 3300025916 | Bacteria | 2655 |
| 170 | Ga0207663_10051544 | 3300025916 | Bacteria | 2563 |
| 171 | Ga0207660_10005375 | 3300025917 | Bacteria | 8316 |
| 172 | Ga0207657_10005742 | 3300025919 | Bacteria | 12944 |
| 173 | Ga0207657_10097086 | 3300025919 | Bacteria | 2450 |
| 174 | Ga0207649_10242530 | 3300025920 | Bacteria | 1294 |
| 175 | Ga0207652_10001649 | 3300025921 | Bacteria | 19585 |
| 176 | Ga0207681_10098872 | 3300025923 | Bacteria | 2100 |
| 177 | Ga0207694_10041393 | 3300025924 | Bacteria | 3550 |
| 178 | Ga0207687_10095563 | 3300025927 | Bacteria | 2176 |
| 179 | Ga0207687_10188571 | 3300025927 | Bacteria | 1603 |
| 180 | Ga0207700_10001432 | 3300025928 | Bacteria | 13527 |
| 181 | Ga0207700_10018197 | 3300025928 | Bacteria | 4715 |
| 182 | Ga0207700_10083703 | 3300025928 | Bacteria | 2498 |
| 183 | Ga0207700_10163042 | 3300025928 | Bacteria | 1853 |
| 184 | Ga0207664_10023054 | 3300025929 | Bacteria | 4659 |
| 185 | Ga0207664_10320258 | 3300025929 | Bacteria | 1368 |
| 186 | Ga0207664_10397233 | 3300025929 | Bacteria | 1226 |
| 187 | Ga0207644_10020693 | 3300025931 | Bacteria | 4476 |
| 188 | Ga0207644_10314371 | 3300025931 | Bacteria | 1265 |
| 189 | Ga0207690_10138022 | 3300025932 | Bacteria | 1793 |
| 190 | Ga0207706_10111396 | 3300025933 | Bacteria | 2408 |
| 191 | Ga0207665_10000090 | 3300025939 | Bacteria | 58962 |
| 192 | Ga0207665_10038595 | 3300025939 | Bacteria | 3181 |
| 193 | Ga0207665_10055097 | 3300025939 | Bacteria | 2682 |
| 194 | Ga0207665_10240190 | 3300025939 | Bacteria | 1334 |
| 195 | Ga0207691_10377591 | 3300025940 | Bacteria | 1210 |
| 196 | Ga0207711_10121596 | 3300025941 | Bacteria | 2331 |
| 197 | Ga0207661_10010365 | 3300025944 | Bacteria | 6707 |
| 198 | Ga0207661_10121205 | 3300025944 | Bacteria | 2227 |
| 199 | Ga0207667_10037563 | 3300025949 | Bacteria | 5176 |
| 200 | Ga0207667_10373362 | 3300025949 | Bacteria | 1453 |
| 201 | Ga0207668_10535684 | 3300025972 | Bacteria | 1012 |
| 202 | Ga0207640_10059884 | 3300025981 | Bacteria | 2514 |
| 203 | Ga0207640_10369449 | 3300025981 | Bacteria | 1159 |
| 204 | Ga0207658_10236281 | 3300025986 | Bacteria | 1545 |
| 205 | Ga0207639_10021282 | 3300026041 | Bacteria | 4656 |
| 206 | Ga0207702_10040866 | 3300026078 | Bacteria | 3888 |
| 207 | Ga0207676_10269952 | 3300026095 | Bacteria | 1540 |
| 208 | Ga0207674_10023609 | 3300026116 | Bacteria | 6584 |
| 209 | Ga0207683_10271120 | 3300026121 | Bacteria | 1550 |
| 210 | Ga0207698_10005624 | 3300026142 | Bacteria | 7758 |
| 211 | Ga0207698_10628552 | 3300026142 | Bacteria | 1061 |
| 212 | Ga0209389_1000009 | 3300027296 | Bacteria | 226873 |
| 213 | Ga0209389_1000212 | 3300027296 | Bacteria | 40932 |
| 214 | Ga0209589_1001280 | 3300027357 | Bacteria | 40932 |
| 215 | Ga0209489_100085 | 3300027361 | Bacteria | 126199 |
| 216 | Ga0209489_100671 | 3300027361 | Bacteria | 66550 |
| 217 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 218 | Ga0209588_1014517 | 3300027671 | Bacteria | 2413 |
| 219 | Ga0268265_10149498 | 3300028380 | Bacteria | 1968 |
| 220 | Ga0268265_10206812 | 3300028380 | Bacteria | 1707 |
| 221 | Ga0307515_10035411 | 3300028794 | Bacteria | 8123 |
| 222 | Ga0265328_10000003 | 3300031239 | Bacteria | 251251 |
| 223 | Ga0265328_10000009 | 3300031239 | Bacteria | 179784 |
| 224 | Ga0265329_10008765 | 3300031242 | Bacteria | 3816 |
| 225 | Ga0265340_10047459 | 3300031247 | Bacteria | 2091 |
| 226 | Ga0265339_10003778 | 3300031249 | Bacteria | 10553 |
| 227 | Ga0265331_10002269 | 3300031250 | Bacteria | 13138 |
| 228 | Ga0265327_10064914 | 3300031251 | Bacteria | 1848 |
| 229 | Ga0265316_10001770 | 3300031344 | Bacteria | 22813 |
| 230 | Ga0265316_10106910 | 3300031344 | Bacteria | 2122 |
| 231 | Ga0307508_10179931 | 3300031616 | Bacteria | 1717 |
| 232 | Ga0265314_10036676 | 3300031711 | Bacteria | 3559 |
| 233 | Ga0265342_10012254 | 3300031712 | Bacteria | 5814 |
| 234 | Ga0307516_10112249 | 3300031730 | Bacteria | 2526 |
| 235 | Ga0307516_10152063 | 3300031730 | Bacteria | 2073 |
| 236 | Ga0307413_10044248 | 3300031824 | Bacteria | 2630 |
| 237 | Ga0307409_100654843 | 3300031995 | Bacteria | 1044 |
| 238 | Ga0307411_10118895 | 3300032005 | Bacteria | 1907 |
| 239 | Ga0307415_100298519 | 3300032126 | Bacteria | 1333 |
| 240 | Ga0307510_10018893 | 3300033180 | Bacteria | 8091 |
| 241 | Ga0307510_10133497 | 3300033180 | Bacteria | 2147 |
| 242 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 243 | Ga0373923_0031097 | 3300035111 | Bacteria | 2150 |
| 244 | Ga0373932_0035778 | 3300035112 | Bacteria | 1406 |
| 245 | Ga0373936_0011362 | 3300035113 | Bacteria | 3370 |
| 246 | Ga0373943_0009282 | 3300035170 | Bacteria | 4408 |
| 247 | Ga0373943_0016263 | 3300035170 | Bacteria | 3390 |
| 248 | Ga0373946_0007518 | 3300035171 | Bacteria | 3985 |
| 249 | Ga0373955_0004218 | 3300035172 | Bacteria | 6343 |
| 250 | Ga0373931_0052031 | 3300035691 | Bacteria | 2182 |
| 251 | Ga0373935_0001222 | 3300035692 | Bacteria | 14189 |
| 252 | Ga0373935_0097514 | 3300035692 | Bacteria | 1934 |
| 253 | Ga0373935_0453053 | 3300035692 | Bacteria | 927 |
| 254 | Ga0373927_0001984 | 3300035695 | Bacteria | 15075 |
| 255 | Ga0373927_0002079 | 3300035695 | Bacteria | 14787 |
| 256 | Ga0373927_0027195 | 3300035695 | Bacteria | 3736 |
| 257 | Ga0373927_0046825 | 3300035695 | Bacteria | 2797 |
| 258 | Ga0373927_0054260 | 3300035695 | Bacteria | 2592 |
| 259 | Ga0373933_0000038 | 3300035724 | Bacteria | 80976 |
| 260 | Ga0373933_0105662 | 3300035724 | Bacteria | 1751 |
| 261 | Ga0373947_0009808 | 3300035725 | Bacteria | 5493 |
| 262 | Ga0373947_0040566 | 3300035725 | Bacteria | 2773 |
| 263 | Ga0373937_0005511 | 3300036401 | Bacteria | 10850 |
| 264 | Ga0373937_0016644 | 3300036401 | Bacteria | 6533 |
| 265 | Ga0373925_0002028 | 3300037068 | Bacteria | 16732 |
| 266 | Ga0373925_0020481 | 3300037068 | Bacteria | 4815 |
| 267 | Ga0373925_0049703 | 3300037068 | Bacteria | 3126 |
| 268 | Ga0395899_0043622 | 3300037312 | Bacteria | 3345 |
| 269 | Ga0395900_0000134 | 3300037418 | Bacteria | 124444 |
| 270 | Ga0395900_0022534 | 3300037418 | Bacteria | 6444 |
| 271 | Ga0395900_0399569 | 3300037418 | Bacteria | 1339 |
| 272 | Ga0395898_0036137 | 3300037466 | Bacteria | 4907 |
| 273 | Ga0395898_0146261 | 3300037466 | Bacteria | 2262 |
| 274 | Ga0395898_0252984 | 3300037466 | Bacteria | 1680 |
| 275 | Ga0395905_0035844 | 3300037471 | Bacteria | 4659 |
| 276 | Ga0395901_0054972 | 3300038443 | Bacteria | 4139 |
| 277 | Ga0395901_0549710 | 3300038443 | Bacteria | 1170 |
| 278 | Ga0395901_0655079 | 3300038443 | Bacteria | 1053 |
| 279 | Ga0436365_0365623 | 3300039437 | Bacteria | 31548 |
| 280 | Ga0436365_0458346 | 3300039437 | Bacteria | 1462 |
| 281 | Ga0436365_1058288 | 3300039437 | Bacteria | 3286 |
| 282 | Ga0436363_0840229 | 3300039450 | Bacteria | 1741 |
| 283 | Ga0436362_0868242 | 3300039453 | Bacteria | 9788 |
| 284 | Ga0451791_0429136 | 3300041451 | Bacteria | 1265 |
| 285 | Ga0451797_0952982 | 3300041453 | Bacteria | 1562 |
| 286 | Ga0466969_0038849 | 3300044656 | Bacteria | 2393 |
| 287 | Ga0466969_0039662 | 3300044656 | Bacteria | 2364 |
| 288 | Ga0466972_0000363 | 3300044658 | Bacteria | 24488 |
| 289 | Ga0466966_0002193 | 3300044684 | Bacteria | 12682 |
| 290 | Ga0466961_0000090 | 3300044693 | Bacteria | 57757 |
| 291 | Ga0466963_0065260 | 3300044694 | Bacteria | 2440 |
| 292 | Ga0466964_0163970 | 3300044706 | Bacteria | 1041 |
| 293 | Ga0466970_0151726 | 3300044765 | Bacteria | 1279 |
| 294 | Ga0466957_0183879 | 3300044842 | Bacteria | 1366 |
| 295 | Ga0466960_0152502 | 3300044901 | Bacteria | 1235 |
| 296 | Ga0466959_0010358 | 3300045049 | Bacteria | 6659 |
| 297 | Ga0466958_0184661 | 3300045836 | Bacteria | 1324 |
| 298 | Ga0466967_0150799 | 3300045976 | Bacteria | 2172 |
| 299 | Ga0466967_0356655 | 3300045976 | Bacteria | 1416 |
| 300 | Ga0495592_0077905 | 3300046454 | Bacteria | 2401 |
| 301 | Ga0495592_0102177 | 3300046454 | Bacteria | 2041 |
| 302 | Ga0495603_0001123 | 3300046455 | Bacteria | 15577 |
| 303 | Ga0495603_0001668 | 3300046455 | Bacteria | 13022 |
| 304 | Ga0495629_0000316 | 3300046459 | Bacteria | 41262 |
| 305 | Ga0495629_0000900 | 3300046459 | Bacteria | 23863 |
| 306 | Ga0495638_0003425 | 3300046460 | Bacteria | 12493 |
| 307 | Ga0495641_0003654 | 3300046461 | Bacteria | 11359 |
| 308 | Ga0495651_0008870 | 3300046462 | Bacteria | 7721 |
| 309 | Ga0495651_0021715 | 3300046462 | Bacteria | 4989 |
| 310 | Ga0495651_0051135 | 3300046462 | Bacteria | 3187 |
| 311 | Ga0495653_0022549 | 3300046463 | Bacteria | 5093 |
| 312 | Ga0495653_0320618 | 3300046463 | Bacteria | 1004 |
| 313 | Ga0495650_0116042 | 3300046471 | Bacteria | 989 |
| 314 | Ga0495580_0004684 | 3300046472 | Bacteria | 11472 |
