F475844
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 696 | 473 | 568 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300032133|Ga0316583_10047508|Ga0316583_100475081 |
| Length | 197 |
| Sequence | MRQPRAWQRMLSGRRLDLLDPTPVDIEIEDIAHGLAFVARWNGQTRGDWPYSVAEHSLLVEEIFSRRPGAEPRWRLAALLHDAPEYVIGDMISPVKAAVGPGYGDLDARLSAAVHLRFGLPAVLPVAVKKAIKVADKASAWLEAVQIAGFSEAEANRLFGRPGDTVLRGLEIRLRPPAVVRADFLRRHHELLESLSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 3 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 6 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 7 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 8 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 9 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 10 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 11 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 12 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 13 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 14 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 15 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 16 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 17 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 18 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 19 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 20 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 21 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 22 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 23 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 24 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 25 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 26 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 27 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 28 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 29 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 30 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 31 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 32 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 33 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 34 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 35 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 36 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 37 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 38 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 39 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 40 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 41 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 42 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 43 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 44 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 45 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 46 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 47 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 48 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 49 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 50 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 51 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 52 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 53 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 54 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 55 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 56 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 57 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 58 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 59 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 60 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 61 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 62 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 63 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 64 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 65 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 66 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 67 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 68 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 69 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 70 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 71 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 72 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 73 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 74 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 75 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 76 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 77 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 78 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 79 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 80 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 81 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 82 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 83 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 84 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 85 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 86 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 87 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 88 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 89 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 90 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 91 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 92 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 93 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 94 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 95 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 96 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 97 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 98 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 99 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 100 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 101 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 102 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 103 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 104 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 105 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 106 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 107 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 108 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 109 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 110 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 111 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 112 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 113 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 114 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 115 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 130 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 131 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 132 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 134 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 139 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 140 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 144 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 145 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 146 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 151 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 152 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 154 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 155 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 156 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 157 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 159 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 160 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 161 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 162 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 163 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 164 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 165 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 166 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 167 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 168 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 189 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 190 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 191 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 192 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 193 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 194 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 195 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 196 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 259 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 260 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 274 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 284 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 285 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 286 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 370 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 371 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 372 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 373 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 374 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 375 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 376 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 377 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 378 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 379 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 380 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 405 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 418 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 423 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 424 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 430 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 432 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 435 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 438 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 439 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 440 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 441 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 442 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 444 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 445 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 446 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 448 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 449 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 450 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 452 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 453 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 455 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 456 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 457 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 458 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 459 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 460 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 461 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 462 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 463 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 464 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 465 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 466 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 467 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 468 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 469 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 470 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 471 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 472 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 473 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.58 |
| Metatranscriptomes | 0.14 |
| Isolates | 18.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.36 |
| Nodule | 12.36 |
| Rhizoplane | 5.75 |
| Rhizosphere | 55.6 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 12.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1005214 | 3300003214 | Bacteria | 2561 |
| 2 | JGI25153J46596_10002451 | 3300003215 | Bacteria | 10699 |
| 3 | JGI25153J46596_10019495 | 3300003215 | Bacteria | 2597 |
| 4 | JGI25153J46596_10021561 | 3300003215 | Bacteria | 2398 |
| 5 | JGI25153J46596_10052238 | 3300003215 | Bacteria | 1165 |
| 6 | JGI25160J50197_1000862 | 3300003354 | Bacteria | 16124 |
| 7 | JGI25160J50197_1001471 | 3300003354 | Bacteria | 11739 |
| 8 | Ga0055542_1003091 | 3300003762 | Bacteria | 4775 |
| 9 | JGI25405J52794_10074805 | 3300003911 | Bacteria | 741 |
| 10 | Ga0055543_1004845 | 3300004625 | Bacteria | 3566 |
| 11 | Ga0065165_1002362 | 3300005262 | Bacteria | 16354 |
| 12 | Ga0065165_1006702 | 3300005262 | Bacteria | 5926 |
| 13 | Ga0070676_10313696 | 3300005328 | Bacteria | 1067 |
| 14 | Ga0070683_100069621 | 3300005329 | Bacteria | 3281 |
| 15 | Ga0070680_100012456 | 3300005336 | Bacteria | 6610 |
| 16 | Ga0070680_100035084 | 3300005336 | Bacteria | 4049 |
| 17 | Ga0070660_100023176 | 3300005339 | Bacteria | 4598 |
| 18 | Ga0070668_100006917 | 3300005347 | Bacteria | 8408 |
| 19 | Ga0070668_100011847 | 3300005347 | Bacteria | 6496 |
| 20 | Ga0070668_100075380 | 3300005347 | Bacteria | 2634 |
| 21 | Ga0070671_100023510 | 3300005355 | Bacteria | 5044 |
| 22 | Ga0070667_100043976 | 3300005367 | Bacteria | 3749 |
| 23 | Ga0070709_10004640 | 3300005434 | Bacteria | 7417 |
| 24 | Ga0070714_100125504 | 3300005435 | Bacteria | 2288 |
| 25 | Ga0070713_100621165 | 3300005436 | Bacteria | 1028 |
| 26 | Ga0070710_10000534 | 3300005437 | Bacteria | 17971 |
| 27 | Ga0070711_100000548 | 3300005439 | Bacteria | 19604 |
| 28 | Ga0070694_100031808 | 3300005444 | Bacteria | 3461 |
| 29 | Ga0070663_100024485 | 3300005455 | Bacteria | 4064 |
| 30 | Ga0070663_100342056 | 3300005455 | Bacteria | 1209 |
| 31 | Ga0070681_10013695 | 3300005458 | Bacteria | 8071 |
| 32 | Ga0068867_100696245 | 3300005459 | Bacteria | 896 |
| 33 | Ga0070679_100091249 | 3300005530 | Bacteria | 3034 |
| 34 | Ga0070679_100203108 | 3300005530 | Bacteria | 1947 |
| 35 | Ga0070684_100032160 | 3300005535 | Bacteria | 4470 |
| 36 | Ga0068853_100022837 | 3300005539 | Bacteria | 5228 |
| 37 | Ga0068853_100286902 | 3300005539 | Bacteria | 1518 |
| 38 | Ga0070695_100035976 | 3300005545 | Bacteria | 3114 |
| 39 | Ga0070693_100105285 | 3300005547 | Bacteria | 1726 |
| 40 | Ga0070665_100245353 | 3300005548 | Bacteria | 1791 |
| 41 | Ga0070704_100169462 | 3300005549 | Bacteria | 1735 |
| 42 | Ga0068855_100056975 | 3300005563 | Bacteria | 4582 |
| 43 | Ga0068855_100200177 | 3300005563 | Bacteria | 2249 |
| 44 | Ga0068855_101271753 | 3300005563 | Bacteria | 763 |
| 45 | Ga0068857_100020685 | 3300005577 | Bacteria | 5791 |
| 46 | Ga0068857_100228397 | 3300005577 | Bacteria | 1702 |
| 47 | Ga0068854_101011280 | 3300005578 | Bacteria | 736 |
| 48 | Ga0068856_100058718 | 3300005614 | Bacteria | 3800 |
| 49 | Ga0068856_100262168 | 3300005614 | Bacteria | 1744 |
| 50 | Ga0070702_100224953 | 3300005615 | Bacteria | 1257 |
| 51 | Ga0068852_100010119 | 3300005616 | Bacteria | 7023 |
| 52 | Ga0068852_100137152 | 3300005616 | Bacteria | 2260 |
| 53 | Ga0068859_100133756 | 3300005617 | Bacteria | 2552 |
| 54 | Ga0068861_100109753 | 3300005719 | Bacteria | 2209 |
| 55 | Ga0068851_10054871 | 3300005834 | Bacteria | 2030 |
| 56 | Ga0068863_100125930 | 3300005841 | Bacteria | 2444 |
| 57 | Ga0068863_100398512 | 3300005841 | Bacteria | 1346 |
| 58 | Ga0068858_100078600 | 3300005842 | Bacteria | 3066 |
| 59 | Ga0068862_100088409 | 3300005844 | Bacteria | 2696 |
| 60 | Ga0068862_100670901 | 3300005844 | Bacteria | 1002 |
| 61 | Ga0081455_10000086 | 3300005937 | Bacteria | 101126 |
| 62 | Ga0081455_10002017 | 3300005937 | Bacteria | 24282 |
| 63 | Ga0081455_10058037 | 3300005937 | Bacteria | 3277 |
| 64 | Ga0081455_10098227 | 3300005937 | Bacteria | 2357 |
| 65 | Ga0081540_1069864 | 3300005983 | Bacteria | 1629 |
| 66 | Ga0070717_10088384 | 3300006028 | Bacteria | 2612 |
| 67 | Ga0070717_11080557 | 3300006028 | Bacteria | 731 |
| 68 | Ga0075365_10008203 | 3300006038 | Bacteria | 5911 |
| 69 | Ga0075368_10008255 | 3300006042 | Bacteria | 3701 |
| 70 | Ga0075363_100007746 | 3300006048 | Bacteria | 4960 |
| 71 | Ga0075363_100195103 | 3300006048 | Bacteria | 1156 |
| 72 | Ga0075364_10035843 | 3300006051 | Bacteria | 3206 |
| 73 | Ga0075364_10039975 | 3300006051 | Bacteria | 3041 |