| 315 | Ga0495580_0068041 | 3300046472 | Bacteria | 2491 |
| 316 | Ga0495580_0329920 | 3300046472 | Bacteria | 1036 |
| 317 | Ga0495582_0000038 | 3300046473 | Bacteria | 67536 |
| 318 | Ga0495605_0051914 | 3300046474 | Bacteria | 1995 |
| 319 | Ga0495639_0000050 | 3300046475 | Bacteria | 52004 |
| 320 | Ga0495639_0121931 | 3300046475 | Bacteria | 1244 |
| 321 | Ga0495662_0001679 | 3300046476 | Bacteria | 11042 |
| 322 | Ga0495664_0022812 | 3300046477 | Bacteria | 3630 |
| 323 | Ga0495664_0072782 | 3300046477 | Bacteria | 2054 |
| 324 | Ga0495594_0000658 | 3300046499 | Bacteria | 17863 |
| 325 | Ga0495594_0073885 | 3300046499 | Bacteria | 1899 |
| 326 | Ga0495594_0089452 | 3300046499 | Bacteria | 1724 |
| 327 | Ga0495606_0023497 | 3300046507 | Bacteria | 4464 |
| 328 | Ga0495606_0035170 | 3300046507 | Bacteria | 3428 |
| 329 | Ga0495606_0194593 | 3300046507 | Bacteria | 1160 |
| 330 | Ga0495608_0052028 | 3300046511 | Bacteria | 2712 |
| 331 | Ga0495616_0023053 | 3300046513 | Bacteria | 3354 |
| 332 | Ga0495616_0064887 | 3300046513 | Bacteria | 1781 |
| 333 | Ga0495620_0100323 | 3300046515 | Bacteria | 1155 |
| 334 | Ga0495628_0037210 | 3300046516 | Bacteria | 3902 |
| 335 | Ga0495628_0040123 | 3300046516 | Bacteria | 3742 |
| 336 | Ga0495630_0002603 | 3300046517 | Bacteria | 12502 |
| 337 | Ga0495631_0120051 | 3300046518 | Bacteria | 1131 |
| 338 | Ga0495643_0005438 | 3300046522 | Bacteria | 8618 |
| 339 | Ga0495648_0044876 | 3300046524 | Bacteria | 2755 |
| 340 | Ga0495666_0110841 | 3300046526 | Bacteria | 1289 |
| 341 | Ga0495666_0129561 | 3300046526 | Bacteria | 1179 |
| 342 | Ga0495666_0165031 | 3300046526 | Bacteria | 1026 |
| 343 | Ga0495652_0027943 | 3300046529 | Bacteria | 4968 |
| 344 | Ga0495652_0151590 | 3300046529 | Bacteria | 1810 |
| 345 | Ga0495665_0000732 | 3300046531 | Bacteria | 16988 |
| 346 | Ga0495640_0004317 | 3300046533 | Bacteria | 11356 |
| 347 | Ga0495640_0038743 | 3300046533 | Bacteria | 3351 |
| 348 | Ga0495587_0016459 | 3300046536 | Bacteria | 4599 |
| 349 | Ga0495645_0020249 | 3300046543 | Bacteria | 4797 |
| 350 | Ga0495622_0007054 | 3300046557 | Bacteria | 5217 |
| 351 | Ga0495622_0030034 | 3300046557 | Bacteria | 2539 |
| 352 | Ga0495667_0044118 | 3300046559 | Bacteria | 2953 |
| 353 | Ga0495667_0054691 | 3300046559 | Bacteria | 2626 |
| 354 | Ga0495668_0020048 | 3300046616 | Bacteria | 3846 |
| 355 | Ga0495634_0000931 | 3300046642 | Bacteria | 27727 |
| 356 | Ga0495634_0235458 | 3300046642 | Bacteria | 1125 |
| 357 | Ga0495611_0041916 | 3300046648 | Bacteria | 2043 |
| 358 | Ga0495635_0000415 | 3300046663 | Bacteria | 27018 |
| 359 | Ga0495635_0006765 | 3300046663 | Bacteria | 8010 |
| 360 | Ga0495588_0028455 | 3300046674 | Bacteria | 2797 |
| 361 | Ga0495588_0031715 | 3300046674 | Bacteria | 2661 |
| 362 | Ga0495657_0006673 | 3300046675 | Bacteria | 9015 |
| 363 | Ga0495599_0050345 | 3300046678 | Bacteria | 2610 |
| 364 | Ga0495599_0059742 | 3300046678 | Bacteria | 2384 |
| 365 | Ga0495623_0029798 | 3300046679 | Bacteria | 3511 |
| 366 | Ga0495646_0005444 | 3300046680 | Bacteria | 8046 |
| 367 | Ga0495646_0065851 | 3300046680 | Bacteria | 2144 |
| 368 | Ga0495646_0098079 | 3300046680 | Bacteria | 1683 |
| 369 | Ga0495647_0000195 | 3300046681 | Bacteria | 16130 |
| 370 | Ga0495658_0000802 | 3300046683 | Bacteria | 16866 |
| 371 | Ga0495658_0168872 | 3300046683 | Bacteria | 1353 |
| 372 | Ga0495613_0002073 | 3300046689 | Bacteria | 15236 |
| 373 | Ga0495613_0036466 | 3300046689 | Bacteria | 3646 |
| 374 | Ga0495613_0108789 | 3300046689 | Bacteria | 1999 |
| 375 | Ga0495613_0230663 | 3300046689 | Bacteria | 1297 |
| 376 | Ga0495624_0013276 | 3300046690 | Bacteria | 5615 |
| 377 | Ga0495624_0097188 | 3300046690 | Bacteria | 1814 |
| 378 | Ga0495589_0129931 | 3300046794 | Bacteria | 1210 |
| 379 | Ga0495600_0007520 | 3300046809 | Bacteria | 6669 |
| 380 | Ga0495600_0048237 | 3300046809 | Bacteria | 2778 |
| 381 | Ga0495581_0005552 | 3300047315 | Bacteria | 7306 |
| 382 | Ga0495581_0025276 | 3300047315 | Bacteria | 3444 |
| 383 | Ga0495581_0091925 | 3300047315 | Bacteria | 1761 |
| 384 | Ga0495581_0137962 | 3300047315 | Bacteria | 1422 |
| 385 | Ga0495604_0006276 | 3300047317 | Bacteria | 9434 |
| 386 | Ga0495604_0040819 | 3300047317 | Bacteria | 3641 |
| 387 | Ga0495674_0013016 | 3300047319 | Bacteria | 7831 |
| 388 | Ga0495676_0178340 | 3300047321 | Bacteria | 1491 |
| 389 | Ga0495680_0007943 | 3300047322 | Bacteria | 9680 |
| 390 | Ga0495683_0133210 | 3300047323 | Bacteria | 1170 |
| 391 | Ga0495687_020454 | 3300047443 | Bacteria | 3224 |
| 392 | Ga0495675_0003949 | 3300047444 | Bacteria | 8991 |
| 393 | Ga0495673_0018019 | 3300047469 | Bacteria | 3571 |
| 394 | Ga0495684_0007203 | 3300047471 | Bacteria | 8634 |
| 395 | Ga0495684_0053921 | 3300047471 | Bacteria | 3067 |
| 396 | Ga0495593_0000291 | 3300047673 | Bacteria | 27242 |
| 397 | Ga0495602_0013244 | 3300048088 | Bacteria | 8434 |
| 398 | Ga0495602_0089560 | 3300048088 | Bacteria | 2558 |
| 399 | Ga0495602_0182140 | 3300048088 | Bacteria | 1619 |
| 400 | Ga0495602_0216323 | 3300048088 | Bacteria | 1450 |
| 401 | Ga0496100_0420916 | 3300048903 | Bacteria | 1020 |
| 402 | Ga0496101_0016399 | 3300048904 | Bacteria | 5004 |
| 403 | Ga0496101_0093709 | 3300048904 | Bacteria | 2237 |
| 404 | Ga0496101_0201487 | 3300048904 | Bacteria | 1539 |
| 405 | Ga0496102_0364182 | 3300048905 | Bacteria | 1361 |
| 406 | Ga0496103_0007433 | 3300048906 | Bacteria | 6530 |
| 407 | Ga0496104_0002707 | 3300048907 | Bacteria | 15254 |
| 408 | Ga0496104_0033366 | 3300048907 | Bacteria | 4794 |
| 409 | Ga0496104_0151185 | 3300048907 | Bacteria | 2228 |
| 410 | Ga0496105_0003571 | 3300048908 | Bacteria | 11538 |
| 411 | Ga0496105_0055582 | 3300048908 | Bacteria | 3268 |
| 412 | Ga0496105_0098375 | 3300048908 | Bacteria | 2416 |
| 413 | Ga0496107_0185189 | 3300048910 | Bacteria | 1546 |
| 414 | Ga0496107_0247923 | 3300048910 | Bacteria | 1325 |
| 415 | Ga0496108_0034095 | 3300048911 | Bacteria | 4229 |
| 416 | Ga0496108_0159285 | 3300048911 | Bacteria | 1950 |
| 417 | Ga0496109_0062374 | 3300048912 | Bacteria | 3408 |
| 418 | Ga0496110_0138945 | 3300048913 | Bacteria | 2196 |
| 419 | Ga0496110_0595633 | 3300048913 | Bacteria | 1003 |
| 420 | Ga0496112_0052736 | 3300048915 | Bacteria | 3992 |
| 421 | Ga0496112_0203106 | 3300048915 | Bacteria | 1940 |
| 422 | Ga0496112_0205840 | 3300048915 | Bacteria | 1926 |
| 423 | Ga0496113_0295209 | 3300048916 | Bacteria | 1297 |
| 424 | Ga0496114_0026045 | 3300048917 | Bacteria | 4785 |
| 425 | Ga0496114_0219475 | 3300048917 | Bacteria | 1669 |
| 426 | Ga0496115_0014957 | 3300048918 | Bacteria | 5882 |
| 427 | Ga0496115_0020501 | 3300048918 | Bacteria | 5101 |
| 428 | Ga0496115_0063096 | 3300048918 | Bacteria | 2989 |
| 429 | Ga0496115_0115536 | 3300048918 | Bacteria | 2207 |
| 430 | Ga0496115_0189441 | 3300048918 | Bacteria | 1699 |
| 431 | Ga0496116_0043348 | 3300048919 | Bacteria | 3066 |
| 432 | Ga0496116_0086484 | 3300048919 | Bacteria | 1923 |
| 433 | Ga0496117_0053075 | 3300048920 | Bacteria | 2851 |
| 434 | Ga0496118_0094901 | 3300048921 | Bacteria | 2038 |
| 435 | Ga0496118_0123848 | 3300048921 | Bacteria | 1678 |
| 436 | Ga0496118_0239225 | 3300048921 | Bacteria | 1041 |
| 437 | Ga0496119_0053771 | 3300048922 | Bacteria | 2457 |
| 438 | Ga0496119_0068638 | 3300048922 | Bacteria | 2086 |
| 439 | Ga0496120_0023635 | 3300048923 | Bacteria | 3844 |
| 440 | Ga0496120_0134452 | 3300048923 | Bacteria | 1262 |
| 441 | Ga0496120_0185687 | 3300048923 | Bacteria | 1017 |
| 442 | Ga0496121_0004381 | 3300048924 | Bacteria | 19069 |
| 443 | Ga0496121_0093712 | 3300048924 | Bacteria | 2337 |
| 444 | Ga0496121_0115231 | 3300048924 | Bacteria | 2041 |
| 445 | Ga0496121_0121330 | 3300048924 | Bacteria | 1974 |
| 446 | Ga0496121_0182565 | 3300048924 | Bacteria | 1512 |
| 447 | Ga0496121_0227800 | 3300048924 | Bacteria | 1307 |
| 448 | Ga0496122_0031165 | 3300048925 | Bacteria | 4446 |
| 449 | Ga0496122_0166606 | 3300048925 | Bacteria | 1335 |
| 450 | Ga0496124_0165758 | 3300048927 | Bacteria | 1717 |
| 451 | Ga0496124_0169879 | 3300048927 | Bacteria | 1690 |
| 452 | Ga0496126_0011094 | 3300048929 | Bacteria | 9362 |
| 453 | Ga0496126_0020402 | 3300048929 | Bacteria | 6498 |
| 454 | Ga0496126_0041687 | 3300048929 | Bacteria | 4246 |
| 455 | Ga0496126_0046829 | 3300048929 | Bacteria | 3962 |
| 456 | Ga0496126_0141572 | 3300048929 | Bacteria | 2070 |
| 457 | Ga0496126_0180251 | 3300048929 | Bacteria | 1795 |
| 458 | Ga0496126_0356276 | 3300048929 | Bacteria | 1196 |
| 459 | Ga0495682_0063244 | 3300049460 | Bacteria | 1335 |
| 460 | Ga0501044_0168504 | 3300049823 | Bacteria | 2163 |