| 74 | Ga0070712_100205525 | 3300006175 | Bacteria | 1550 |
| 75 | Ga0070712_100261472 | 3300006175 | Bacteria | 1387 |
| 76 | Ga0075367_10113131 | 3300006178 | Bacteria | 1667 |
| 77 | Ga0075369_10068346 | 3300006186 | Bacteria | 1561 |
| 78 | Ga0075366_10006253 | 3300006195 | Bacteria | 6510 |
| 79 | Ga0075366_10023086 | 3300006195 | Bacteria | 3624 |
| 80 | Ga0075366_10446679 | 3300006195 | Bacteria | 798 |
| 81 | Ga0075370_10136652 | 3300006353 | Bacteria | 1432 |
| 82 | Ga0075428_100495259 | 3300006844 | Bacteria | 1308 |
| 83 | Ga0075428_100699522 | 3300006844 | Bacteria | 1080 |
| 84 | Ga0075430_100009804 | 3300006846 | Bacteria | 8102 |
| 85 | Ga0075431_100005807 | 3300006847 | Bacteria | 12211 |
| 86 | Ga0075433_10000513 | 3300006852 | Bacteria | 25290 |
| 87 | Ga0075433_10188624 | 3300006852 | Bacteria | 1834 |
| 88 | Ga0075429_100325787 | 3300006880 | Bacteria | 1344 |
| 89 | Ga0075436_100349687 | 3300006914 | Bacteria | 1065 |
| 90 | Ga0097620_100133751 | 3300006931 | Bacteria | 2552 |
| 91 | Ga0105240_10002871 | 3300009093 | Bacteria | 27247 |
| 92 | Ga0105240_10004761 | 3300009093 | Bacteria | 20490 |
| 93 | Ga0105240_10007546 | 3300009093 | Bacteria | 15763 |
| 94 | Ga0105240_10130948 | 3300009093 | Bacteria | 3009 |
| 95 | Ga0111539_10016218 | 3300009094 | Bacteria | 9241 |
| 96 | Ga0105247_10105210 | 3300009101 | Bacteria | 1809 |
| 97 | Ga0114129_10173299 | 3300009147 | Bacteria | 2940 |
| 98 | Ga0114129_10542625 | 3300009147 | Bacteria | 1513 |
| 99 | Ga0105241_10177655 | 3300009174 | Bacteria | 1763 |
| 100 | Ga0105241_10281291 | 3300009174 | Bacteria | 1421 |
| 101 | Ga0105248_10047698 | 3300009177 | Bacteria | 4803 |
| 102 | Ga0105237_10015590 | 3300009545 | Bacteria | 7905 |
| 103 | Ga0105237_10028914 | 3300009545 | Bacteria | 5641 |
| 104 | Ga0105237_10998320 | 3300009545 | Bacteria | 844 |
| 105 | Ga0105238_10003869 | 3300009551 | Bacteria | 14870 |
| 106 | Ga0105238_10005018 | 3300009551 | Bacteria | 13082 |
| 107 | Ga0105238_10555258 | 3300009551 | Bacteria | 1153 |
| 108 | Ga0105238_10560970 | 3300009551 | Bacteria | 1147 |
| 109 | Ga0105249_10446314 | 3300009553 | Bacteria | 1332 |
| 110 | Ga0105239_10018844 | 3300010375 | Bacteria | 7625 |
| 111 | Ga0105239_10082874 | 3300010375 | Bacteria | 3532 |
| 112 | Ga0105239_10109682 | 3300010375 | Bacteria | 3059 |
| 113 | Ga0105239_10148114 | 3300010375 | Bacteria | 2619 |
| 114 | Ga0105239_10296140 | 3300010375 | Bacteria | 1822 |
| 115 | Ga0105246_10056523 | 3300011119 | Bacteria | 2713 |
| 116 | Ga0157369_10000685 | 3300013105 | Bacteria | 43830 |
| 117 | Ga0157374_10070980 | 3300013296 | Bacteria | 3283 |
| 118 | Ga0157375_10371631 | 3300013308 | Bacteria | 1596 |
| 119 | Ga0157375_10970152 | 3300013308 | Bacteria | 991 |
| 120 | Ga0163163_10143448 | 3300014325 | Bacteria | 2431 |
| 121 | Ga0157380_10294294 | 3300014326 | Bacteria | 1492 |
| 122 | Ga0157379_10203769 | 3300014968 | Bacteria | 1789 |
| 123 | Ga0157376_10675816 | 3300014969 | Bacteria | 1035 |
| 124 | Ga0206353_11573899 | 3300020082 | Bacteria | 1118 |
| 125 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 126 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 127 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 128 | Ga0214545_1035621 | 3300021324 | Bacteria | 1634 |
| 129 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 130 | Ga0213873_10018929 | 3300021358 | Bacteria | 1590 |
| 131 | Ga0213872_10087414 | 3300021361 | Bacteria | 1396 |
| 132 | Ga0213874_10103358 | 3300021377 | Bacteria | 950 |
| 133 | Ga0213876_10069397 | 3300021384 | Bacteria | 1861 |
| 134 | Ga0213876_10267544 | 3300021384 | Bacteria | 908 |
| 135 | Ga0209677_104884 | 3300025253 | Bacteria | 3676 |
| 136 | Ga0209148_1000654 | 3300025254 | Bacteria | 29905 |
| 137 | Ga0209233_1001456 | 3300025261 | Bacteria | 9342 |
| 138 | Ga0209455_1010095 | 3300025272 | Bacteria | 2426 |
| 139 | Ga0209564_1032890 | 3300025295 | Bacteria | 1552 |
| 140 | Ga0209758_1000320 | 3300025297 | Bacteria | 92649 |
| 141 | Ga0209758_1001495 | 3300025297 | Bacteria | 27238 |
| 142 | Ga0209758_1011255 | 3300025297 | Bacteria | 5209 |
| 143 | Ga0209758_1037460 | 3300025297 | Bacteria | 1874 |
| 144 | Ga0209758_1060429 | 3300025297 | Bacteria | 1255 |
| 145 | Ga0209758_1060430 | 3300025297 | Bacteria | 1255 |
| 146 | Ga0207426_1000746 | 3300025302 | Bacteria | 36609 |
| 147 | Ga0207426_1004351 | 3300025302 | Bacteria | 6962 |
| 148 | Ga0209257_1012298 | 3300025304 | Bacteria | 3979 |
| 149 | Ga0209257_1038158 | 3300025304 | Bacteria | 1458 |
| 150 | Ga0207656_10016053 | 3300025321 | Bacteria | 2908 |
| 151 | Ga0207656_10138113 | 3300025321 | Bacteria | 1147 |
| 152 | Ga0207692_10000091 | 3300025898 | Bacteria | 26705 |
| 153 | Ga0207688_10031744 | 3300025901 | Bacteria | 2917 |
| 154 | Ga0207647_10030422 | 3300025904 | Bacteria | 3484 |
| 155 | Ga0207699_10000782 | 3300025906 | Bacteria | 15227 |
| 156 | Ga0207645_10510000 | 3300025907 | Bacteria | 815 |
| 157 | Ga0207705_10032876 | 3300025909 | Bacteria | 3706 |
| 158 | Ga0207654_10008841 | 3300025911 | Bacteria | 5110 |
| 159 | Ga0207654_10010107 | 3300025911 | Bacteria | 4800 |
| 160 | Ga0207707_10001881 | 3300025912 | Bacteria | 19162 |
| 161 | Ga0207695_10000503 | 3300025913 | Bacteria | 83026 |
| 162 | Ga0207695_10102221 | 3300025913 | Bacteria | 2859 |
| 163 | Ga0207695_10302211 | 3300025913 | Bacteria | 1491 |
| 164 | Ga0207671_10263060 | 3300025914 | Bacteria | 1358 |
| 165 | Ga0207671_10575208 | 3300025914 | Bacteria | 898 |
| 166 | Ga0207693_10029076 | 3300025915 | Bacteria | 4368 |
| 167 | Ga0207693_10430565 | 3300025915 | Bacteria | 1031 |
| 168 | Ga0207663_10047322 | 3300025916 | Bacteria | 2655 |
| 169 | Ga0207660_10005375 | 3300025917 | Bacteria | 8316 |
| 170 | Ga0207660_10048097 | 3300025917 | Bacteria | 3018 |
| 171 | Ga0207657_10005742 | 3300025919 | Bacteria | 12944 |
| 172 | Ga0207657_10061871 | 3300025919 | Bacteria | 3207 |
| 173 | Ga0207649_10642742 | 3300025920 | Bacteria | 819 |
| 174 | Ga0207652_10001649 | 3300025921 | Bacteria | 19585 |
| 175 | Ga0207681_10609515 | 3300025923 | Bacteria | 903 |
| 176 | Ga0207694_10041393 | 3300025924 | Bacteria | 3550 |
| 177 | Ga0207694_10266785 | 3300025924 | Bacteria | 1403 |
| 178 | Ga0207700_10018197 | 3300025928 | Bacteria | 4715 |
| 179 | Ga0207664_10023054 | 3300025929 | Bacteria | 4659 |
| 180 | Ga0207644_10020693 | 3300025931 | Bacteria | 4476 |
| 181 | Ga0207690_10003499 | 3300025932 | Bacteria | 9366 |
| 182 | Ga0207690_10137839 | 3300025932 | Bacteria | 1794 |
| 183 | Ga0207690_10291594 | 3300025932 | Bacteria | 1274 |
| 184 | Ga0207661_10049173 | 3300025944 | Bacteria | 3355 |
| 185 | Ga0207667_10037563 | 3300025949 | Bacteria | 5176 |
| 186 | Ga0207667_10050013 | 3300025949 | Bacteria | 4412 |
| 187 | Ga0207667_10231534 | 3300025949 | Bacteria | 1892 |
| 188 | Ga0207667_10264307 | 3300025949 | Bacteria | 1760 |
| 189 | Ga0207712_10292993 | 3300025961 | Bacteria | 1332 |
| 190 | Ga0207668_10015251 | 3300025972 | Bacteria | 4770 |
| 191 | Ga0207668_10191950 | 3300025972 | Bacteria | 1619 |
| 192 | Ga0207668_10216734 | 3300025972 | Bacteria | 1534 |
| 193 | Ga0207658_10563461 | 3300025986 | Bacteria | 1020 |
| 194 | Ga0207703_10561468 | 3300026035 | Bacteria | 1077 |
| 195 | Ga0207639_10021282 | 3300026041 | Bacteria | 4656 |
| 196 | Ga0207639_10029266 | 3300026041 | Bacteria | 4030 |
| 197 | Ga0207639_10087060 | 3300026041 | Bacteria | 2489 |
| 198 | Ga0207639_11000265 | 3300026041 | Bacteria | 783 |
| 199 | Ga0207678_10036640 | 3300026067 | Bacteria | 4270 |
| 200 | Ga0207678_10044490 | 3300026067 | Bacteria | 3840 |
| 201 | Ga0207678_10108119 | 3300026067 | Bacteria | 2372 |
| 202 | Ga0207678_10359567 | 3300026067 | Bacteria | 1256 |
| 203 | Ga0207678_10632672 | 3300026067 | Bacteria | 939 |
| 204 | Ga0207708_10104812 | 3300026075 | Bacteria | 2191 |
| 205 | Ga0207702_10141120 | 3300026078 | Bacteria | 2180 |
| 206 | Ga0207702_10224566 | 3300026078 | Bacteria | 1752 |
| 207 | Ga0207702_10579719 | 3300026078 | Bacteria | 1099 |
| 208 | Ga0207641_10106892 | 3300026088 | Bacteria | 2474 |
| 209 | Ga0207641_10303079 | 3300026088 | Bacteria | 1510 |
| 210 | Ga0207641_10512830 | 3300026088 | Bacteria | 1166 |
| 211 | Ga0207648_10410844 | 3300026089 | Bacteria | 1228 |
| 212 | Ga0207648_10481755 | 3300026089 | Bacteria | 1133 |
| 213 | Ga0207674_10023609 | 3300026116 | Bacteria | 6584 |
| 214 | Ga0207674_10255838 | 3300026116 | Bacteria | 1698 |
| 215 | Ga0207675_100113164 | 3300026118 | Bacteria | 2562 |
| 216 | Ga0207698_10005624 | 3300026142 | Bacteria | 7758 |
| 217 | Ga0207698_10165117 | 3300026142 | Bacteria | 1942 |
| 218 | Ga0209813_10039071 | 3300027866 | Bacteria | 1437 |
| 219 | Ga0207428_10221335 | 3300027907 | Bacteria | 1419 |
| 220 | Ga0268266_10161520 | 3300028379 | Bacteria | 2027 |
| 221 | Ga0268266_10323426 | 3300028379 | Bacteria | 1444 |
| 222 | Ga0268265_10124676 | 3300028380 | Bacteria | 2129 |
| 223 | Ga0268265_10925306 | 3300028380 | Bacteria | 857 |
| 224 | Ga0265319_1051150 | 3300028563 | Bacteria | 1363 |
| 225 | Ga0265334_10006729 | 3300028573 | Bacteria | 4937 |
| 226 | Ga0265338_10022804 | 3300028800 | Bacteria | 6463 |
| 227 | Ga0265338_10026178 | 3300028800 | Bacteria | 5894 |
| 228 | Ga0265338_10026523 | 3300028800 | Bacteria | 5841 |
| 229 | Ga0265338_10083442 | 3300028800 | Bacteria | 2673 |
| 230 | Ga0265338_10094210 | 3300028800 | Bacteria | 2464 |
| 231 | Ga0265320_10115032 | 3300031240 | Bacteria | 1230 |
| 232 | Ga0265327_10074629 | 3300031251 | Bacteria | 1689 |
| 233 | Ga0316576_10008259 | 3300031727 | Bacteria | 6625 |
| 234 | Ga0307413_10185353 | 3300031824 | Bacteria | 1488 |
| 235 | Ga0307410_10236883 | 3300031852 | Bacteria | 1412 |
| 236 | Ga0307409_100073567 | 3300031995 | Bacteria | 2726 |
| 237 | Ga0307416_100126903 | 3300032002 | Bacteria | 2287 |
| 238 | Ga0307416_101039223 | 3300032002 | Bacteria | 923 |
| 239 | Ga0307416_101174244 | 3300032002 | Bacteria | 873 |
| 240 | Ga0307411_10028563 | 3300032005 | Bacteria | 3393 |
| 241 | Ga0307415_100183628 | 3300032126 | Bacteria | 1644 |
| 242 | Ga0316583_10047508 | 3300032133 | Bacteria | 1513 |
| 243 | Ga0307510_10132792 | 3300033180 | Bacteria | 2156 |
| 244 | Ga0373958_0053448 | 3300034819 | Bacteria | 858 |
| 245 | Ga0373959_0021175 | 3300034820 | Bacteria | 1246 |
| 246 | Ga0373938_0041745 | 3300034957 | Bacteria | 1021 |
| 247 | Ga0373928_0016212 | 3300035084 | Bacteria | 1523 |
| 248 | Ga0373929_0059958 | 3300035085 | Bacteria | 888 |
| 249 | Ga0373940_0008127 | 3300035088 | Bacteria | 2396 |
| 250 | Ga0373940_0025751 | 3300035088 | Bacteria | 1534 |
| 251 | Ga0373949_0057201 | 3300035090 | Bacteria | 996 |
| 252 | Ga0373932_0003500 | 3300035112 | Bacteria | 3771 |
| 253 | Ga0373939_0014883 | 3300035114 | Bacteria | 2026 |
| 254 | Ga0373960_0080014 | 3300035121 | Bacteria | 1027 |
| 255 | Ga0373961_0242858 | 3300035241 | Bacteria | 649 |
| 256 | Ga0373931_0000351 | 3300035691 | Bacteria | 18984 |
| 257 | Ga0373931_0171794 | 3300035691 | Bacteria | 1278 |
| 258 | Ga0373935_0303963 | 3300035692 | Bacteria | 1128 |
| 259 | Ga0373927_0001984 | 3300035695 | Bacteria | 15075 |
| 260 | Ga0373933_0000038 | 3300035724 | Bacteria | 80976 |
| 261 | Ga0373937_0231953 | 3300036401 | Bacteria | 1738 |
| 262 | Ga0373925_0417112 | 3300037068 | Bacteria | 1096 |
| 263 | Ga0395899_0000026 | 3300037312 | Bacteria | 345291 |
| 264 | Ga0395898_0198937 | 3300037466 | Bacteria | 1914 |
| 265 | Ga0395905_0896989 | 3300037471 | Bacteria | 789 |
| 266 | Ga0436364_0531241 | 3300037853 | Bacteria | 769 |
| 267 | Ga0400483_075974 | 3300039062 | Bacteria | 3308 |
| 268 | Ga0400483_080646 | 3300039062 | Bacteria | 14829 |
| 269 | Ga0400483_085672 | 3300039062 | Bacteria | 2820 |
| 270 | Ga0400483_114150 | 3300039062 | Bacteria | 2205 |
| 271 | Ga0400483_115380 | 3300039062 | Bacteria | 1822 |
| 272 | Ga0400483_118604 | 3300039062 | Bacteria | 1172 |
| 273 | Ga0400483_156125 | 3300039062 | Bacteria | 1187 |
| 274 | Ga0400483_212347 | 3300039062 | Bacteria | 3877 |
| 275 | Ga0400483_216717 | 3300039062 | Bacteria | 1932 |
| 276 | Ga0400483_229872 | 3300039062 | Bacteria | 12743 |
| 277 | Ga0400483_238163 | 3300039062 | Bacteria | 1866 |
| 278 | Ga0400483_242397 | 3300039062 | Bacteria | 1616 |
| 279 | Ga0436365_0365623 | 3300039437 | Bacteria | 31548 |
| 280 | Ga0436365_0434683 | 3300039437 | Bacteria | 808 |
| 281 | Ga0436365_0711553 | 3300039437 | Bacteria | 97884 |
| 282 | Ga0436365_1902327 | 3300039437 | Bacteria | 890 |
| 283 | Ga0436360_0753528 | 3300039438 | Bacteria | 798 |
| 284 | Ga0436360_1213167 | 3300039438 | Bacteria | 1991 |
| 285 | Ga0436361_0552255 | 3300039447 | Bacteria | 1114 |
| 286 | Ga0436361_0779011 | 3300039447 | Bacteria | 1870 |
| 287 | Ga0436361_0805306 | 3300039447 | Bacteria | 3569 |
| 288 | Ga0436363_0149506 | 3300039450 | Bacteria | 2325 |
| 289 | Ga0436363_1007251 | 3300039450 | Bacteria | 928 |
| 290 | Ga0436363_1378300 | 3300039450 | Bacteria | 7286 |
| 291 | Ga0436362_0272811 | 3300039453 | Bacteria | 1919 |
| 292 | Ga0436362_1067038 | 3300039453 | Bacteria | 1075 |
| 293 | Ga0466972_0000363 | 3300044658 | Bacteria | 24488 |
| 294 | Ga0466972_0084083 | 3300044658 | Bacteria | 1513 |
| 295 | Ga0466972_0140517 | 3300044658 | Bacteria | 1136 |
| 296 | Ga0466965_0035434 | 3300044683 | Bacteria | 2445 |
| 297 | Ga0466961_0201509 | 3300044693 | Bacteria | 1231 |
| 298 | Ga0466964_0071255 | 3300044706 | Bacteria | 1470 |
| 299 | Ga0466968_0001648 | 3300044735 | Bacteria | 8067 |
| 300 | Ga0466968_0037667 | 3300044735 | Bacteria | 2030 |
| 301 | Ga0466968_0056259 | 3300044735 | Bacteria | 1689 |
| 302 | Ga0466968_0129873 | 3300044735 | Bacteria | 1146 |
| 303 | Ga0466970_0374253 | 3300044765 | Bacteria | 810 |
| 304 | Ga0466959_0057334 | 3300045049 | Bacteria | 2840 |
| 305 | Ga0451576_0001020 | 3300045051 | Bacteria | 51854 |
| 306 | Ga0466967_0606679 | 3300045976 | Bacteria | 1080 |
| 307 | Ga0495603_0045503 | 3300046455 | Bacteria | 2617 |
| 308 | Ga0495590_0046319 | 3300046457 | Bacteria | 1517 |
| 309 | Ga0495629_0000900 | 3300046459 | Bacteria | 23863 |
| 310 | Ga0495638_0003425 | 3300046460 | Bacteria | 12493 |
| 311 | Ga0495651_0021715 | 3300046462 | Bacteria | 4989 |
| 312 | Ga0495651_0051135 | 3300046462 | Bacteria | 3187 |
| 313 | Ga0495651_0233019 | 3300046462 | Bacteria | 1267 |
| 314 | Ga0495651_0666486 | 3300046462 | Bacteria | 651 |
| 315 | Ga0495653_0022549 | 3300046463 | Bacteria | 5093 |
| 316 | Ga0495653_0227682 | 3300046463 | Bacteria | 1249 |
| 317 | Ga0495605_0119724 | 3300046474 | Bacteria | 1194 |
| 318 | Ga0495662_0103820 | 3300046476 | Bacteria | 1391 |
| 319 | Ga0495664_0005450 | 3300046477 | Bacteria | 6991 |
| 320 | Ga0495584_0260622 | 3300046491 | Bacteria | 881 |
| 321 | Ga0495606_0023497 | 3300046507 | Bacteria | 4464 |
| 322 | Ga0495606_0035170 | 3300046507 | Bacteria | 3428 |
| 323 | Ga0495606_0053725 | 3300046507 | Bacteria | 2613 |
| 324 | Ga0495606_0192703 | 3300046507 | Bacteria | 1167 |
| 325 | Ga0495608_0110982 | 3300046511 | Bacteria | 1763 |
| 326 | Ga0495610_0074036 | 3300046512 | Bacteria | 1581 |
| 327 | Ga0495610_0196402 | 3300046512 | Bacteria | 829 |
| 328 | Ga0495618_0379552 | 3300046514 | Bacteria | 867 |
| 329 | Ga0495628_0040123 | 3300046516 | Bacteria | 3742 |
| 330 | Ga0495628_0174794 | 3300046516 | Bacteria | 1627 |
| 331 | Ga0495630_0035846 | 3300046517 | Bacteria | 3707 |
| 332 | Ga0495631_0098170 | 3300046518 | Bacteria | 1261 |
| 333 | Ga0495631_0206960 | 3300046518 | Bacteria | 839 |
| 334 | Ga0495632_0238846 | 3300046519 | Bacteria | 818 |
| 335 | Ga0495637_0146650 | 3300046520 | Bacteria | 893 |
| 336 | Ga0495643_0005438 | 3300046522 | Bacteria | 8618 |
| 337 | Ga0495643_0072904 | 3300046522 | Bacteria | 1800 |
| 338 | Ga0495643_0223834 | 3300046522 | Bacteria | 891 |
| 339 | Ga0495648_0169772 | 3300046524 | Bacteria | 1119 |
| 340 | Ga0495642_0053360 | 3300046528 | Bacteria | 1666 |
| 341 | Ga0495652_0027943 | 3300046529 | Bacteria | 4968 |
| 342 | Ga0495652_0216450 | 3300046529 | Bacteria | 1442 |
| 343 | Ga0495652_0218332 | 3300046529 | Bacteria | 1434 |
| 344 | Ga0495654_0117540 | 3300046530 | Bacteria | 1207 |
| 345 | Ga0495640_0038743 | 3300046533 | Bacteria | 3351 |
| 346 | Ga0495640_0051430 | 3300046533 | Bacteria | 2832 |
| 347 | Ga0495587_0016459 | 3300046536 | Bacteria | 4599 |
| 348 | Ga0495645_0020249 | 3300046543 | Bacteria | 4797 |
| 349 | Ga0495622_0000699 | 3300046557 | Bacteria | 19021 |
| 350 | Ga0495622_0030034 | 3300046557 | Bacteria | 2539 |
| 351 | Ga0495622_0032398 | 3300046557 | Bacteria | 2441 |
| 352 | Ga0495622_0108540 | 3300046557 | Bacteria | 1271 |
| 353 | Ga0495622_0172696 | 3300046557 | Bacteria | 971 |