| 461 | nmdc:mga00v17_28031_c1 | 3300050491 | Bacteria | 3294 |
| 462 | nmdc:mga0yw44_12366_c1 | 3300050492 | Bacteria | 4446 |
| 463 | nmdc:mga0yw44_9102_c1 | 3300050492 | Bacteria | 4995 |
| 464 | nmdc:mga06z11_18221_c1 | 3300050494 | Bacteria | 3203 |
| 465 | nmdc:mga04h51_8605_c1 | 3300050495 | Bacteria | 2734 |
| 466 | nmdc:mga07m45_12697_c1 | 3300050496 | Bacteria | 4454 |
| 467 | nmdc:mga07m45_14394_c1 | 3300050496 | Bacteria | 4213 |
| 468 | nmdc:mga0sz30_48285_c1 | 3300050516 | Bacteria | 1801 |
| 469 | nmdc:mga0sz30_91389_c1 | 3300050516 | Bacteria | 1325 |
| 470 | Ga0500610_0086510 | 3300053079 | Bacteria | 1631 |
| 471 | Ga0495655_0064603 | 3300053083 | Bacteria | 1008 |
| 472 | Ga0495619_0072419 | 3300053085 | Bacteria | 2308 |
| 473 | Ga0495619_0128440 | 3300053085 | Bacteria | 1741 |
| 474 | Ga0500578_0252381 | 3300053086 | Bacteria | 1062 |
| 475 | Ga0500643_000047 | 3300053087 | Bacteria | 148938 |
| 476 | Ga0500566_0027227 | 3300053094 | Bacteria | 3345 |
| 477 | Ga0500641_0107328 | 3300053096 | Bacteria | 1200 |
| 478 | Ga0500555_007180 | 3300053103 | Bacteria | 3165 |
| 479 | Ga0500556_0004374 | 3300053104 | Bacteria | 4025 |
| 480 | Ga0500557_000078 | 3300053105 | Bacteria | 36522 |
| 481 | Ga0500572_001844 | 3300053111 | Bacteria | 5368 |
| 482 | Ga0500595_002149 | 3300053119 | Bacteria | 10038 |
| 483 | Ga0500607_061424 | 3300053121 | Bacteria | 1967 |
| 484 | Ga0500621_050726 | 3300053126 | Bacteria | 1680 |
| 485 | Ga0500642_0005047 | 3300053130 | Bacteria | 4212 |
| 486 | Ga0500642_0008914 | 3300053130 | Bacteria | 3456 |
| 487 | Ga0500652_021783 | 3300053131 | Bacteria | 2418 |
| 488 | Ga0500559_0000226 | 3300053136 | Bacteria | 45182 |
| 489 | Ga0500559_0015797 | 3300053136 | Bacteria | 3189 |
| 490 | Ga0500639_022150 | 3300053163 | Bacteria | 3356 |
| 491 | Ga0500636_0000024 | 3300053177 | Bacteria | 86744 |
| 492 | Ga0500625_014244 | 3300053729 | Bacteria | 3671 |
| 493 | Ga0500609_002803 | 3300053731 | Bacteria | 2484 |
| 494 | Ga0500552_002622 | 3300053733 | Bacteria | 1766 |
| 495 | Ga0500596_002085 | 3300053735 | Bacteria | 3977 |
| 496 | Ga0500601_000078 | 3300053737 | Bacteria | 20015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0168504 | Ga0501044_0168504_489_1370 | 258 |
| 2 | 3300031239 | Ga0265328_10000003 | Ga0265328_10000003186 | 272 |
| 3 | 3300031242 | Ga0265329_10008765 | Ga0265329_100087654 | 272 |
| 4 | 3300031250 | Ga0265331_10002269 | Ga0265331_100022695 | 272 |
| 5 | 3300031251 | Ga0265327_10064914 | Ga0265327_100649143 | 272 |
| 6 | 3300031344 | Ga0265316_10001770 | Ga0265316_1000177011 | 272 |
| 7 | iso_pu_bacteria | 2906635258 | 2906642408 | 276 |
| 8 | iso_pu_bacteria | 2906660503 | 2906660715 | 276 |
| 9 | 3300031239 | Ga0265328_10000009 | Ga0265328_1000000974 | 277 |
| 10 | iso_pu_bacteria | 2885374607 | 2885379779 | 277 |
| 11 | iso_pu_bacteria | 2904690495 | 2904697817 | 277 |
| 12 | iso_pu_bacteria | 2906610324 | 2906611559 | 277 |
| 13 | iso_pu_bacteria | 2908739725 | 2908745139 | 277 |
| 14 | iso_pu_bacteria | 2908756301 | 2908762809 | 277 |
| 15 | iso_pu_bacteria | 2922425934 | 2922427790 | 277 |
| 16 | 3300039437 | Ga0436365_0365623 | Ga0436365_0365623_19132_20010 | 278 |
| 17 | 3300039450 | Ga0436363_0840229 | Ga0436363_0840229_188_1066 | 278 |
| 18 | 3300039453 | Ga0436362_0868242 | Ga0436362_0868242_626_1504 | 278 |
| 19 | 3300046794 | Ga0495589_0129931 | Ga0495589_0129931_161_1003 | 278 |
| 20 | 3300007265 | Ga0099794_10018933 | Ga0099794_100189331 | 281 |
| 21 | 3300017792 | Ga0163161_10230262 | Ga0163161_102302622 | 281 |
| 22 | 3300035692 | Ga0373935_0453053 | Ga0373935_0453053_60_911 | 281 |
| 23 | 3300046526 | Ga0495666_0165031 | Ga0495666_0165031_169_1014 | 281 |
| 24 | 3300046690 | Ga0495624_0097188 | Ga0495624_0097188_26_871 | 281 |
| 25 | 3300048918 | Ga0496115_0189441 | Ga0496115_0189441_27_872 | 281 |
| 26 | 3300053096 | Ga0500641_0107328 | Ga0500641_0107328_345_1190 | 281 |
| 27 | 3300053126 | Ga0500621_050726 | Ga0500621_050726_20_865 | 281 |
| 28 | iso_pu_bacteria | 2507262055 | 2507507280 | 287 |
| 29 | iso_pu_bacteria | 2508501009 | 2508541336 | 287 |
| 30 | iso_pu_bacteria | 2508501042 | 2508693334 | 287 |
| 31 | iso_pu_bacteria | 2511231028 | 2511401369 | 287 |
| 32 | iso_pu_bacteria | 2513237092 | 2513626379 | 287 |
| 33 | iso_pu_bacteria | 2513237094 | 2513637090 | 287 |
| 34 | iso_pu_bacteria | 2513237095 | 2513652527 | 287 |
| 35 | iso_pu_bacteria | 2513237096 | 2513655110 | 287 |
| 36 | iso_pu_bacteria | 2513237102 | 2513705956 | 287 |
| 37 | iso_pu_bacteria | 2513237137 | 2513863245 | 287 |
| 38 | iso_pu_bacteria | 2513237139 | 2513876657 | 287 |
| 39 | iso_pu_bacteria | 2513237141 | 2513887409 | 287 |
| 40 | iso_pu_bacteria | 2513237145 | 2513915867 | 287 |
| 41 | iso_pu_bacteria | 2513237161 | 2514012298 | 287 |
| 42 | iso_pu_bacteria | 2515154112 | 2515631416 | 287 |
| 43 | iso_pu_bacteria | 2517093001 | 2517104792 | 287 |
| 44 | iso_pu_bacteria | 2517572143 | 2517894829 | 287 |
| 45 | iso_pu_bacteria | 2524023205 | 2524440600 | 287 |
| 46 | iso_pu_bacteria | 2524023228 | 2524534594 | 287 |
| 47 | iso_pu_bacteria | 2528768022 | 2528855365 | 287 |
| 48 | iso_pu_bacteria | 2617270735 | 2617354210 | 287 |
| 49 | iso_pu_bacteria | 2617270741 | 2617373119 | 287 |
| 50 | iso_pu_bacteria | 2667528175 | 2671119244 | 287 |
| 51 | iso_pu_bacteria | 2744054633 | 2745079312 | 287 |
| 52 | iso_pu_bacteria | 2791355196 | 2793061264 | 287 |
| 53 | iso_pu_bacteria | 2791355197 | 2793071916 | 287 |
| 54 | iso_pu_bacteria | 2802429603 | 2805918637 | 287 |
| 55 | iso_pu_bacteria | 2816332527 | 2818236973 | 287 |
| 56 | iso_pu_bacteria | 2824600985 | 2824608559 | 287 |
| 57 | iso_pu_bacteria | 2824609381 | 2824613723 | 287 |
| 58 | iso_pu_bacteria | 2824617872 | 2824625790 | 287 |
| 59 | iso_pu_bacteria | 2824626560 | 2824633808 | 287 |
| 60 | iso_pu_bacteria | 2824635225 | 2824642187 | 287 |
| 61 | iso_pu_bacteria | 2824644064 | 2824649591 | 287 |
| 62 | iso_pu_bacteria | 2824653114 | 2824660277 | 287 |
| 63 | iso_pu_bacteria | 2824661429 | 2824670338 | 287 |
| 64 | iso_pu_bacteria | 2824671348 | 2824678118 | 287 |
| 65 | iso_pu_bacteria | 2824679649 | 2824686636 | 287 |
| 66 | iso_pu_bacteria | 2824687955 | 2824694250 | 287 |
| 67 | iso_pu_bacteria | 2824696289 | 2824703080 | 287 |
| 68 | iso_pu_bacteria | 2824704595 | 2824711778 | 287 |
| 69 | iso_pu_bacteria | 2824714736 | 2824719550 | 287 |
| 70 | iso_pu_bacteria | 2824723954 | 2824729983 | 287 |
| 71 | iso_pu_bacteria | 2824732956 | 2824739099 | 287 |
| 72 | iso_pu_bacteria | 2824746037 | 2824751972 | 287 |
| 73 | iso_pu_bacteria | 2824753945 | 2824763103 | 287 |
| 74 | iso_pu_bacteria | 2824763712 | 2824772897 | 287 |
| 75 | iso_pu_bacteria | 2824773399 | 2824779679 | 287 |
| 76 | iso_pu_bacteria | 2838122688 | 2838127125 | 287 |
| 77 | iso_pu_bacteria | 2841941048 | 2841947362 | 287 |
| 78 | iso_pu_bacteria | 2841949485 | 2841955849 | 287 |
| 79 | iso_pu_bacteria | 2841957949 | 2841961704 | 287 |
| 80 | iso_pu_bacteria | 2841966195 | 2841974318 | 287 |
| 81 | iso_pu_bacteria | 2841974524 | 2841981022 | 287 |
| 82 | iso_pu_bacteria | 2841983080 | 2841987225 | 287 |
| 83 | iso_pu_bacteria | 2842038055 | 2842041145 | 287 |
| 84 | iso_pu_bacteria | 2842045827 | 2842045910 | 287 |
| 85 | iso_pu_bacteria | 2844315083 | 2844320393 | 287 |
| 86 | iso_pu_bacteria | 2847930680 | 2847937928 | 287 |
| 87 | iso_pu_bacteria | 2847939898 | 2847948162 | 287 |
| 88 | iso_pu_bacteria | 2849076700 | 2849077930 | 287 |
| 89 | iso_pu_bacteria | 2857509624 | 2857511124 | 287 |
| 90 | iso_pu_bacteria | 2874590934 | 2874595982 | 287 |
| 91 | iso_pu_bacteria | 2874612657 | 2874618502 | 287 |
| 92 | iso_pu_bacteria | 2874620515 | 2874625738 | 287 |
| 93 | iso_pu_bacteria | 2874628541 | 2874632922 | 287 |
| 94 | iso_pu_bacteria | 2874645413 | 2874650806 | 287 |
| 95 | iso_pu_bacteria | 2876761206 | 2876768677 | 287 |
| 96 | iso_pu_bacteria | 2876771140 | 2876776190 | 287 |
| 97 | iso_pu_bacteria | 2876818435 | 2876822150 | 287 |
| 98 | iso_pu_bacteria | 2879074833 | 2879080279 | 287 |
| 99 | iso_pu_bacteria | 2879083081 | 2879084209 | 287 |
| 100 | iso_pu_bacteria | 2879099564 | 2879105410 | 287 |
| 101 | iso_pu_bacteria | 2879127579 | 2879129123 | 287 |
| 102 | iso_pu_bacteria | 2879142872 | 2879143753 | 287 |
| 103 | iso_pu_bacteria | 2881364244 | 2881370346 | 287 |
| 104 | iso_pu_bacteria | 2881665667 | 2881673596 | 287 |
| 105 | iso_pu_bacteria | 2885366525 | 2885368354 | 287 |
| 106 | iso_pu_bacteria | 2885409591 | 2885409952 | 287 |
| 107 | iso_pu_bacteria | 2888378607 | 2888385898 | 287 |
| 108 | iso_pu_bacteria | 2888419890 | 2888426004 | 287 |
| 109 | iso_pu_bacteria | 2903727486 | 2903732946 | 287 |
| 110 | iso_pu_bacteria | 2904666416 | 2904673901 | 287 |
| 111 | iso_pu_bacteria | 2904699407 | 2904705994 | 287 |
| 112 | iso_pu_bacteria | 2904711408 | 2904711493 | 287 |
| 113 | iso_pu_bacteria | 2906602504 | 2906607278 | 287 |
| 114 | iso_pu_bacteria | 2906626472 | 2906630217 | 287 |
| 115 | iso_pu_bacteria | 2906643746 | 2906651277 | 287 |
| 116 | iso_pu_bacteria | 2908775508 | 2908781571 | 287 |
| 117 | iso_pu_bacteria | 2922368715 | 2922376206 | 287 |
| 118 | iso_pu_bacteria | 2922393267 | 2922393590 | 287 |
| 119 | iso_pu_bacteria | 2929615660 | 2929622984 | 287 |
| 120 | iso_pu_bacteria | 2929624759 | 2929631579 | 287 |
| 121 | iso_pu_bacteria | 2932784394 | 2932789369 | 287 |
| 122 | iso_pu_bacteria | 2932794094 | 2932797711 | 287 |
| 123 | iso_pu_bacteria | 2932801729 | 2932804229 | 287 |
| 124 | iso_pu_bacteria | 2932809354 | 2932816415 | 287 |
| 125 | iso_pu_bacteria | 2932818245 | 2932821998 | 287 |
| 126 | iso_pu_bacteria | 2932828146 | 2932831976 | 287 |
| 127 | iso_pu_bacteria | 2933577622 | 2933584812 | 287 |
| 128 | iso_pu_bacteria | 2935608549 | 2935610341 | 287 |
| 129 | iso_pu_bacteria | 2935616580 | 2935621915 | 287 |
| 130 | iso_pu_bacteria | 2935638405 | 2935644076 | 287 |
| 131 | iso_pu_bacteria | 2935648319 | 2935651315 | 287 |
| 132 | iso_pu_bacteria | 2935656913 | 2935659495 | 287 |
| 133 | iso_pu_bacteria | 2935665750 | 2935669010 | 287 |
| 134 | iso_pu_bacteria | 2935675223 | 2935683684 | 287 |
| 135 | iso_pu_bacteria | 2935684952 | 2935692376 | 287 |
| 136 | iso_pu_bacteria | 2935694250 | 2935700456 | 287 |
| 137 | iso_pu_bacteria | 2935703347 | 2935708916 | 287 |
| 138 | iso_pu_bacteria | 2935713505 | 2935720386 | 287 |
| 139 | iso_pu_bacteria | 2935722832 | 2935729667 | 287 |
| 140 | iso_pu_bacteria | 2935732158 | 2935739351 | 287 |
| 141 | iso_pu_bacteria | 2935741537 | 2935748108 | 287 |
| 142 | iso_pu_bacteria | 2935750917 | 2935758311 | 287 |
| 143 | iso_pu_bacteria | 2935760218 | 2935767390 | 287 |
| 144 | iso_pu_bacteria | 2935769743 | 2935771124 | 287 |
| 145 | iso_pu_bacteria | 2935777560 | 2935781293 | 287 |
| 146 | iso_pu_bacteria | 2935785616 | 2935786175 | 287 |
| 147 | iso_pu_bacteria | 2935793552 | 2935794028 | 287 |
| 148 | iso_pu_bacteria | 2935801545 | 2935805726 | 287 |
| 149 | iso_pu_bacteria | 2935810662 | 2935815718 | 287 |
| 150 | iso_pu_bacteria | 2935819856 | 2935823502 | 287 |
| 151 | iso_pu_bacteria | 2935827899 | 2935833327 | 287 |
| 152 | iso_pu_bacteria | 2935837841 | 2935842030 | 287 |
| 153 | iso_pu_bacteria | 2935847175 | 2935849027 | 287 |
| 154 | iso_pu_bacteria | 2935855204 | 2935860162 | 287 |
| 155 | iso_pu_bacteria | 2935864058 | 2935867558 | 287 |
| 156 | iso_pu_bacteria | 2935873716 | 2935878631 | 287 |
| 157 | iso_pu_bacteria | 2935883170 | 2935890414 | 287 |
| 158 | iso_pu_bacteria | 2935908558 | 2935912883 | 287 |
| 159 | iso_pu_bacteria | 2935916978 | 2935922798 | 287 |
| 160 | iso_pu_bacteria | 2935926038 | 2935930223 | 287 |
| 161 | iso_pu_bacteria | 2935934488 | 2935939124 | 287 |
| 162 | iso_pu_bacteria | 2935942939 | 2935946071 | 287 |
| 163 | iso_pu_bacteria | 2935951376 | 2935955408 | 287 |
| 164 | iso_pu_bacteria | 2935959822 | 2935965237 | 287 |
| 165 | iso_pu_bacteria | 2935967501 | 2935972221 | 287 |
| 166 | iso_pu_bacteria | 2935975950 | 2935976148 | 287 |
| 167 | iso_pu_bacteria | 2935984226 | 2935986355 | 287 |
| 168 | iso_pu_bacteria | 2935992306 | 2935998091 | 287 |
| 169 | iso_pu_bacteria | 2936002035 | 2936006792 | 287 |
| 170 | iso_pu_bacteria | 2936011229 | 2936013910 | 287 |
| 171 | iso_pu_bacteria | 2936019824 | 2936022566 | 287 |
| 172 | iso_pu_bacteria | 2936028420 | 2936035515 | 287 |
| 173 | iso_pu_bacteria | 2936037263 | 2936040956 | 287 |
| 174 | iso_pu_bacteria | 2936046547 | 2936049016 | 287 |
| 175 | iso_pu_bacteria | 2936055302 | 2936060406 | 287 |
| 176 | iso_pu_bacteria | 2940556831 | 2940564215 | 287 |
| 177 | iso_pu_bacteria | 2941507105 | 2941508216 | 287 |
| 178 | iso_pu_bacteria | 2941515067 | 2941515278 | 287 |
| 179 | iso_pu_bacteria | 2941523033 | 2941524147 | 287 |
| 180 | iso_pu_bacteria | 2941531003 | 2941531584 | 287 |
| 181 | iso_pu_bacteria | 2941538514 | 2941546577 | 287 |
| 182 | iso_pu_bacteria | 3005474847 | 3005477502 | 287 |
| 183 | iso_pu_bacteria | 3005483717 | 3005486211 | 287 |
| 184 | iso_pu_bacteria | 3005506211 | 3005511635 | 287 |
| 185 | iso_pu_bacteria | 3005587118 | 3005588472 | 287 |
| 186 | iso_pu_bacteria | 3005594810 | 3005600772 | 287 |
| 187 | iso_pu_bacteria | 3005710791 | 3005716187 | 287 |
| 188 | iso_pu_bacteria | 3005718088 | 3005723562 | 287 |
| 189 | iso_pu_bacteria | 8006926726 | 8006927238 | 287 |
| 190 | iso_pu_bacteria | 8006933436 | 8006933727 | 287 |
| 191 | iso_pu_bacteria | 8006973647 | 8006983399 | 287 |
| 192 | iso_pu_bacteria | 8016511872 | 8016520200 | 287 |
| 193 | iso_pu_bacteria | 8016522445 | 8016528105 | 287 |
| 194 | iso_pu_bacteria | 8016539877 | 8016546474 | 287 |
| 195 | iso_pu_bacteria | 8016557553 | 8016564007 | 287 |
| 196 | iso_pu_bacteria | 8016566248 | 8016571558 | 287 |
| 197 | iso_pu_bacteria | 8016575299 | 8016575804 | 287 |
| 198 | iso_pu_bacteria | 8016583857 | 8016594877 | 287 |
| 199 | iso_pu_bacteria | 8016595262 | 8016601718 | 287 |
| 200 | iso_pu_bacteria | 8016622563 | 8016624805 | 287 |
| 201 | iso_pu_bacteria | 8016630954 | 8016638305 | 287 |
| 202 | iso_pu_bacteria | 8017057580 | 8017065361 | 287 |
| 203 | iso_pu_bacteria | 8019538911 | 8019546822 | 287 |
| 204 | iso_pu_bacteria | 8019565922 | 8019569764 | 287 |
| 205 | iso_pu_bacteria | 8019586578 | 8019592696 | 287 |
| 206 | iso_pu_bacteria | 8019597564 | 8019598756 | 287 |
| 207 | iso_pu_bacteria | 8019608314 | 8019609618 | 287 |
| 208 | iso_pu_bacteria | 8019619141 | 8019620216 | 287 |
| 209 | iso_pu_bacteria | 8019629233 | 8019632884 | 287 |
| 210 | iso_pu_bacteria | 8019638758 | 8019647042 | 287 |
| 211 | iso_pu_bacteria | 8019648815 | 8019655655 | 287 |
| 212 | iso_pu_bacteria | 8019659431 | 8019660745 | 287 |
| 213 | iso_pu_bacteria | 8019668869 | 8019670157 | 287 |
| 214 | iso_pu_bacteria | 8019687851 | 8019692101 | 287 |
| 215 | iso_pu_bacteria | 8055742211 | 8055744654 | 287 |
| 216 | iso_pu_bacteria | 8056681323 | 8056682244 | 287 |
| 217 | iso_pu_bacteria | 8056689827 | 8056695244 | 287 |
| 218 | iso_pu_bacteria | 8056967851 | 8056974662 | 287 |
| 219 | 3300005434 | Ga0070709_10004640 | Ga0070709_100046406 | 290 |
| 220 | 3300005436 | Ga0070713_100007442 | Ga0070713_1000074422 | 290 |
| 221 | 3300005437 | Ga0070710_10000534 | Ga0070710_1000053416 | 290 |
| 222 | 3300005439 | Ga0070711_100000548 | Ga0070711_1000005486 | 290 |
| 223 | 3300005530 | Ga0070679_100698797 | Ga0070679_1006987971 | 290 |
| 224 | 3300006163 | Ga0070715_10021767 | Ga0070715_100217673 | 290 |
| 225 | 3300006173 | Ga0070716_100043367 | Ga0070716_1000433672 | 290 |
| 226 | 3300006175 | Ga0070712_100060009 | Ga0070712_1000600093 | 290 |
| 227 | 3300025898 | Ga0207692_10000091 | Ga0207692_1000009116 | 290 |
| 228 | 3300025905 | Ga0207685_10012829 | Ga0207685_100128293 | 290 |
| 229 | 3300025906 | Ga0207699_10000782 | Ga0207699_1000078214 | 290 |
| 230 | 3300025915 | Ga0207693_10029076 | Ga0207693_100290763 | 290 |
| 231 | 3300025916 | Ga0207663_10047322 | Ga0207663_100473224 | 290 |
| 232 | 3300025928 | Ga0207700_10018197 | Ga0207700_100181976 | 290 |
| 233 | 3300025929 | Ga0207664_10023054 | Ga0207664_100230542 | 290 |
| 234 | 3300025939 | Ga0207665_10055097 | Ga0207665_100550972 | 290 |
| 235 | 3300031711 | Ga0265314_10036676 | Ga0265314_100366763 | 290 |
| 236 | 3300031712 | Ga0265342_10012254 | Ga0265342_100122544 | 290 |
| 237 | 3300031730 | Ga0307516_10112249 | Ga0307516_101122492 | 290 |
| 238 | 3300048921 | Ga0496118_0239225 | Ga0496118_0239225_145_1026 | 290 |
| 239 | 3300053111 | Ga0500572_001844 | Ga0500572_001844_2957_3850 | 290 |
| 240 | 3300053136 | Ga0500559_0000226 | Ga0500559_0000226_32209_33102 | 290 |
| 241 | 3300053163 | Ga0500639_022150 | Ga0500639_022150_1544_2437 | 290 |
| 242 | 3300053735 | Ga0500596_002085 | Ga0500596_002085_1591_2484 | 290 |
| 243 | 3300003215 | JGI25153J46596_10002451 | JGI25153J46596_100024516 | 291 |
| 244 | 3300003215 | JGI25153J46596_10003211 | JGI25153J46596_100032112 | 291 |
| 245 | 3300003215 | JGI25153J46596_10015442 | JGI25153J46596_100154422 | 291 |
| 246 | 3300003354 | JGI25160J50197_1000862 | JGI25160J50197_100086213 | 291 |
| 247 | 3300003354 | JGI25160J50197_1001471 | JGI25160J50197_10014718 | 291 |
| 248 | 3300003354 | JGI25160J50197_1021553 | JGI25160J50197_10215532 | 291 |
| 249 | 3300003762 | Ga0055542_1003091 | Ga0055542_10030916 | 291 |
| 250 | 3300005262 | Ga0065165_1002741 | Ga0065165_100274114 | 291 |