| 354 | Ga0495667_0044118 | 3300046559 | Bacteria | 2953 |
| 355 | Ga0495656_0319067 | 3300046615 | Bacteria | 800 |
| 356 | Ga0495668_0020048 | 3300046616 | Bacteria | 3846 |
| 357 | Ga0495668_0092934 | 3300046616 | Bacteria | 1652 |
| 358 | Ga0495634_0398920 | 3300046642 | Bacteria | 817 |
| 359 | Ga0495625_0526427 | 3300046660 | Bacteria | 719 |
| 360 | Ga0495635_0006765 | 3300046663 | Bacteria | 8010 |
| 361 | Ga0495635_0023237 | 3300046663 | Bacteria | 4321 |
| 362 | Ga0495661_0199095 | 3300046665 | Bacteria | 1050 |
| 363 | Ga0495657_0006673 | 3300046675 | Bacteria | 9015 |
| 364 | Ga0495657_0068992 | 3300046675 | Bacteria | 2314 |
| 365 | Ga0495599_0331056 | 3300046678 | Bacteria | 915 |
| 366 | Ga0495623_0029798 | 3300046679 | Bacteria | 3511 |
| 367 | Ga0495646_0022884 | 3300046680 | Bacteria | 3937 |
| 368 | Ga0495658_0397585 | 3300046683 | Bacteria | 878 |
| 369 | Ga0495613_0036466 | 3300046689 | Bacteria | 3646 |
| 370 | Ga0495613_0046098 | 3300046689 | Bacteria | 3224 |
| 371 | Ga0495613_0473520 | 3300046689 | Bacteria | 846 |
| 372 | Ga0495624_0290679 | 3300046690 | Bacteria | 986 |
| 373 | Ga0495649_0079608 | 3300046694 | Bacteria | 1752 |
| 374 | Ga0495600_0007520 | 3300046809 | Bacteria | 6669 |
| 375 | Ga0495600_0048237 | 3300046809 | Bacteria | 2778 |
| 376 | Ga0495581_0025276 | 3300047315 | Bacteria | 3444 |
| 377 | Ga0495604_0006276 | 3300047317 | Bacteria | 9434 |
| 378 | Ga0495604_0040819 | 3300047317 | Bacteria | 3641 |
| 379 | Ga0495674_0013016 | 3300047319 | Bacteria | 7831 |
| 380 | Ga0495672_0007741 | 3300047320 | Bacteria | 8039 |
| 381 | Ga0495672_0298362 | 3300047320 | Bacteria | 764 |
| 382 | Ga0495676_0021088 | 3300047321 | Bacteria | 5702 |
| 383 | Ga0495680_0007943 | 3300047322 | Bacteria | 9680 |
| 384 | Ga0495683_0054012 | 3300047323 | Bacteria | 2003 |
| 385 | Ga0495683_0180299 | 3300047323 | Bacteria | 965 |
| 386 | Ga0495687_175112 | 3300047443 | Bacteria | 706 |
| 387 | Ga0495675_0003949 | 3300047444 | Bacteria | 8991 |
| 388 | Ga0495673_0108636 | 3300047469 | Bacteria | 1112 |
| 389 | Ga0495673_0185425 | 3300047469 | Bacteria | 786 |
| 390 | Ga0495686_0197279 | 3300047472 | Bacteria | 1157 |
| 391 | Ga0495593_0063295 | 3300047673 | Bacteria | 1932 |
| 392 | Ga0495602_0013244 | 3300048088 | Bacteria | 8434 |
| 393 | Ga0495602_0610040 | 3300048088 | Bacteria | 749 |
| 394 | Ga0496100_0058924 | 3300048903 | Bacteria | 2522 |
| 395 | Ga0496100_0118101 | 3300048903 | Bacteria | 1852 |
| 396 | Ga0496101_0045623 | 3300048904 | Bacteria | 3140 |
| 397 | Ga0496101_0053843 | 3300048904 | Bacteria | 2904 |
| 398 | Ga0496101_0108815 | 3300048904 | Bacteria | 2084 |
| 399 | Ga0496102_0025794 | 3300048905 | Bacteria | 5234 |
| 400 | Ga0496102_0605867 | 3300048905 | Bacteria | 1018 |
| 401 | Ga0496102_0915356 | 3300048905 | Bacteria | 798 |
| 402 | Ga0496102_1026283 | 3300048905 | Bacteria | 745 |
| 403 | Ga0496103_0007433 | 3300048906 | Bacteria | 6530 |
| 404 | Ga0496103_0173750 | 3300048906 | Bacteria | 1384 |
| 405 | Ga0496104_0002707 | 3300048907 | Bacteria | 15254 |
| 406 | Ga0496104_0029300 | 3300048907 | Bacteria | 5105 |
| 407 | Ga0496104_0033366 | 3300048907 | Bacteria | 4794 |
| 408 | Ga0496104_0301152 | 3300048907 | Bacteria | 1515 |
| 409 | Ga0496104_0522280 | 3300048907 | Bacteria | 1098 |
| 410 | Ga0496105_0003571 | 3300048908 | Bacteria | 11538 |
| 411 | Ga0496105_0077048 | 3300048908 | Bacteria | 2753 |
| 412 | Ga0496105_0140306 | 3300048908 | Bacteria | 1989 |
| 413 | Ga0496106_0349625 | 3300048909 | Bacteria | 1187 |
| 414 | Ga0496106_0753678 | 3300048909 | Bacteria | 774 |
| 415 | Ga0496107_0071425 | 3300048910 | Bacteria | 2522 |
| 416 | Ga0496107_0099485 | 3300048910 | Bacteria | 2131 |
| 417 | Ga0496108_0034095 | 3300048911 | Bacteria | 4229 |
| 418 | Ga0496109_0062374 | 3300048912 | Bacteria | 3408 |
| 419 | Ga0496110_0083477 | 3300048913 | Bacteria | 2850 |
| 420 | Ga0496111_0241288 | 3300048914 | Bacteria | 1342 |
| 421 | Ga0496112_0052736 | 3300048915 | Bacteria | 3992 |
| 422 | Ga0496112_0094636 | 3300048915 | Bacteria | 2958 |
| 423 | Ga0496113_0120823 | 3300048916 | Bacteria | 2048 |
| 424 | Ga0496113_0414979 | 3300048916 | Bacteria | 1081 |
| 425 | Ga0496114_0191788 | 3300048917 | Bacteria | 1788 |
| 426 | Ga0496114_0313449 | 3300048917 | Bacteria | 1386 |
| 427 | Ga0496114_0333313 | 3300048917 | Bacteria | 1341 |
| 428 | Ga0496115_0027942 | 3300048918 | Bacteria | 4416 |
| 429 | Ga0496115_0218994 | 3300048918 | Bacteria | 1571 |
| 430 | Ga0496115_0231656 | 3300048918 | Bacteria | 1523 |
| 431 | Ga0496115_0260701 | 3300048918 | Bacteria | 1425 |
| 432 | Ga0496115_0557190 | 3300048918 | Bacteria | 915 |
| 433 | Ga0496115_0627416 | 3300048918 | Bacteria | 852 |
| 434 | Ga0496116_0014259 | 3300048919 | Bacteria | 6357 |
| 435 | Ga0496116_0043348 | 3300048919 | Bacteria | 3066 |
| 436 | Ga0496117_0055450 | 3300048920 | Bacteria | 2769 |
| 437 | Ga0496117_0222959 | 3300048920 | Bacteria | 1048 |
| 438 | Ga0496118_0043905 | 3300048921 | Bacteria | 3507 |
| 439 | Ga0496118_0068846 | 3300048921 | Bacteria | 2568 |
| 440 | Ga0496118_0115119 | 3300048921 | Bacteria | 1771 |
| 441 | Ga0496118_0383671 | 3300048921 | Bacteria | 736 |
| 442 | Ga0496119_0018956 | 3300048922 | Bacteria | 5095 |
| 443 | Ga0496119_0105269 | 3300048922 | Bacteria | 1576 |
| 444 | Ga0496120_0023635 | 3300048923 | Bacteria | 3844 |
| 445 | Ga0496121_0004381 | 3300048924 | Bacteria | 19069 |
| 446 | Ga0496121_0093712 | 3300048924 | Bacteria | 2337 |
| 447 | Ga0496121_0226031 | 3300048924 | Bacteria | 1314 |
| 448 | Ga0496121_0451774 | 3300048924 | Bacteria | 828 |
| 449 | Ga0496122_0087738 | 3300048925 | Bacteria | 2136 |
| 450 | Ga0496122_0188080 | 3300048925 | Bacteria | 1222 |
| 451 | Ga0496123_0105528 | 3300048926 | Bacteria | 1626 |
| 452 | Ga0496124_0095498 | 3300048927 | Bacteria | 2416 |
| 453 | Ga0496124_0269060 | 3300048927 | Bacteria | 1249 |
| 454 | Ga0496125_0051118 | 3300048928 | Bacteria | 3412 |
| 455 | Ga0496125_0064011 | 3300048928 | Bacteria | 2927 |
| 456 | Ga0496125_0104161 | 3300048928 | Bacteria | 2079 |
| 457 | Ga0496125_0256258 | 3300048928 | Bacteria | 1100 |
| 458 | Ga0496126_0020402 | 3300048929 | Bacteria | 6498 |
| 459 | Ga0496126_0041687 | 3300048929 | Bacteria | 4246 |
| 460 | Ga0495682_0027484 | 3300049460 | Bacteria | 2110 |
| 461 | Ga0501031_0022736 | 3300049568 | Bacteria | 4087 |
| 462 | Ga0501032_0000119 | 3300049569 | Bacteria | 65020 |
| 463 | Ga0501033_0015916 | 3300049570 | Bacteria | 5696 |
| 464 | Ga0501033_0019157 | 3300049570 | Bacteria | 5174 |
| 465 | Ga0501034_0000413 | 3300049571 | Bacteria | 71861 |
| 466 | Ga0501034_0001333 | 3300049571 | Bacteria | 33330 |
| 467 | Ga0501034_0024474 | 3300049571 | Bacteria | 6142 |
| 468 | Ga0501034_0031661 | 3300049571 | Bacteria | 5373 |
| 469 | Ga0501034_0045102 | 3300049571 | Bacteria | 4456 |
| 470 | Ga0501036_0000614 | 3300049572 | Bacteria | 25905 |
| 471 | Ga0501037_0000288 | 3300049573 | Bacteria | 42724 |
| 472 | Ga0501037_0005289 | 3300049573 | Bacteria | 9393 |
| 473 | Ga0501038_0000046 | 3300049574 | Bacteria | 106465 |
| 474 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 475 | Ga0501039_0488441 | 3300049575 | Bacteria | 967 |
| 476 | Ga0501040_0867520 | 3300049576 | Bacteria | 654 |
| 477 | Ga0501041_0293562 | 3300049577 | Bacteria | 1024 |
| 478 | Ga0501041_0551734 | 3300049577 | Bacteria | 734 |
| 479 | Ga0501043_0000051 | 3300049579 | Bacteria | 106957 |
| 480 | Ga0501046_0452338 | 3300049580 | Bacteria | 923 |
| 481 | Ga0501047_0358203 | 3300049581 | Bacteria | 1295 |
| 482 | Ga0501047_0615906 | 3300049581 | Bacteria | 906 |
| 483 | Ga0501047_0957430 | 3300049581 | Bacteria | 669 |
| 484 | Ga0501071_0661671 | 3300049587 | Bacteria | 804 |
| 485 | Ga0501072_0340796 | 3300049588 | Bacteria | 1191 |
| 486 | Ga0501073_0504863 | 3300049589 | Bacteria | 836 |
| 487 | Ga0501075_0373526 | 3300049591 | Bacteria | 1087 |
| 488 | Ga0501077_0101197 | 3300049593 | Bacteria | 1826 |
| 489 | Ga0501035_0000102 | 3300049822 | Bacteria | 106915 |
| 490 | Ga0501035_0243868 | 3300049822 | Bacteria | 1528 |
| 491 | Ga0501044_0001230 | 3300049823 | Bacteria | 30435 |
| 492 | Ga0501044_0135164 | 3300049823 | Bacteria | 2457 |
| 493 | nmdc:mga03n38_171368_c1 | 3300050490 | Bacteria | 1106 |