| 251 | 3300005327 | Ga0070658_10045549 | Ga0070658_100455492 | 291 |
| 252 | 3300005327 | Ga0070658_10055695 | Ga0070658_100556954 | 291 |
| 253 | 3300005329 | Ga0070683_100003848 | Ga0070683_1000038485 | 291 |
| 254 | 3300005329 | Ga0070683_100409872 | Ga0070683_1004098721 | 291 |
| 255 | 3300005331 | Ga0070670_100254612 | Ga0070670_1002546122 | 291 |
| 256 | 3300005331 | Ga0070670_100429363 | Ga0070670_1004293631 | 291 |
| 257 | 3300005334 | Ga0068869_100340874 | Ga0068869_1003408741 | 291 |
| 258 | 3300005335 | Ga0070666_10167695 | Ga0070666_101676952 | 291 |
| 259 | 3300005336 | Ga0070680_100012456 | Ga0070680_1000124564 | 291 |
| 260 | 3300005336 | Ga0070680_100042667 | Ga0070680_1000426674 | 291 |
| 261 | 3300005338 | Ga0068868_100125005 | Ga0068868_1001250053 | 291 |
| 262 | 3300005338 | Ga0068868_100145980 | Ga0068868_1001459802 | 291 |
| 263 | 3300005339 | Ga0070660_100023176 | Ga0070660_1000231762 | 291 |
| 264 | 3300005344 | Ga0070661_100220764 | Ga0070661_1002207642 | 291 |
| 265 | 3300005344 | Ga0070661_100316723 | Ga0070661_1003167232 | 291 |
| 266 | 3300005347 | Ga0070668_100075380 | Ga0070668_1000753802 | 291 |
| 267 | 3300005353 | Ga0070669_100164962 | Ga0070669_1001649622 | 291 |
| 268 | 3300005355 | Ga0070671_100023510 | Ga0070671_1000235105 | 291 |
| 269 | 3300005366 | Ga0070659_100329839 | Ga0070659_1003298391 | 291 |
| 270 | 3300005367 | Ga0070667_100043976 | Ga0070667_1000439763 | 291 |
| 271 | 3300005434 | Ga0070709_10002036 | Ga0070709_100020363 | 291 |
| 272 | 3300005435 | Ga0070714_100003949 | Ga0070714_1000039493 | 291 |
| 273 | 3300005435 | Ga0070714_100034569 | Ga0070714_1000345696 | 291 |
| 274 | 3300005436 | Ga0070713_100001936 | Ga0070713_1000019364 | 291 |
| 275 | 3300005436 | Ga0070713_100003099 | Ga0070713_1000030996 | 291 |
| 276 | 3300005437 | Ga0070710_10007272 | Ga0070710_100072723 | 291 |
| 277 | 3300005437 | Ga0070710_10203723 | Ga0070710_102037232 | 291 |
| 278 | 3300005439 | Ga0070711_100007787 | Ga0070711_1000077874 | 291 |
| 279 | 3300005439 | Ga0070711_100082260 | Ga0070711_1000822601 | 291 |
| 280 | 3300005445 | Ga0070708_100114000 | Ga0070708_1001140001 | 291 |
| 281 | 3300005455 | Ga0070663_100030869 | Ga0070663_1000308692 | 291 |
| 282 | 3300005455 | Ga0070663_100057216 | Ga0070663_1000572162 | 291 |
| 283 | 3300005457 | Ga0070662_100294473 | Ga0070662_1002944731 | 291 |
| 284 | 3300005458 | Ga0070681_10132380 | Ga0070681_101323802 | 291 |
| 285 | 3300005458 | Ga0070681_10213535 | Ga0070681_102135352 | 291 |
| 286 | 3300005471 | Ga0070698_100571769 | Ga0070698_1005717691 | 291 |
| 287 | 3300005535 | Ga0070684_100011240 | Ga0070684_10001124010 | 291 |
| 288 | 3300005535 | Ga0070684_100032160 | Ga0070684_1000321601 | 291 |
| 289 | 3300005535 | Ga0070684_100445957 | Ga0070684_1004459571 | 291 |
| 290 | 3300005536 | Ga0070697_100313080 | Ga0070697_1003130802 | 291 |
| 291 | 3300005539 | Ga0068853_100022837 | Ga0068853_1000228372 | 291 |
| 292 | 3300005563 | Ga0068855_100718676 | Ga0068855_1007186761 | 291 |
| 293 | 3300005577 | Ga0068857_100252100 | Ga0068857_1002521002 | 291 |
| 294 | 3300005577 | Ga0068857_100322583 | Ga0068857_1003225832 | 291 |
| 295 | 3300005577 | Ga0068857_100340443 | Ga0068857_1003404432 | 291 |
| 296 | 3300005614 | Ga0068856_100165928 | Ga0068856_1001659282 | 291 |
| 297 | 3300005614 | Ga0068856_100435945 | Ga0068856_1004359452 | 291 |
| 298 | 3300005616 | Ga0068852_100317659 | Ga0068852_1003176592 | 291 |
| 299 | 3300005618 | Ga0068864_100422286 | Ga0068864_1004222862 | 291 |
| 300 | 3300005718 | Ga0068866_10092932 | Ga0068866_100929322 | 291 |
| 301 | 3300005841 | Ga0068863_100137455 | Ga0068863_1001374552 | 291 |
| 302 | 3300005842 | Ga0068858_100078600 | Ga0068858_1000786002 | 291 |
| 303 | 3300005843 | Ga0068860_100283127 | Ga0068860_1002831272 | 291 |
| 304 | 3300005983 | Ga0081540_1013003 | Ga0081540_10130032 | 291 |
| 305 | 3300005983 | Ga0081540_1021486 | Ga0081540_10214862 | 291 |
| 306 | 3300006028 | Ga0070717_10001632 | Ga0070717_100016328 | 291 |
| 307 | 3300006028 | Ga0070717_10002923 | Ga0070717_1000292313 | 291 |
| 308 | 3300006028 | Ga0070717_10051927 | Ga0070717_100519275 | 291 |
| 309 | 3300006028 | Ga0070717_10106505 | Ga0070717_101065052 | 291 |
| 310 | 3300006038 | Ga0075365_10008203 | Ga0075365_100082033 | 291 |
| 311 | 3300006038 | Ga0075365_10013543 | Ga0075365_100135432 | 291 |
| 312 | 3300006038 | Ga0075365_10049118 | Ga0075365_100491183 | 291 |
| 313 | 3300006048 | Ga0075363_100007746 | Ga0075363_1000077461 | 291 |
| 314 | 3300006051 | Ga0075364_10032847 | Ga0075364_100328472 | 291 |
| 315 | 3300006173 | Ga0070716_100020294 | Ga0070716_1000202942 | 291 |
| 316 | 3300006173 | Ga0070716_100066125 | Ga0070716_1000661252 | 291 |
| 317 | 3300006175 | Ga0070712_100025875 | Ga0070712_1000258755 | 291 |
| 318 | 3300006175 | Ga0070712_100206403 | Ga0070712_1002064032 | 291 |
| 319 | 3300006178 | Ga0075367_10058773 | Ga0075367_100587732 | 291 |
| 320 | 3300006195 | Ga0075366_10006253 | Ga0075366_100062532 | 291 |
| 321 | 3300006353 | Ga0075370_10099953 | Ga0075370_100999532 | 291 |
| 322 | 3300006941 | Ga0099825_1019063 | Ga0099825_10190632 | 291 |
| 323 | 3300006942 | Ga0099824_1029034 | Ga0099824_10290344 | 291 |
| 324 | 3300006944 | Ga0099823_1076012 | Ga0099823_10760122 | 291 |
| 325 | 3300007788 | Ga0099795_10006504 | Ga0099795_100065042 | 291 |
| 326 | 3300007788 | Ga0099795_10028301 | Ga0099795_100283012 | 291 |
| 327 | 3300007788 | Ga0099795_10103511 | Ga0099795_101035111 | 291 |
| 328 | 3300009093 | Ga0105240_10007546 | Ga0105240_1000754617 | 291 |
| 329 | 3300009093 | Ga0105240_10033152 | Ga0105240_100331527 | 291 |
| 330 | 3300009093 | Ga0105240_10182042 | Ga0105240_101820423 | 291 |
| 331 | 3300009093 | Ga0105240_10212180 | Ga0105240_102121803 | 291 |
| 332 | 3300009098 | Ga0105245_10083863 | Ga0105245_100838632 | 291 |
| 333 | 3300009098 | Ga0105245_10352837 | Ga0105245_103528372 | 291 |
| 334 | 3300009174 | Ga0105241_10138421 | Ga0105241_101384213 | 291 |
| 335 | 3300009174 | Ga0105241_10334209 | Ga0105241_103342092 | 291 |
| 336 | 3300009545 | Ga0105237_10002635 | Ga0105237_1000263513 | 291 |
| 337 | 3300009545 | Ga0105237_10028914 | Ga0105237_100289142 | 291 |
| 338 | 3300009545 | Ga0105237_10166769 | Ga0105237_101667692 | 291 |
| 339 | 3300009545 | Ga0105237_10293677 | Ga0105237_102936771 | 291 |
| 340 | 3300009551 | Ga0105238_10003869 | Ga0105238_100038696 | 291 |
| 341 | 3300010159 | Ga0099796_10027409 | Ga0099796_100274092 | 291 |
| 342 | 3300010375 | Ga0105239_10018844 | Ga0105239_100188442 | 291 |
| 343 | 3300010375 | Ga0105239_10082874 | Ga0105239_100828745 | 291 |
| 344 | 3300010375 | Ga0105239_10208891 | Ga0105239_102088913 | 291 |
| 345 | 3300011119 | Ga0105246_10081307 | Ga0105246_100813072 | 291 |
| 346 | 3300013104 | Ga0157370_10040261 | Ga0157370_100402614 | 291 |
| 347 | 3300013105 | Ga0157369_10000685 | Ga0157369_100006856 | 291 |
| 348 | 3300013105 | Ga0157369_10007917 | Ga0157369_1000791711 | 291 |
| 349 | 3300013105 | Ga0157369_10836450 | Ga0157369_108364501 | 291 |
| 350 | 3300013308 | Ga0157375_10251135 | Ga0157375_102511352 | 291 |
| 351 | 3300014325 | Ga0163163_10260403 | Ga0163163_102604032 | 291 |
| 352 | 3300014968 | Ga0157379_10247644 | Ga0157379_102476441 | 291 |
| 353 | 3300020069 | Ga0197907_11507651 | Ga0197907_115076511 | 291 |
| 354 | 3300020080 | Ga0206350_11404750 | Ga0206350_114047503 | 291 |
| 355 | 3300020082 | Ga0206353_11430012 | Ga0206353_114300121 | 291 |
| 356 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001357 | 291 |
| 357 | 3300021320 | Ga0214544_1025712 | Ga0214544_10257122 | 291 |
| 358 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005357 | 291 |
| 359 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003407 | 291 |
| 360 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002360 | 291 |
| 361 | 3300021361 | Ga0213872_10030128 | Ga0213872_100301281 | 291 |
| 362 | 3300021384 | Ga0213876_10064728 | Ga0213876_100647281 | 291 |
| 363 | 3300025254 | Ga0209148_1000654 | Ga0209148_100065422 | 291 |
| 364 | 3300025261 | Ga0209233_1009814 | Ga0209233_10098142 | 291 |
| 365 | 3300025272 | Ga0209455_1008424 | Ga0209455_10084243 | 291 |
| 366 | 3300025295 | Ga0209564_1009980 | Ga0209564_10099804 | 291 |
| 367 | 3300025297 | Ga0209758_1000320 | Ga0209758_100032080 | 291 |
| 368 | 3300025297 | Ga0209758_1001495 | Ga0209758_10014955 | 291 |
| 369 | 3300025302 | Ga0207426_1000746 | Ga0207426_100074614 | 291 |
| 370 | 3300025302 | Ga0207426_1001214 | Ga0207426_100121423 | 291 |
| 371 | 3300025302 | Ga0207426_1004351 | Ga0207426_10043516 | 291 |
| 372 | 3300025302 | Ga0207426_1028304 | Ga0207426_10283042 | 291 |
| 373 | 3300025304 | Ga0209257_1012298 | Ga0209257_10122982 | 291 |
| 374 | 3300025898 | Ga0207692_10001475 | Ga0207692_100014758 | 291 |
| 375 | 3300025898 | Ga0207692_10111587 | Ga0207692_101115872 | 291 |
| 376 | 3300025900 | Ga0207710_10094440 | Ga0207710_100944402 | 291 |
| 377 | 3300025905 | Ga0207685_10125208 | Ga0207685_101252081 | 291 |
| 378 | 3300025906 | Ga0207699_10185077 | Ga0207699_101850772 | 291 |
| 379 | 3300025909 | Ga0207705_10032876 | Ga0207705_100328765 | 291 |
| 380 | 3300025909 | Ga0207705_10146047 | Ga0207705_101460472 | 291 |
| 381 | 3300025911 | Ga0207654_10010107 | Ga0207654_100101072 | 291 |
| 382 | 3300025911 | Ga0207654_10078650 | Ga0207654_100786502 | 291 |
| 383 | 3300025911 | Ga0207654_10106473 | Ga0207654_101064732 | 291 |
| 384 | 3300025912 | Ga0207707_10001881 | Ga0207707_1000188114 | 291 |
| 385 | 3300025912 | Ga0207707_10094903 | Ga0207707_100949032 | 291 |
| 386 | 3300025913 | Ga0207695_10000503 | Ga0207695_1000050320 | 291 |
| 387 | 3300025913 | Ga0207695_10320320 | Ga0207695_103203202 | 291 |
| 388 | 3300025913 | Ga0207695_10512624 | Ga0207695_105126242 | 291 |
| 389 | 3300025914 | Ga0207671_10001399 | Ga0207671_100013996 | 291 |
| 390 | 3300025914 | Ga0207671_10040110 | Ga0207671_100401102 | 291 |
| 391 | 3300025914 | Ga0207671_10199188 | Ga0207671_101991882 | 291 |
| 392 | 3300025914 | Ga0207671_10296628 | Ga0207671_102966282 | 291 |
| 393 | 3300025915 | Ga0207693_10000479 | Ga0207693_1000047924 | 291 |
| 394 | 3300025915 | Ga0207693_10111691 | Ga0207693_101116913 | 291 |
| 395 | 3300025915 | Ga0207693_10336961 | Ga0207693_103369611 | 291 |
| 396 | 3300025916 | Ga0207663_10023702 | Ga0207663_100237022 | 291 |
| 397 | 3300025916 | Ga0207663_10051544 | Ga0207663_100515443 | 291 |
| 398 | 3300025917 | Ga0207660_10005375 | Ga0207660_100053757 | 291 |
| 399 | 3300025919 | Ga0207657_10005742 | Ga0207657_100057422 | 291 |
| 400 | 3300025919 | Ga0207657_10097086 | Ga0207657_100970863 | 291 |
| 401 | 3300025920 | Ga0207649_10242530 | Ga0207649_102425302 | 291 |
| 402 | 3300025921 | Ga0207652_10001649 | Ga0207652_1000164915 | 291 |
| 403 | 3300025923 | Ga0207681_10098872 | Ga0207681_100988722 | 291 |
| 404 | 3300025924 | Ga0207694_10041393 | Ga0207694_100413934 | 291 |
| 405 | 3300025927 | Ga0207687_10095563 | Ga0207687_100955633 | 291 |
| 406 | 3300025927 | Ga0207687_10188571 | Ga0207687_101885712 | 291 |
| 407 | 3300025928 | Ga0207700_10001432 | Ga0207700_100014324 | 291 |
| 408 | 3300025928 | Ga0207700_10083703 | Ga0207700_100837031 | 291 |
| 409 | 3300025928 | Ga0207700_10163042 | Ga0207700_101630423 | 291 |
| 410 | 3300025929 | Ga0207664_10320258 | Ga0207664_103202582 | 291 |
| 411 | 3300025929 | Ga0207664_10397233 | Ga0207664_103972332 | 291 |
| 412 | 3300025931 | Ga0207644_10020693 | Ga0207644_100206932 | 291 |
| 413 | 3300025931 | Ga0207644_10314371 | Ga0207644_103143712 | 291 |
| 414 | 3300025932 | Ga0207690_10138022 | Ga0207690_101380221 | 291 |
| 415 | 3300025933 | Ga0207706_10111396 | Ga0207706_101113963 | 291 |
| 416 | 3300025939 | Ga0207665_10000090 | Ga0207665_1000009013 | 291 |
| 417 | 3300025939 | Ga0207665_10038595 | Ga0207665_100385954 | 291 |
| 418 | 3300025939 | Ga0207665_10240190 | Ga0207665_102401902 | 291 |
| 419 | 3300025940 | Ga0207691_10377591 | Ga0207691_103775912 | 291 |
| 420 | 3300025941 | Ga0207711_10121596 | Ga0207711_101215963 | 291 |
| 421 | 3300025944 | Ga0207661_10010365 | Ga0207661_1001036511 | 291 |
| 422 | 3300025944 | Ga0207661_10121205 | Ga0207661_101212052 | 291 |
| 423 | 3300025949 | Ga0207667_10037563 | Ga0207667_100375635 | 291 |
| 424 | 3300025949 | Ga0207667_10373362 | Ga0207667_103733622 | 291 |
| 425 | 3300025972 | Ga0207668_10535684 | Ga0207668_105356841 | 291 |
| 426 | 3300025981 | Ga0207640_10059884 | Ga0207640_100598842 | 291 |
| 427 | 3300025981 | Ga0207640_10369449 | Ga0207640_103694492 | 291 |
| 428 | 3300025986 | Ga0207658_10236281 | Ga0207658_102362812 | 291 |
| 429 | 3300026041 | Ga0207639_10021282 | Ga0207639_100212825 | 291 |
| 430 | 3300026078 | Ga0207702_10040866 | Ga0207702_100408665 | 291 |
| 431 | 3300026095 | Ga0207676_10269952 | Ga0207676_102699521 | 291 |
| 432 | 3300026116 | Ga0207674_10023609 | Ga0207674_100236094 | 291 |
| 433 | 3300026121 | Ga0207683_10271120 | Ga0207683_102711202 | 291 |
| 434 | 3300026142 | Ga0207698_10005624 | Ga0207698_100056241 | 291 |
| 435 | 3300026142 | Ga0207698_10628552 | Ga0207698_106285521 | 291 |
| 436 | 3300027296 | Ga0209389_1000009 | Ga0209389_1000009142 | 291 |
| 437 | 3300027296 | Ga0209389_1000212 | Ga0209389_100021234 | 291 |
| 438 | 3300027357 | Ga0209589_1001280 | Ga0209589_10012806 | 291 |
| 439 | 3300027361 | Ga0209489_100085 | Ga0209489_1000857 | 291 |
| 440 | 3300027361 | Ga0209489_100671 | Ga0209489_10067112 | 291 |
| 441 | 3300027363 | Ga0209700_100016 | Ga0209700_10001692 | 291 |
| 442 | 3300027671 | Ga0209588_1014517 | Ga0209588_10145174 | 291 |
| 443 | 3300028380 | Ga0268265_10149498 | Ga0268265_101494982 | 291 |
| 444 | 3300028380 | Ga0268265_10206812 | Ga0268265_102068122 | 291 |
| 445 | 3300028794 | Ga0307515_10035411 | Ga0307515_1003541112 | 291 |
| 446 | 3300031247 | Ga0265340_10047459 | Ga0265340_100474592 | 291 |
| 447 | 3300031249 | Ga0265339_10003778 | Ga0265339_100037784 | 291 |
| 448 | 3300031344 | Ga0265316_10106910 | Ga0265316_101069102 | 291 |
| 449 | 3300031616 | Ga0307508_10179931 | Ga0307508_101799312 | 291 |
| 450 | 3300031730 | Ga0307516_10152063 | Ga0307516_101520632 | 291 |
| 451 | 3300031824 | Ga0307413_10044248 | Ga0307413_100442482 | 291 |
| 452 | 3300031995 | Ga0307409_100654843 | Ga0307409_1006548431 | 291 |
| 453 | 3300032005 | Ga0307411_10118895 | Ga0307411_101188952 | 291 |
| 454 | 3300032126 | Ga0307415_100298519 | Ga0307415_1002985192 | 291 |
| 455 | 3300033180 | Ga0307510_10018893 | Ga0307510_100188933 | 291 |
| 456 | 3300033180 | Ga0307510_10133497 | Ga0307510_101334972 | 291 |
| 457 | 3300033442 | Ga0315911_1000010 | Ga0315911_100001064 | 291 |
| 458 | 3300035111 | Ga0373923_0031097 | Ga0373923_0031097_908_1804 | 291 |
| 459 | 3300035112 | Ga0373932_0035778 | Ga0373932_0035778_295_1176 | 291 |
| 460 | 3300035113 | Ga0373936_0011362 | Ga0373936_0011362_887_1783 | 291 |
| 461 | 3300035170 | Ga0373943_0009282 | Ga0373943_0009282_3248_4144 | 291 |
| 462 | 3300035170 | Ga0373943_0016263 | Ga0373943_0016263_1273_2154 | 291 |
| 463 | 3300035171 | Ga0373946_0007518 | Ga0373946_0007518_1397_2293 | 291 |
| 464 | 3300035172 | Ga0373955_0004218 | Ga0373955_0004218_3914_4810 | 291 |
| 465 | 3300035691 | Ga0373931_0052031 | Ga0373931_0052031_124_1005 | 291 |
| 466 | 3300035692 | Ga0373935_0001222 | Ga0373935_0001222_5521_6417 | 291 |
| 467 | 3300035692 | Ga0373935_0097514 | Ga0373935_0097514_666_1547 | 291 |
| 468 | 3300035695 | Ga0373927_0001984 | Ga0373927_0001984_4745_5626 | 291 |
| 469 | 3300035695 | Ga0373927_0002079 | Ga0373927_0002079_7716_8612 | 291 |
| 470 | 3300035695 | Ga0373927_0027195 | Ga0373927_0027195_998_1879 | 291 |
| 471 | 3300035695 | Ga0373927_0046825 | Ga0373927_0046825_1537_2418 | 291 |
| 472 | 3300035695 | Ga0373927_0054260 | Ga0373927_0054260_1594_2475 | 291 |
| 473 | 3300035724 | Ga0373933_0000038 | Ga0373933_0000038_71863_72744 | 291 |
| 474 | 3300035724 | Ga0373933_0105662 | Ga0373933_0105662_158_1054 | 291 |
| 475 | 3300035725 | Ga0373947_0009808 | Ga0373947_0009808_3116_4012 | 291 |
| 476 | 3300035725 | Ga0373947_0040566 | Ga0373947_0040566_1060_1941 | 291 |
| 477 | 3300036401 | Ga0373937_0005511 | Ga0373937_0005511_6834_7730 | 291 |
| 478 | 3300036401 | Ga0373937_0016644 | Ga0373937_0016644_2165_3061 | 291 |
| 479 | 3300037068 | Ga0373925_0002028 | Ga0373925_0002028_13296_14192 | 291 |
| 480 | 3300037068 | Ga0373925_0020481 | Ga0373925_0020481_3107_3988 | 291 |
| 481 | 3300037068 | Ga0373925_0049703 | Ga0373925_0049703_2096_2977 | 291 |
| 482 | 3300037312 | Ga0395899_0043622 | Ga0395899_0043622_2035_2916 | 291 |
| 483 | 3300037418 | Ga0395900_0000134 | Ga0395900_0000134_8283_9161 | 291 |
| 484 | 3300037418 | Ga0395900_0022534 | Ga0395900_0022534_120_1001 | 291 |
| 485 | 3300037418 | Ga0395900_0399569 | Ga0395900_0399569_153_1034 | 291 |
| 486 | 3300037466 | Ga0395898_0036137 | Ga0395898_0036137_876_1757 | 291 |
| 487 | 3300037466 | Ga0395898_0146261 | Ga0395898_0146261_775_1656 | 291 |
| 488 | 3300037466 | Ga0395898_0252984 | Ga0395898_0252984_588_1469 | 291 |
| 489 | 3300037471 | Ga0395905_0035844 | Ga0395905_0035844_881_1762 | 291 |
| 490 | 3300038443 | Ga0395901_0054972 | Ga0395901_0054972_687_1565 | 291 |
| 491 | 3300038443 | Ga0395901_0549710 | Ga0395901_0549710_192_1073 | 291 |
| 492 | 3300038443 | Ga0395901_0655079 | Ga0395901_0655079_45_920 | 291 |