| 494 | nmdc:mga00v17_17467_c1 | 3300050491 | Bacteria | 4062 |
| 495 | nmdc:mga0yw44_322388_c1 | 3300050492 | Bacteria | 1038 |
| 496 | nmdc:mga0yw44_9102_c1 | 3300050492 | Bacteria | 4995 |
| 497 | nmdc:mga0k408_75413_c1 | 3300050493 | Bacteria | 1971 |
| 498 | nmdc:mga0k408_91430_c1 | 3300050493 | Bacteria | 1788 |
| 499 | nmdc:mga06z11_35953_c1 | 3300050494 | Bacteria | 2441 |
| 500 | nmdc:mga04h51_8605_c1 | 3300050495 | Bacteria | 2734 |
| 501 | nmdc:mga07m45_12697_c1 | 3300050496 | Bacteria | 4454 |
| 502 | nmdc:mga07m45_14394_c1 | 3300050496 | Bacteria | 4213 |
| 503 | nmdc:mga05p37_329011_c1 | 3300050507 | Bacteria | 1806 |
| 504 | nmdc:mga05p37_541177_c1 | 3300050507 | Bacteria | 1328 |
| 505 | nmdc:mga05p37_603096_c1 | 3300050507 | Bacteria | 1239 |
| 506 | nmdc:mga05p37_85288_c1 | 3300050507 | Bacteria | 3891 |
| 507 | nmdc:mga09592_502459_c1 | 3300050508 | Bacteria | 1044 |
| 508 | nmdc:mga0qj67_107560_c1 | 3300050509 | Bacteria | 2250 |
| 509 | nmdc:mga06r32_61080_c1 | 3300050510 | Bacteria | 3627 |
| 510 | nmdc:mga08y16_125828_c1 | 3300050511 | Bacteria | 2666 |
| 511 | nmdc:mga08y16_4733_c1 | 3300050511 | Bacteria | 14195 |
| 512 | nmdc:mga08y16_95603_c1 | 3300050511 | Bacteria | 3095 |
| 513 | nmdc:mga0n895_146074_c1 | 3300050512 | Bacteria | 2394 |
| 514 | nmdc:mga0n895_193085_c1 | 3300050512 | Bacteria | 2067 |
| 515 | nmdc:mga0n895_567399_c1 | 3300050512 | Bacteria | 1140 |
| 516 | nmdc:mga08x19_518073_c1 | 3300050514 | Bacteria | 842 |
| 517 | nmdc:mga0a205_10887_c1 | 3300050515 | Bacteria | 8369 |
| 518 | nmdc:mga0a205_265521_c1 | 3300050515 | Bacteria | 1594 |
| 519 | nmdc:mga0a205_891617_c1 | 3300050515 | Bacteria | 736 |
| 520 | nmdc:mga0sz30_50125_c1 | 3300050516 | Bacteria | 1770 |
| 521 | nmdc:mga0sz30_50701_c1 | 3300050516 | Bacteria | 1760 |
| 522 | Ga0500610_0355241 | 3300053079 | Bacteria | 618 |
| 523 | Ga0495655_0044091 | 3300053083 | Bacteria | 1152 |
| 524 | Ga0495595_0155847 | 3300053084 | Bacteria | 1125 |
| 525 | Ga0495619_0046460 | 3300053085 | Bacteria | 2855 |
| 526 | Ga0500578_0123944 | 3300053086 | Bacteria | 1623 |
| 527 | Ga0500643_000047 | 3300053087 | Bacteria | 148938 |
| 528 | Ga0500643_008375 | 3300053087 | Bacteria | 4065 |
| 529 | Ga0500651_0035166 | 3300053093 | Bacteria | 3158 |
| 530 | Ga0500651_0320785 | 3300053093 | Bacteria | 885 |
| 531 | Ga0500566_0027227 | 3300053094 | Bacteria | 3345 |
| 532 | Ga0500566_0141474 | 3300053094 | Bacteria | 1276 |
| 533 | Ga0500640_034386 | 3300053095 | Bacteria | 2226 |
| 534 | Ga0500650_0163777 | 3300053098 | Bacteria | 1025 |
| 535 | Ga0500555_007180 | 3300053103 | Bacteria | 3165 |
| 536 | Ga0500555_051460 | 3300053103 | Bacteria | 1126 |
| 537 | Ga0500556_0000326 | 3300053104 | Bacteria | 35770 |
| 538 | Ga0500556_0128367 | 3300053104 | Bacteria | 992 |
| 539 | Ga0500558_169387 | 3300053106 | Bacteria | 792 |
| 540 | Ga0500595_033458 | 3300053119 | Bacteria | 1706 |
| 541 | Ga0500595_045758 | 3300053119 | Bacteria | 1380 |
| 542 | Ga0500614_070537 | 3300053123 | Bacteria | 958 |
| 543 | Ga0500618_037738 | 3300053125 | Bacteria | 1116 |
| 544 | Ga0500642_0008914 | 3300053130 | Bacteria | 3456 |
| 545 | Ga0500642_0010822 | 3300053130 | Bacteria | 3235 |
| 546 | Ga0500655_004973 | 3300053133 | Bacteria | 2390 |
| 547 | Ga0500658_0112542 | 3300053134 | Bacteria | 1199 |
| 548 | Ga0500658_0420634 | 3300053134 | Bacteria | 610 |
| 549 | Ga0500559_0028573 | 3300053136 | Bacteria | 2383 |
| 550 | Ga0500568_0067797 | 3300053139 | Bacteria | 1370 |
| 551 | Ga0500573_0262309 | 3300053140 | Bacteria | 884 |
| 552 | Ga0500577_0052342 | 3300053142 | Bacteria | 1539 |
| 553 | Ga0500589_187102 | 3300053147 | Bacteria | 808 |
| 554 | Ga0500590_230533 | 3300053148 | Bacteria | 755 |
| 555 | Ga0500616_0002793 | 3300053153 | Bacteria | 14061 |
| 556 | Ga0500616_0087570 | 3300053153 | Bacteria | 1550 |
| 557 | Ga0500620_016927 | 3300053155 | Bacteria | 2093 |
| 558 | Ga0500622_0006265 | 3300053156 | Bacteria | 6952 |
| 559 | Ga0500633_0067440 | 3300053160 | Bacteria | 1272 |
| 560 | Ga0500638_019612 | 3300053162 | Bacteria | 3172 |
| 561 | Ga0500637_0002010 | 3300053178 | Bacteria | 8872 |
| 562 | Ga0500609_025756 | 3300053731 | Bacteria | 806 |
| 563 | Ga0500552_002212 | 3300053733 | Bacteria | 1885 |
| 564 | Ga0500599_000212 | 3300053736 | Bacteria | 5460 |
| 565 | Ga0500601_000078 | 3300053737 | Bacteria | 20015 |
| 566 | Ga0500661_005887 | 3300055283 | Bacteria | 2286 |
| 567 | Ga0501082_0254233 | 3300060353 | Bacteria | 1529 |
| 568 | Ga0501082_0305812 | 3300060353 | Bacteria | 1385 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026075 | Ga0207708_10104812 | Ga0207708_101048121 | 168 |
| 2 | 3300005844 | Ga0068862_100088409 | Ga0068862_1000884093 | 169 |
| 3 | 3300028380 | Ga0268265_10124676 | Ga0268265_101246763 | 169 |
| 4 | 3300046615 | Ga0495656_0319067 | Ga0495656_0319067_59_652 | 171 |
| 5 | 3300028800 | Ga0265338_10022804 | Ga0265338_100228045 | 172 |
| 6 | 3300044735 | Ga0466968_0129873 | Ga0466968_0129873_131_727 | 173 |
| 7 | 3300048903 | Ga0496100_0118101 | Ga0496100_0118101_1283_1837 | 178 |
| 8 | 3300005937 | Ga0081455_10000086 | Ga0081455_1000008629 | 179 |
| 9 | 3300006844 | Ga0075428_100699522 | Ga0075428_1006995222 | 179 |
| 10 | 3300009094 | Ga0111539_10016218 | Ga0111539_100162189 | 179 |
| 11 | 3300050511 | nmdc:mga08y16_4733_c1 | nmdc:mga08y16_4733_c1_2415_3044 | 179 |
| 12 | 3300005328 | Ga0070676_10313696 | Ga0070676_103136962 | 183 |
| 13 | 3300005841 | Ga0068863_100125930 | Ga0068863_1001259302 | 183 |
| 14 | 3300006880 | Ga0075429_100325787 | Ga0075429_1003257872 | 183 |
| 15 | 3300021361 | Ga0213872_10087414 | Ga0213872_100874142 | 183 |
| 16 | 3300021384 | Ga0213876_10267544 | Ga0213876_102675441 | 183 |
| 17 | 3300025907 | Ga0207645_10510000 | Ga0207645_105100001 | 183 |
| 18 | 3300026088 | Ga0207641_10106892 | Ga0207641_101068922 | 183 |
| 19 | 3300028563 | Ga0265319_1051150 | Ga0265319_10511502 | 183 |
| 20 | 3300028573 | Ga0265334_10006729 | Ga0265334_100067293 | 183 |
| 21 | 3300028800 | Ga0265338_10026523 | Ga0265338_100265233 | 183 |
| 22 | 3300028800 | Ga0265338_10083442 | Ga0265338_100834422 | 183 |
| 23 | 3300028800 | Ga0265338_10094210 | Ga0265338_100942102 | 183 |
| 24 | 3300031240 | Ga0265320_10115032 | Ga0265320_101150321 | 183 |
| 25 | 3300031251 | Ga0265327_10074629 | Ga0265327_100746292 | 183 |
| 26 | 3300035692 | Ga0373935_0303963 | Ga0373935_0303963_228_821 | 183 |
| 27 | 3300037466 | Ga0395898_0198937 | Ga0395898_0198937_935_1534 | 183 |
| 28 | 3300039062 | Ga0400483_118604 | Ga0400483_118604_449_1018 | 183 |
| 29 | 3300039062 | Ga0400483_156125 | Ga0400483_156125_503_1096 | 183 |
| 30 | 3300039438 | Ga0436360_1213167 | Ga0436360_1213167_77_670 | 183 |
| 31 | 3300039447 | Ga0436361_0552255 | Ga0436361_0552255_120_719 | 183 |
| 32 | 3300039447 | Ga0436361_0805306 | Ga0436361_0805306_2202_2801 | 183 |
| 33 | 3300039453 | Ga0436362_1067038 | Ga0436362_1067038_354_947 | 183 |
| 34 | 3300044683 | Ga0466965_0035434 | Ga0466965_0035434_1207_1800 | 183 |
| 35 | 3300045049 | Ga0466959_0057334 | Ga0466959_0057334_1607_2200 | 183 |
| 36 | 3300046455 | Ga0495603_0045503 | Ga0495603_0045503_398_955 | 183 |
| 37 | 3300046457 | Ga0495590_0046319 | Ga0495590_0046319_52_609 | 183 |
| 38 | 3300046516 | Ga0495628_0174794 | Ga0495628_0174794_741_1307 | 183 |
| 39 | 3300046517 | Ga0495630_0035846 | Ga0495630_0035846_3004_3570 | 183 |
| 40 | 3300046528 | Ga0495642_0053360 | Ga0495642_0053360_260_817 | 183 |
| 41 | 3300046529 | Ga0495652_0216450 | Ga0495652_0216450_536_1126 | 183 |
| 42 | 3300046557 | Ga0495622_0000699 | Ga0495622_0000699_16102_16659 | 183 |
| 43 | 3300046557 | Ga0495622_0108540 | Ga0495622_0108540_441_1007 | 183 |
| 44 | 3300046557 | Ga0495622_0172696 | Ga0495622_0172696_27_587 | 183 |
| 45 | 3300046616 | Ga0495668_0092934 | Ga0495668_0092934_410_967 | 183 |
| 46 | 3300046683 | Ga0495658_0397585 | Ga0495658_0397585_229_786 | 183 |
| 47 | 3300047320 | Ga0495672_0007741 | Ga0495672_0007741_3198_3755 | 183 |
| 48 | 3300048909 | Ga0496106_0349625 | Ga0496106_0349625_374_964 | 183 |
| 49 | 3300048910 | Ga0496107_0071425 | Ga0496107_0071425_345_935 | 183 |
| 50 | 3300048918 | Ga0496115_0231656 | Ga0496115_0231656_122_712 | 183 |
| 51 | 3300048918 | Ga0496115_0627416 | Ga0496115_0627416_40_636 | 183 |
| 52 | 3300049581 | Ga0501047_0957430 | Ga0501047_0957430_23_625 | 183 |
| 53 | 3300053087 | Ga0500643_008375 | Ga0500643_008375_1437_2030 | 183 |
| 54 | 3300053103 | Ga0500555_051460 | Ga0500555_051460_411_1004 | 183 |
| 55 | 3300053119 | Ga0500595_045758 | Ga0500595_045758_632_1189 | 183 |
| 56 | 3300053133 | Ga0500655_004973 | Ga0500655_004973_592_1149 | 183 |
| 57 | 3300053178 | Ga0500637_0002010 | Ga0500637_0002010_1645_2202 | 183 |
| 58 | 3300013308 | Ga0157375_10371631 | Ga0157375_103716311 | 184 |
| 59 | 3300014326 | Ga0157380_10294294 | Ga0157380_102942942 | 184 |
| 60 | 3300039062 | Ga0400483_075974 | Ga0400483_075974_2210_2773 | 184 |
| 61 | 3300039062 | Ga0400483_085672 | Ga0400483_085672_1040_1606 | 184 |
| 62 | 3300039062 | Ga0400483_115380 | Ga0400483_115380_853_1416 | 184 |
| 63 | 3300039062 | Ga0400483_216717 | Ga0400483_216717_622_1215 | 184 |
| 64 | 3300039062 | Ga0400483_238163 | Ga0400483_238163_395_961 | 184 |
| 65 | 3300046520 | Ga0495637_0146650 | Ga0495637_0146650_26_649 | 184 |
| 66 | 3300047320 | Ga0495672_0298362 | Ga0495672_0298362_20_655 | 184 |
| 67 | 3300049570 | Ga0501033_0019157 | Ga0501033_0019157_1258_1863 | 184 |
| 68 | 3300049571 | Ga0501034_0024474 | Ga0501034_0024474_5395_6000 | 184 |
| 69 | 3300049573 | Ga0501037_0005289 | Ga0501037_0005289_7884_8489 | 184 |
| 70 | 3300049576 | Ga0501040_0867520 | Ga0501040_0867520_26_601 | 184 |
| 71 | 3300049577 | Ga0501041_0293562 | Ga0501041_0293562_393_956 | 184 |
| 72 | 3300049581 | Ga0501047_0358203 | Ga0501047_0358203_641_1246 | 184 |
| 73 | 3300049822 | Ga0501035_0243868 | Ga0501035_0243868_306_911 | 184 |
| 74 | 3300049823 | Ga0501044_0135164 | Ga0501044_0135164_1833_2438 | 184 |
| 75 | 3300050491 | nmdc:mga00v17_17467_c1 | nmdc:mga00v17_17467_c1_2287_2847 | 184 |
| 76 | 3300006852 | Ga0075433_10188624 | Ga0075433_101886242 | 185 |
| 77 | 3300048905 | Ga0496102_0605867 | Ga0496102_0605867_184_744 | 185 |
| 78 | 3300053098 | Ga0500650_0163777 | Ga0500650_0163777_407_976 | 185 |
| 79 | 3300005578 | Ga0068854_101011280 | Ga0068854_1010112801 | 187 |
| 80 | 3300009093 | Ga0105240_10002871 | Ga0105240_100028715 | 187 |
| 81 | 3300009551 | Ga0105238_10005018 | Ga0105238_1000501811 | 187 |
| 82 | 3300010375 | Ga0105239_10296140 | Ga0105239_102961403 | 187 |
| 83 | 3300020082 | Ga0206353_11573899 | Ga0206353_115738991 | 187 |
| 84 | 3300025321 | Ga0207656_10016053 | Ga0207656_100160533 | 187 |
| 85 | 3300035241 | Ga0373961_0242858 | Ga0373961_0242858_40_612 | 187 |
| 86 | 3300035695 | Ga0373927_0001984 | Ga0373927_0001984_3508_4071 | 187 |
| 87 | 3300035724 | Ga0373933_0000038 | Ga0373933_0000038_70635_71198 | 187 |
| 88 | 3300036401 | Ga0373937_0231953 | Ga0373937_0231953_50_634 | 187 |
| 89 | 3300039437 | Ga0436365_0365623 | Ga0436365_0365623_17898_18464 | 187 |
| 90 | 3300039437 | Ga0436365_1902327 | Ga0436365_1902327_306_878 | 187 |
| 91 | 3300039438 | Ga0436360_0753528 | Ga0436360_0753528_57_623 | 187 |
| 92 | 3300039450 | Ga0436363_1007251 | Ga0436363_1007251_248_814 | 187 |
| 93 | 3300039453 | Ga0436362_0272811 | Ga0436362_0272811_298_864 | 187 |
| 94 | 3300045976 | Ga0466967_0606679 | Ga0466967_0606679_198_761 | 187 |
| 95 | 3300046462 | Ga0495651_0666486 | Ga0495651_0666486_45_629 | 187 |
| 96 | 3300046507 | Ga0495606_0192703 | Ga0495606_0192703_23_586 | 187 |
| 97 | 3300046518 | Ga0495631_0098170 | Ga0495631_0098170_688_1251 | 187 |
| 98 | 3300046524 | Ga0495648_0169772 | Ga0495648_0169772_50_613 | 187 |
| 99 | 3300046530 | Ga0495654_0117540 | Ga0495654_0117540_30_593 | 187 |
| 100 | 3300046660 | Ga0495625_0526427 | Ga0495625_0526427_21_584 | 187 |
| 101 | 3300046689 | Ga0495613_0473520 | Ga0495613_0473520_52_615 | 187 |
| 102 | 3300048905 | Ga0496102_1026283 | Ga0496102_1026283_24_596 | 187 |
| 103 | 3300050511 | nmdc:mga08y16_125828_c1 | nmdc:mga08y16_125828_c1_2078_2650 | 187 |
| 104 | 3300050515 | nmdc:mga0a205_891617_c1 | nmdc:mga0a205_891617_c1_137_709 | 187 |
| 105 | 3300053079 | Ga0500610_0355241 | Ga0500610_0355241_31_594 | 187 |
| 106 | 3300053130 | Ga0500642_0010822 | Ga0500642_0010822_32_595 | 187 |
| 107 | 3300053134 | Ga0500658_0420634 | Ga0500658_0420634_20_583 | 187 |
| 108 | iso_pu_bacteria | 2854681122 | 2854681172 | 187 |
| 109 | iso_pu_bacteria | 3000017691 | 3000020693 | 187 |
| 110 | iso_pu_bacteria | 2899259804 | 2899260895 | 188 |
| 111 | 3300009147 | Ga0114129_10542625 | Ga0114129_105426251 | 189 |
| 112 | 3300050507 | nmdc:mga05p37_541177_c1 | nmdc:mga05p37_541177_c1_31_666 | 189 |
| 113 | iso_pu_bacteria | 2898795034 | 2898795676 | 189 |
| 114 | iso_pu_bacteria | 2834578030 | 2834578240 | 190 |
| 115 | iso_pu_bacteria | 2919679072 | 2919680417 | 190 |
| 116 | iso_pu_bacteria | 3000405567 | 3000408205 | 190 |
| 117 | 3300006051 | Ga0075364_10039975 | Ga0075364_100399751 | 191 |
| 118 | 3300046462 | Ga0495651_0233019 | Ga0495651_0233019_614_1243 | 191 |
| 119 | 3300049589 | Ga0501073_0504863 | Ga0501073_0504863_58_642 | 191 |
| 120 | iso_pu_bacteria | 2713897090 | 2715498755 | 191 |
| 121 | iso_pu_bacteria | 2836160341 | 2836163271 | 191 |
| 122 | iso_pu_bacteria | 2855020534 | 2855021251 | 191 |
| 123 | iso_pu_bacteria | 2899275550 | 2899279114 | 191 |
| 124 | iso_pu_bacteria | 8057132660 | 8057135055 | 191 |
| 125 | 3300032133 | Ga0316583_10047508 | Ga0316583_100475081 | 192 |
| 126 | 3300031727 | Ga0316576_10008259 | Ga0316576_100082592 | 193 |
| 127 | 3300037068 | Ga0373925_0417112 | Ga0373925_0417112_337_924 | 193 |
| 128 | 3300039062 | Ga0400483_080646 | Ga0400483_080646_10228_10812 | 193 |
| 129 | 3300039062 | Ga0400483_114150 | Ga0400483_114150_1150_1749 | 193 |
| 130 | 3300039062 | Ga0400483_212347 | Ga0400483_212347_943_1533 | 193 |
| 131 | 3300039062 | Ga0400483_229872 | Ga0400483_229872_1327_1911 | 193 |
| 132 | 3300039062 | Ga0400483_242397 | Ga0400483_242397_497_1096 | 193 |
| 133 | 3300049571 | Ga0501034_0000413 | Ga0501034_0000413_38382_38981 | 193 |
| 134 | 3300049575 | Ga0501039_0488441 | Ga0501039_0488441_296_886 | 193 |
| 135 | 3300049587 | Ga0501071_0661671 | Ga0501071_0661671_189_779 | 193 |
| 136 | 3300049588 | Ga0501072_0340796 | Ga0501072_0340796_96_686 | 193 |
| 137 | 3300049591 | Ga0501075_0373526 | Ga0501075_0373526_23_613 | 193 |
| 138 | 3300003911 | JGI25405J52794_10074805 | JGI25405J52794_100748051 | 194 |
| 139 | 3300005937 | Ga0081455_10002017 | Ga0081455_100020178 | 194 |
| 140 | 3300005937 | Ga0081455_10058037 | Ga0081455_100580374 | 194 |
| 141 | 3300006028 | Ga0070717_11080557 | Ga0070717_110805571 | 195 |
| 142 | 3300039437 | Ga0436365_0434683 | Ga0436365_0434683_108_695 | 195 |
| 143 | 3300031824 | Ga0307413_10185353 | Ga0307413_101853532 | 196 |
| 144 | 3300031852 | Ga0307410_10236883 | Ga0307410_102368833 | 196 |
| 145 | 3300031995 | Ga0307409_100073567 | Ga0307409_1000735674 | 196 |
| 146 | 3300032002 | Ga0307416_100126903 | Ga0307416_1001269032 | 196 |
| 147 | 3300032005 | Ga0307411_10028563 | Ga0307411_100285634 | 196 |
| 148 | 3300032126 | Ga0307415_100183628 | Ga0307415_1001836282 | 196 |
| 149 | 3300037853 | Ga0436364_0531241 | Ga0436364_0531241_76_669 | 196 |
| 150 | 3300026088 | Ga0207641_10512830 | Ga0207641_105128302 | 197 |
| 151 | 3300028800 | Ga0265338_10026178 | Ga0265338_100261786 | 197 |
| 152 | 3300032002 | Ga0307416_101039223 | Ga0307416_1010392232 | 197 |
| 153 | 3300032002 | Ga0307416_101174244 | Ga0307416_1011742441 | 197 |
| 154 | 3300049568 | Ga0501031_0022736 | Ga0501031_0022736_3293_3901 | 197 |
| 155 | 3300049569 | Ga0501032_0000119 | Ga0501032_0000119_46058_46666 | 197 |
| 156 | 3300049570 | Ga0501033_0015916 | Ga0501033_0015916_143_751 | 197 |
| 157 | 3300049571 | Ga0501034_0001333 | Ga0501034_0001333_14368_14976 | 197 |
| 158 | 3300049571 | Ga0501034_0045102 | Ga0501034_0045102_3082_3693 | 197 |
| 159 | 3300049572 | Ga0501036_0000614 | Ga0501036_0000614_143_751 | 197 |
| 160 | 3300049573 | Ga0501037_0000288 | Ga0501037_0000288_130_738 | 197 |
| 161 | 3300049574 | Ga0501038_0000046 | Ga0501038_0000046_18255_18863 | 197 |
| 162 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_8765_9373 | 197 |
| 163 | 3300049577 | Ga0501041_0551734 | Ga0501041_0551734_32_640 | 197 |
| 164 | 3300049579 | Ga0501043_0000051 | Ga0501043_0000051_106187_106795 | 197 |
| 165 | 3300049580 | Ga0501046_0452338 | Ga0501046_0452338_197_805 | 197 |
| 166 | 3300049581 | Ga0501047_0615906 | Ga0501047_0615906_120_728 | 197 |