| 493 | 3300039437 | Ga0436365_0458346 | Ga0436365_0458346_563_1444 | 291 |
| 494 | 3300039437 | Ga0436365_1058288 | Ga0436365_1058288_240_1154 | 291 |
| 495 | 3300041451 | Ga0451791_0429136 | Ga0451791_0429136_331_1212 | 291 |
| 496 | 3300041453 | Ga0451797_0952982 | Ga0451797_0952982_440_1321 | 291 |
| 497 | 3300044656 | Ga0466969_0038849 | Ga0466969_0038849_490_1371 | 291 |
| 498 | 3300044656 | Ga0466969_0039662 | Ga0466969_0039662_812_1741 | 291 |
| 499 | 3300044658 | Ga0466972_0000363 | Ga0466972_0000363_14565_15446 | 291 |
| 500 | 3300044684 | Ga0466966_0002193 | Ga0466966_0002193_3618_4499 | 291 |
| 501 | 3300044693 | Ga0466961_0000090 | Ga0466961_0000090_35848_36729 | 291 |
| 502 | 3300044694 | Ga0466963_0065260 | Ga0466963_0065260_262_1191 | 291 |
| 503 | 3300044706 | Ga0466964_0163970 | Ga0466964_0163970_50_931 | 291 |
| 504 | 3300044765 | Ga0466970_0151726 | Ga0466970_0151726_104_985 | 291 |
| 505 | 3300044842 | Ga0466957_0183879 | Ga0466957_0183879_154_1035 | 291 |
| 506 | 3300044901 | Ga0466960_0152502 | Ga0466960_0152502_49_924 | 291 |
| 507 | 3300045049 | Ga0466959_0010358 | Ga0466959_0010358_820_1701 | 291 |
| 508 | 3300045836 | Ga0466958_0184661 | Ga0466958_0184661_276_1157 | 291 |
| 509 | 3300045976 | Ga0466967_0150799 | Ga0466967_0150799_952_1827 | 291 |
| 510 | 3300045976 | Ga0466967_0356655 | Ga0466967_0356655_131_1012 | 291 |
| 511 | 3300046454 | Ga0495592_0077905 | Ga0495592_0077905_1276_2172 | 291 |
| 512 | 3300046454 | Ga0495592_0102177 | Ga0495592_0102177_743_1624 | 291 |
| 513 | 3300046455 | Ga0495603_0001123 | Ga0495603_0001123_14303_15199 | 291 |
| 514 | 3300046455 | Ga0495603_0001668 | Ga0495603_0001668_9676_10557 | 291 |
| 515 | 3300046459 | Ga0495629_0000316 | Ga0495629_0000316_10385_11281 | 291 |
| 516 | 3300046459 | Ga0495629_0000900 | Ga0495629_0000900_21520_22395 | 291 |
| 517 | 3300046460 | Ga0495638_0003425 | Ga0495638_0003425_10479_11354 | 291 |
| 518 | 3300046461 | Ga0495641_0003654 | Ga0495641_0003654_5594_6490 | 291 |
| 519 | 3300046462 | Ga0495651_0008870 | Ga0495651_0008870_4124_5020 | 291 |
| 520 | 3300046462 | Ga0495651_0021715 | Ga0495651_0021715_1453_2334 | 291 |
| 521 | 3300046462 | Ga0495651_0051135 | Ga0495651_0051135_1443_2318 | 291 |
| 522 | 3300046463 | Ga0495653_0022549 | Ga0495653_0022549_4135_5016 | 291 |
| 523 | 3300046463 | Ga0495653_0320618 | Ga0495653_0320618_19_894 | 291 |
| 524 | 3300046471 | Ga0495650_0116042 | Ga0495650_0116042_10_891 | 291 |
| 525 | 3300046472 | Ga0495580_0004684 | Ga0495580_0004684_5255_6151 | 291 |
| 526 | 3300046472 | Ga0495580_0068041 | Ga0495580_0068041_577_1458 | 291 |
| 527 | 3300046472 | Ga0495580_0329920 | Ga0495580_0329920_136_1017 | 291 |
| 528 | 3300046473 | Ga0495582_0000038 | Ga0495582_0000038_55091_55987 | 291 |
| 529 | 3300046474 | Ga0495605_0051914 | Ga0495605_0051914_791_1666 | 291 |
| 530 | 3300046475 | Ga0495639_0000050 | Ga0495639_0000050_9980_10876 | 291 |
| 531 | 3300046475 | Ga0495639_0121931 | Ga0495639_0121931_157_1032 | 291 |
| 532 | 3300046476 | Ga0495662_0001679 | Ga0495662_0001679_4113_5009 | 291 |
| 533 | 3300046477 | Ga0495664_0022812 | Ga0495664_0022812_34_930 | 291 |
| 534 | 3300046477 | Ga0495664_0072782 | Ga0495664_0072782_282_1163 | 291 |
| 535 | 3300046499 | Ga0495594_0000658 | Ga0495594_0000658_6606_7502 | 291 |
| 536 | 3300046499 | Ga0495594_0073885 | Ga0495594_0073885_396_1277 | 291 |
| 537 | 3300046499 | Ga0495594_0089452 | Ga0495594_0089452_170_1051 | 291 |
| 538 | 3300046507 | Ga0495606_0023497 | Ga0495606_0023497_2226_3101 | 291 |
| 539 | 3300046507 | Ga0495606_0035170 | Ga0495606_0035170_979_1860 | 291 |
| 540 | 3300046507 | Ga0495606_0194593 | Ga0495606_0194593_96_977 | 291 |
| 541 | 3300046511 | Ga0495608_0052028 | Ga0495608_0052028_790_1671 | 291 |
| 542 | 3300046513 | Ga0495616_0023053 | Ga0495616_0023053_1480_2361 | 291 |
| 543 | 3300046513 | Ga0495616_0064887 | Ga0495616_0064887_494_1369 | 291 |
| 544 | 3300046515 | Ga0495620_0100323 | Ga0495620_0100323_11_892 | 291 |
| 545 | 3300046516 | Ga0495628_0037210 | Ga0495628_0037210_2960_3856 | 291 |
| 546 | 3300046516 | Ga0495628_0040123 | Ga0495628_0040123_2562_3443 | 291 |
| 547 | 3300046517 | Ga0495630_0002603 | Ga0495630_0002603_1583_2479 | 291 |
| 548 | 3300046518 | Ga0495631_0120051 | Ga0495631_0120051_162_1043 | 291 |
| 549 | 3300046522 | Ga0495643_0005438 | Ga0495643_0005438_4196_5077 | 291 |
| 550 | 3300046524 | Ga0495648_0044876 | Ga0495648_0044876_775_1650 | 291 |
| 551 | 3300046526 | Ga0495666_0110841 | Ga0495666_0110841_131_1012 | 291 |
| 552 | 3300046526 | Ga0495666_0129561 | Ga0495666_0129561_233_1129 | 291 |
| 553 | 3300046529 | Ga0495652_0027943 | Ga0495652_0027943_1457_2338 | 291 |
| 554 | 3300046529 | Ga0495652_0151590 | Ga0495652_0151590_82_978 | 291 |
| 555 | 3300046531 | Ga0495665_0000732 | Ga0495665_0000732_10311_11207 | 291 |
| 556 | 3300046533 | Ga0495640_0004317 | Ga0495640_0004317_10083_10979 | 291 |
| 557 | 3300046533 | Ga0495640_0038743 | Ga0495640_0038743_490_1365 | 291 |
| 558 | 3300046536 | Ga0495587_0016459 | Ga0495587_0016459_2989_3870 | 291 |
| 559 | 3300046543 | Ga0495645_0020249 | Ga0495645_0020249_3035_3916 | 291 |
| 560 | 3300046557 | Ga0495622_0007054 | Ga0495622_0007054_1011_1907 | 291 |
| 561 | 3300046557 | Ga0495622_0030034 | Ga0495622_0030034_1416_2291 | 291 |
| 562 | 3300046559 | Ga0495667_0044118 | Ga0495667_0044118_626_1507 | 291 |
| 563 | 3300046559 | Ga0495667_0054691 | Ga0495667_0054691_1513_2409 | 291 |
| 564 | 3300046616 | Ga0495668_0020048 | Ga0495668_0020048_102_983 | 291 |
| 565 | 3300046642 | Ga0495634_0000931 | Ga0495634_0000931_8746_9642 | 291 |
| 566 | 3300046642 | Ga0495634_0235458 | Ga0495634_0235458_58_1029 | 291 |
| 567 | 3300046648 | Ga0495611_0041916 | Ga0495611_0041916_722_1597 | 291 |
| 568 | 3300046663 | Ga0495635_0000415 | Ga0495635_0000415_8776_9672 | 291 |
| 569 | 3300046663 | Ga0495635_0006765 | Ga0495635_0006765_5825_6700 | 291 |
| 570 | 3300046674 | Ga0495588_0028455 | Ga0495588_0028455_301_1182 | 291 |
| 571 | 3300046674 | Ga0495588_0031715 | Ga0495588_0031715_1262_2158 | 291 |
| 572 | 3300046675 | Ga0495657_0006673 | Ga0495657_0006673_1282_2163 | 291 |
| 573 | 3300046678 | Ga0495599_0050345 | Ga0495599_0050345_277_1158 | 291 |
| 574 | 3300046678 | Ga0495599_0059742 | Ga0495599_0059742_1228_2124 | 291 |
| 575 | 3300046679 | Ga0495623_0029798 | Ga0495623_0029798_1274_2155 | 291 |
| 576 | 3300046680 | Ga0495646_0005444 | Ga0495646_0005444_1557_2453 | 291 |
| 577 | 3300046680 | Ga0495646_0065851 | Ga0495646_0065851_635_1516 | 291 |
| 578 | 3300046680 | Ga0495646_0098079 | Ga0495646_0098079_561_1436 | 291 |
| 579 | 3300046681 | Ga0495647_0000195 | Ga0495647_0000195_5192_6088 | 291 |
| 580 | 3300046683 | Ga0495658_0000802 | Ga0495658_0000802_5758_6654 | 291 |
| 581 | 3300046683 | Ga0495658_0168872 | Ga0495658_0168872_213_1094 | 291 |
| 582 | 3300046689 | Ga0495613_0002073 | Ga0495613_0002073_4030_4926 | 291 |
| 583 | 3300046689 | Ga0495613_0036466 | Ga0495613_0036466_1710_2585 | 291 |
| 584 | 3300046689 | Ga0495613_0108789 | Ga0495613_0108789_792_1673 | 291 |
| 585 | 3300046689 | Ga0495613_0230663 | Ga0495613_0230663_311_1192 | 291 |
| 586 | 3300046690 | Ga0495624_0013276 | Ga0495624_0013276_520_1416 | 291 |
| 587 | 3300046809 | Ga0495600_0007520 | Ga0495600_0007520_107_988 | 291 |
| 588 | 3300046809 | Ga0495600_0048237 | Ga0495600_0048237_1855_2730 | 291 |
| 589 | 3300047315 | Ga0495581_0005552 | Ga0495581_0005552_6177_7073 | 291 |
| 590 | 3300047315 | Ga0495581_0025276 | Ga0495581_0025276_782_1657 | 291 |
| 591 | 3300047315 | Ga0495581_0091925 | Ga0495581_0091925_818_1699 | 291 |
| 592 | 3300047315 | Ga0495581_0137962 | Ga0495581_0137962_287_1168 | 291 |
| 593 | 3300047317 | Ga0495604_0006276 | Ga0495604_0006276_1489_2370 | 291 |
| 594 | 3300047317 | Ga0495604_0040819 | Ga0495604_0040819_527_1402 | 291 |
| 595 | 3300047319 | Ga0495674_0013016 | Ga0495674_0013016_6499_7380 | 291 |
| 596 | 3300047321 | Ga0495676_0178340 | Ga0495676_0178340_563_1444 | 291 |
| 597 | 3300047322 | Ga0495680_0007943 | Ga0495680_0007943_7978_8859 | 291 |
| 598 | 3300047323 | Ga0495683_0133210 | Ga0495683_0133210_275_1156 | 291 |
| 599 | 3300047443 | Ga0495687_020454 | Ga0495687_020454_1051_1932 | 291 |
| 600 | 3300047444 | Ga0495675_0003949 | Ga0495675_0003949_7304_8185 | 291 |
| 601 | 3300047469 | Ga0495673_0018019 | Ga0495673_0018019_729_1610 | 291 |
| 602 | 3300047471 | Ga0495684_0007203 | Ga0495684_0007203_4323_5219 | 291 |
| 603 | 3300047471 | Ga0495684_0053921 | Ga0495684_0053921_675_1556 | 291 |
| 604 | 3300047673 | Ga0495593_0000291 | Ga0495593_0000291_10266_11162 | 291 |
| 605 | 3300048088 | Ga0495602_0013244 | Ga0495602_0013244_6282_7163 | 291 |
| 606 | 3300048088 | Ga0495602_0089560 | Ga0495602_0089560_1051_1926 | 291 |