| 167 | 3300049822 | Ga0501035_0000102 | Ga0501035_0000102_161_769 | 197 |
| 168 | 3300049823 | Ga0501044_0001230 | Ga0501044_0001230_27411_28019 | 197 |
| 169 | 3300005347 | Ga0070668_100011847 | Ga0070668_1000118472 | 198 |
| 170 | 3300005617 | Ga0068859_100133756 | Ga0068859_1001337562 | 198 |
| 171 | 3300006931 | Ga0097620_100133751 | Ga0097620_1001337512 | 198 |
| 172 | 3300025949 | Ga0207667_10231534 | Ga0207667_102315342 | 198 |
| 173 | 3300025972 | Ga0207668_10015251 | Ga0207668_100152512 | 198 |
| 174 | 3300039450 | Ga0436363_1378300 | Ga0436363_1378300_2230_2826 | 198 |
| 175 | 3300045051 | Ga0451576_0001020 | Ga0451576_0001020_18871_19479 | 198 |
| 176 | 3300005549 | Ga0070704_100169462 | Ga0070704_1001694623 | 199 |
| 177 | 3300005615 | Ga0070702_100224953 | Ga0070702_1002249532 | 199 |
| 178 | 3300011119 | Ga0105246_10056523 | Ga0105246_100565233 | 199 |
| 179 | 3300014969 | Ga0157376_10675816 | Ga0157376_106758161 | 199 |
| 180 | 3300025932 | Ga0207690_10003499 | Ga0207690_100034997 | 199 |
| 181 | 3300026041 | Ga0207639_10029266 | Ga0207639_100292662 | 199 |
| 182 | 3300026067 | Ga0207678_10108119 | Ga0207678_101081192 | 199 |
| 183 | 3300037312 | Ga0395899_0000026 | Ga0395899_0000026_302715_303401 | 199 |
| 184 | 3300048924 | Ga0496121_0451774 | Ga0496121_0451774_154_774 | 199 |
| 185 | 3300049571 | Ga0501034_0031661 | Ga0501034_0031661_4551_5177 | 199 |
| 186 | 3300053104 | Ga0500556_0000326 | Ga0500556_0000326_14929_15552 | 199 |
| 187 | 3300053153 | Ga0500616_0002793 | Ga0500616_0002793_1176_1799 | 199 |
| 188 | iso_pu_bacteria | 2840878972 | 2840881608 | 199 |
| 189 | 3300009147 | Ga0114129_10173299 | Ga0114129_101732994 | 200 |
| 190 | 3300039437 | Ga0436365_0711553 | Ga0436365_0711553_73815_74477 | 200 |
| 191 | 3300039450 | Ga0436363_0149506 | Ga0436363_0149506_1389_2051 | 200 |
| 192 | 3300050507 | nmdc:mga05p37_329011_c1 | nmdc:mga05p37_329011_c1_584_1195 | 200 |
| 193 | 3300050510 | nmdc:mga06r32_61080_c1 | nmdc:mga06r32_61080_c1_639_1250 | 200 |
| 194 | iso_pu_bacteria | 2513237094 | 2513637092 | 200 |
| 195 | iso_pu_bacteria | 2513237095 | 2513652525 | 200 |
| 196 | iso_pu_bacteria | 2513237102 | 2513705958 | 200 |
| 197 | iso_pu_bacteria | 2513237161 | 2514012296 | 200 |
| 198 | iso_pu_bacteria | 2517093001 | 2517104794 | 200 |
| 199 | iso_pu_bacteria | 2528768022 | 2528855363 | 200 |
| 200 | iso_pu_bacteria | 2617270741 | 2617373121 | 200 |
| 201 | iso_pu_bacteria | 2791355196 | 2793061266 | 200 |
| 202 | iso_pu_bacteria | 2802429603 | 2805918639 | 200 |
| 203 | iso_pu_bacteria | 2816332527 | 2818236975 | 200 |
| 204 | iso_pu_bacteria | 2824617872 | 2824625792 | 200 |
| 205 | iso_pu_bacteria | 2824626560 | 2824633810 | 200 |
| 206 | iso_pu_bacteria | 2824635225 | 2824642189 | 200 |
| 207 | iso_pu_bacteria | 2824644064 | 2824649593 | 200 |
| 208 | iso_pu_bacteria | 2824661429 | 2824670340 | 200 |
| 209 | iso_pu_bacteria | 2824671348 | 2824678120 | 200 |
| 210 | iso_pu_bacteria | 2824679649 | 2824686634 | 200 |
| 211 | iso_pu_bacteria | 2824687955 | 2824694248 | 200 |
| 212 | iso_pu_bacteria | 2824696289 | 2824703078 | 200 |
| 213 | iso_pu_bacteria | 2824704595 | 2824711776 | 200 |
| 214 | iso_pu_bacteria | 2824714736 | 2824719552 | 200 |
| 215 | iso_pu_bacteria | 2824723954 | 2824729981 | 200 |
| 216 | iso_pu_bacteria | 2824732956 | 2824739101 | 200 |
| 217 | iso_pu_bacteria | 2824746037 | 2824751974 | 200 |
| 218 | iso_pu_bacteria | 2824753945 | 2824763105 | 200 |
| 219 | iso_pu_bacteria | 2824763712 | 2824772895 | 200 |
| 220 | iso_pu_bacteria | 2824773399 | 2824779681 | 200 |
| 221 | iso_pu_bacteria | 2838122688 | 2838127123 | 200 |
| 222 | iso_pu_bacteria | 2841941048 | 2841947360 | 200 |
| 223 | iso_pu_bacteria | 2841949485 | 2841955851 | 200 |
| 224 | iso_pu_bacteria | 2841957949 | 2841961702 | 200 |
| 225 | iso_pu_bacteria | 2841966195 | 2841974316 | 200 |
| 226 | iso_pu_bacteria | 2841974524 | 2841981024 | 200 |
| 227 | iso_pu_bacteria | 2841983080 | 2841987223 | 200 |
| 228 | iso_pu_bacteria | 2842038055 | 2842041147 | 200 |
| 229 | iso_pu_bacteria | 2842045827 | 2842045908 | 200 |
| 230 | iso_pu_bacteria | 2844315083 | 2844320395 | 200 |
| 231 | iso_pu_bacteria | 2847939898 | 2847948164 | 200 |
| 232 | iso_pu_bacteria | 2849076700 | 2849077928 | 200 |
| 233 | iso_pu_bacteria | 2874620515 | 2874625740 | 200 |
| 234 | iso_pu_bacteria | 2874628541 | 2874632920 | 200 |
| 235 | iso_pu_bacteria | 2879099564 | 2879105408 | 200 |
| 236 | iso_pu_bacteria | 2881364244 | 2881370348 | 200 |
| 237 | iso_pu_bacteria | 2885366525 | 2885368356 | 200 |
| 238 | iso_pu_bacteria | 2888378607 | 2888385900 | 200 |
| 239 | iso_pu_bacteria | 2903727486 | 2903732944 | 200 |
| 240 | iso_pu_bacteria | 2904666416 | 2904673899 | 200 |
| 241 | iso_pu_bacteria | 2904711408 | 2904711491 | 200 |
| 242 | iso_pu_bacteria | 2906602504 | 2906607276 | 200 |
| 243 | iso_pu_bacteria | 2906626472 | 2906630215 | 200 |
| 244 | iso_pu_bacteria | 2908775508 | 2908781573 | 200 |
| 245 | iso_pu_bacteria | 2922368715 | 2922376208 | 200 |
| 246 | iso_pu_bacteria | 2922393267 | 2922393588 | 200 |
| 247 | iso_pu_bacteria | 2929615660 | 2929622986 | 200 |
| 248 | iso_pu_bacteria | 2929624759 | 2929631581 | 200 |
| 249 | iso_pu_bacteria | 2932784394 | 2932789371 | 200 |
| 250 | iso_pu_bacteria | 2932794094 | 2932797713 | 200 |
| 251 | iso_pu_bacteria | 2932801729 | 2932804231 | 200 |
| 252 | iso_pu_bacteria | 2932809354 | 2932816417 | 200 |
| 253 | iso_pu_bacteria | 2932818245 | 2932822000 | 200 |
| 254 | iso_pu_bacteria | 2932828146 | 2932831978 | 200 |
| 255 | iso_pu_bacteria | 2933577622 | 2933584810 | 200 |
| 256 | iso_pu_bacteria | 2935616580 | 2935621917 | 200 |
| 257 | iso_pu_bacteria | 2935638405 | 2935644074 | 200 |
| 258 | iso_pu_bacteria | 2935665750 | 2935669012 | 200 |
| 259 | iso_pu_bacteria | 2935675223 | 2935683686 | 200 |
| 260 | iso_pu_bacteria | 2935684952 | 2935692374 | 200 |
| 261 | iso_pu_bacteria | 2935694250 | 2935700458 | 200 |
| 262 | iso_pu_bacteria | 2935703347 | 2935708914 | 200 |
| 263 | iso_pu_bacteria | 2935713505 | 2935720388 | 200 |
| 264 | iso_pu_bacteria | 2935722832 | 2935729669 | 200 |
| 265 | iso_pu_bacteria | 2935732158 | 2935739349 | 200 |
| 266 | iso_pu_bacteria | 2935741537 | 2935748110 | 200 |
| 267 | iso_pu_bacteria | 2935750917 | 2935758313 | 200 |
| 268 | iso_pu_bacteria | 2935760218 | 2935767392 | 200 |
| 269 | iso_pu_bacteria | 2935777560 | 2935781291 | 200 |
| 270 | iso_pu_bacteria | 2935801545 | 2935805728 | 200 |
| 271 | iso_pu_bacteria | 2935810662 | 2935815716 | 200 |
| 272 | iso_pu_bacteria | 2935827899 | 2935833325 | 200 |
| 273 | iso_pu_bacteria | 2935837841 | 2935842028 | 200 |
| 274 | iso_pu_bacteria | 2935855204 | 2935860164 | 200 |
| 275 | iso_pu_bacteria | 2935864058 | 2935867560 | 200 |
| 276 | iso_pu_bacteria | 2935873716 | 2935878629 | 200 |
| 277 | iso_pu_bacteria | 2935883170 | 2935890412 | 200 |
| 278 | iso_pu_bacteria | 2935959822 | 2935965239 | 200 |
| 279 | iso_pu_bacteria | 2935992306 | 2935998093 | 200 |
| 280 | iso_pu_bacteria | 2936002035 | 2936006794 | 200 |
| 281 | iso_pu_bacteria | 2936037263 | 2936040954 | 200 |
| 282 | iso_pu_bacteria | 2940556831 | 2940564217 | 200 |
| 283 | iso_pu_bacteria | 2941538514 | 2941546579 | 200 |
| 284 | iso_pu_bacteria | 3005483717 | 3005486209 | 200 |
| 285 | iso_pu_bacteria | 3005587118 | 3005588474 | 200 |
| 286 | iso_pu_bacteria | 3005710791 | 3005716189 | 200 |
| 287 | iso_pu_bacteria | 3005718088 | 3005723564 | 200 |
| 288 | iso_pu_bacteria | 8016511872 | 8016520198 | 200 |
| 289 | iso_pu_bacteria | 8016522445 | 8016528103 | 200 |
| 290 | iso_pu_bacteria | 8016530956 | 8016533233 | 200 |
| 291 | iso_pu_bacteria | 8016539877 | 8016546472 | 200 |
| 292 | iso_pu_bacteria | 8016557553 | 8016564009 | 200 |
| 293 | iso_pu_bacteria | 8016566248 | 8016571555 | 200 |
| 294 | iso_pu_bacteria | 8016575299 | 8016575802 | 200 |
| 295 | iso_pu_bacteria | 8016595262 | 8016601720 | 200 |
| 296 | iso_pu_bacteria | 8016613128 | 8016616332 | 200 |
| 297 | iso_pu_bacteria | 8016622563 | 8016624803 | 200 |
| 298 | iso_pu_bacteria | 8017057580 | 8017065363 | 200 |
| 299 | iso_pu_bacteria | 8019530166 | 8019533025 | 200 |
| 300 | iso_pu_bacteria | 8019538911 | 8019546824 | 200 |
| 301 | iso_pu_bacteria | 8019547302 | 8019551846 | 200 |
| 302 | iso_pu_bacteria | 8019576017 | 8019584749 | 