| 607 | 3300048088 | Ga0495602_0182140 | Ga0495602_0182140_606_1502 | 291 |
| 608 | 3300048088 | Ga0495602_0216323 | Ga0495602_0216323_497_1378 | 291 |
| 609 | 3300048903 | Ga0496100_0420916 | Ga0496100_0420916_34_915 | 291 |
| 610 | 3300048904 | Ga0496101_0016399 | Ga0496101_0016399_1912_2793 | 291 |
| 611 | 3300048904 | Ga0496101_0093709 | Ga0496101_0093709_1053_1928 | 291 |
| 612 | 3300048904 | Ga0496101_0201487 | Ga0496101_0201487_483_1364 | 291 |
| 613 | 3300048905 | Ga0496102_0364182 | Ga0496102_0364182_128_1009 | 291 |
| 614 | 3300048906 | Ga0496103_0007433 | Ga0496103_0007433_2140_3021 | 291 |
| 615 | 3300048907 | Ga0496104_0002707 | Ga0496104_0002707_12486_13361 | 291 |
| 616 | 3300048907 | Ga0496104_0033366 | Ga0496104_0033366_2330_3211 | 291 |
| 617 | 3300048907 | Ga0496104_0151185 | Ga0496104_0151185_268_1149 | 291 |
| 618 | 3300048908 | Ga0496105_0003571 | Ga0496105_0003571_9889_10764 | 291 |
| 619 | 3300048908 | Ga0496105_0055582 | Ga0496105_0055582_1810_2685 | 291 |
| 620 | 3300048908 | Ga0496105_0098375 | Ga0496105_0098375_451_1332 | 291 |
| 621 | 3300048910 | Ga0496107_0185189 | Ga0496107_0185189_481_1362 | 291 |
| 622 | 3300048910 | Ga0496107_0247923 | Ga0496107_0247923_38_919 | 291 |
| 623 | 3300048911 | Ga0496108_0034095 | Ga0496108_0034095_448_1329 | 291 |
| 624 | 3300048911 | Ga0496108_0159285 | Ga0496108_0159285_37_912 | 291 |
| 625 | 3300048912 | Ga0496109_0062374 | Ga0496109_0062374_1494_2375 | 291 |
| 626 | 3300048913 | Ga0496110_0138945 | Ga0496110_0138945_748_1629 | 291 |
| 627 | 3300048913 | Ga0496110_0595633 | Ga0496110_0595633_112_993 | 291 |
| 628 | 3300048915 | Ga0496112_0052736 | Ga0496112_0052736_1322_2203 | 291 |
| 629 | 3300048915 | Ga0496112_0203106 | Ga0496112_0203106_198_1079 | 291 |
| 630 | 3300048915 | Ga0496112_0205840 | Ga0496112_0205840_810_1691 | 291 |
| 631 | 3300048916 | Ga0496113_0295209 | Ga0496113_0295209_45_920 | 291 |
| 632 | 3300048917 | Ga0496114_0026045 | Ga0496114_0026045_3451_4326 | 291 |
| 633 | 3300048917 | Ga0496114_0219475 | Ga0496114_0219475_583_1464 | 291 |
| 634 | 3300048918 | Ga0496115_0014957 | Ga0496115_0014957_3177_4058 | 291 |
| 635 | 3300048918 | Ga0496115_0020501 | Ga0496115_0020501_1912_2793 | 291 |
| 636 | 3300048918 | Ga0496115_0063096 | Ga0496115_0063096_1237_2118 | 291 |
| 637 | 3300048918 | Ga0496115_0115536 | Ga0496115_0115536_32_967 | 291 |
| 638 | 3300048919 | Ga0496116_0043348 | Ga0496116_0043348_645_1520 | 291 |
| 639 | 3300048919 | Ga0496116_0086484 | Ga0496116_0086484_336_1217 | 291 |
| 640 | 3300048920 | Ga0496117_0053075 | Ga0496117_0053075_861_1736 | 291 |
| 641 | 3300048921 | Ga0496118_0094901 | Ga0496118_0094901_469_1350 | 291 |
| 642 | 3300048921 | Ga0496118_0123848 | Ga0496118_0123848_359_1234 | 291 |
| 643 | 3300048922 | Ga0496119_0053771 | Ga0496119_0053771_497_1378 | 291 |
| 644 | 3300048922 | Ga0496119_0068638 | Ga0496119_0068638_338_1213 | 291 |
| 645 | 3300048923 | Ga0496120_0023635 | Ga0496120_0023635_1679_2554 | 291 |
| 646 | 3300048923 | Ga0496120_0134452 | Ga0496120_0134452_235_1110 | 291 |
| 647 | 3300048923 | Ga0496120_0185687 | Ga0496120_0185687_121_1002 | 291 |
| 648 | 3300048924 | Ga0496121_0004381 | Ga0496121_0004381_12083_12958 | 291 |
| 649 | 3300048924 | Ga0496121_0093712 | Ga0496121_0093712_122_997 | 291 |
| 650 | 3300048924 | Ga0496121_0115231 | Ga0496121_0115231_129_1016 | 291 |
| 651 | 3300048924 | Ga0496121_0121330 | Ga0496121_0121330_690_1571 | 291 |
| 652 | 3300048924 | Ga0496121_0182565 | Ga0496121_0182565_363_1244 | 291 |
| 653 | 3300048924 | Ga0496121_0227800 | Ga0496121_0227800_119_994 | 291 |
| 654 | 3300048925 | Ga0496122_0031165 | Ga0496122_0031165_74_955 | 291 |
| 655 | 3300048925 | Ga0496122_0166606 | Ga0496122_0166606_350_1231 | 291 |
| 656 | 3300048927 | Ga0496124_0165758 | Ga0496124_0165758_91_972 | 291 |
| 657 | 3300048927 | Ga0496124_0169879 | Ga0496124_0169879_189_1064 | 291 |
| 658 | 3300048929 | Ga0496126_0011094 | Ga0496126_0011094_7775_8656 | 291 |
| 659 | 3300048929 | Ga0496126_0020402 | Ga0496126_0020402_4599_5480 | 291 |
| 660 | 3300048929 | Ga0496126_0041687 | Ga0496126_0041687_1807_2682 | 291 |
| 661 | 3300048929 | Ga0496126_0046829 | Ga0496126_0046829_1025_1906 | 291 |
| 662 | 3300048929 | Ga0496126_0141572 | Ga0496126_0141572_1044_1925 | 291 |
| 663 | 3300048929 | Ga0496126_0180251 | Ga0496126_0180251_388_1269 | 291 |
| 664 | 3300048929 | Ga0496126_0356276 | Ga0496126_0356276_237_1112 | 291 |
| 665 | 3300049460 | Ga0495682_0063244 | Ga0495682_0063244_276_1151 | 291 |
| 666 | 3300050491 | nmdc:mga00v17_28031_c1 | nmdc:mga00v17_28031_c1_1235_2116 | 291 |
| 667 | 3300050492 | nmdc:mga0yw44_12366_c1 | nmdc:mga0yw44_12366_c1_541_1422 | 291 |
| 668 | 3300050492 | nmdc:mga0yw44_9102_c1 | nmdc:mga0yw44_9102_c1_1610_2485 | 291 |
| 669 | 3300050494 | nmdc:mga06z11_18221_c1 | nmdc:mga06z11_18221_c1_1390_2271 | 291 |
| 670 | 3300050495 | nmdc:mga04h51_8605_c1 | nmdc:mga04h51_8605_c1_1662_2543 | 291 |
| 671 | 3300050496 | nmdc:mga07m45_12697_c1 | nmdc:mga07m45_12697_c1_2500_3375 | 291 |
| 672 | 3300050496 | nmdc:mga07m45_14394_c1 | nmdc:mga07m45_14394_c1_993_1874 | 291 |
| 673 | 3300050516 | nmdc:mga0sz30_48285_c1 | nmdc:mga0sz30_48285_c1_579_1454 | 291 |
| 674 | 3300050516 | nmdc:mga0sz30_91389_c1 | nmdc:mga0sz30_91389_c1_210_1091 | 291 |
| 675 | 3300053079 | Ga0500610_0086510 | Ga0500610_0086510_331_1206 | 291 |
| 676 | 3300053083 | Ga0495655_0064603 | Ga0495655_0064603_69_950 | 291 |
| 677 | 3300053085 | Ga0495619_0072419 | Ga0495619_0072419_1382_2263 | 291 |
| 678 | 3300053085 | Ga0495619_0128440 | Ga0495619_0128440_226_1101 | 291 |
| 679 | 3300053086 | Ga0500578_0252381 | Ga0500578_0252381_127_1002 | 291 |
| 680 | 3300053087 | Ga0500643_000047 | Ga0500643_000047_34105_34980 | 291 |
| 681 | 3300053094 | Ga0500566_0027227 | Ga0500566_0027227_824_1699 | 291 |
| 682 | 3300053103 | Ga0500555_007180 | Ga0500555_007180_1779_2654 | 291 |
| 683 | 3300053104 | Ga0500556_0004374 | Ga0500556_0004374_184_1059 | 291 |
| 684 | 3300053105 | Ga0500557_000078 | Ga0500557_000078_34108_34989 | 291 |
| 685 | 3300053119 | Ga0500595_002149 | Ga0500595_002149_4012_4893 | 291 |
| 686 | 3300053121 | Ga0500607_061424 | Ga0500607_061424_924_1799 | 291 |
| 687 | 3300053130 | Ga0500642_0005047 | Ga0500642_0005047_1631_2512 | 291 |
| 688 | 3300053130 | Ga0500642_0008914 | Ga0500642_0008914_1531_2406 | 291 |
| 689 | 3300053131 | Ga0500652_021783 | Ga0500652_021783_364_1239 | 291 |
| 690 | 3300053136 | Ga0500559_0015797 | Ga0500559_0015797_1127_2002 | 291 |
| 691 | 3300053177 | Ga0500636_0000024 | Ga0500636_0000024_28972_29853 | 291 |
| 692 | 3300053729 | Ga0500625_014244 | Ga0500625_014244_1277_2158 | 291 |
| 693 | 3300053731 | Ga0500609_002803 | Ga0500609_002803_967_1842 | 291 |
| 694 | 3300053733 | Ga0500552_002622 | Ga0500552_002622_228_1103 | 291 |
| 695 | 3300053737 | Ga0500601_000078 | Ga0500601_000078_12047_12922 | 291 |
| 696 | iso_pu_bacteria | 2513237104 | 2513719095 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z3h-assembly3.cif.gz_C | crystal structure of iba57 from chaetomium thermophilum | 0.8326 | 2 | 283 |
| 7z3h-assembly5.cif.gz_E | crystal structure of iba57 from chaetomium thermophilum | 0.8302 | 2 | 283 |
| 7z3h-assembly6.cif.gz_F | crystal structure of iba57 from chaetomium thermophilum | 0.8203 | 2 | 283 |
| 7z3h-assembly2.cif.gz_B | crystal structure of iba57 from chaetomium thermophilum | 0.8191 | 2 | 283 |
| 7z3h-assembly3.cif.gz_C | crystal structure of iba57 from chaetomium thermophilum | 0.8089 | 2 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vlyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9376 | 10 | 99 | 3.30.70.1400 |
| af_G5EE11_2_112_3.30.70.1400 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9236 | 1 | 103 | 3.30.70.1400 |
| 1vlyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9167 | 10 | 99 | 3.30.70.1400 |
| 3girA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9063 | 11 | 95 | 3.30.70.1400 |
| af_E9AH81_4_151_3.30.70.1400 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9005 | 3 | 111 | 3.30.70.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C9VHB0-F1-model_v4 | Folate-binding protein | 0.991 | 1 | 94 |
GO:0016226
|
| AF-X0XDU6-F1-model_v4 | Aminomethyltransferase folate-binding domain-containing protein | 0.983 | 1 | 110 |
GO:0016226
|
| AF-A0A7C9VHB0-F1-model_v4 | Folate-binding protein | 0.9806 | 1 | 94 |
GO:0016226
|
| AF-X0XDU6-F1-model_v4 | Aminomethyltransferase folate-binding domain-containing protein | 0.9572 | 1 | 110 |
GO:0016226
|
| AF-A0A164AMH0-F1-model_v4 | Folate-binding protein | 0.9534 | 1 | 283 |
GO:0016226
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar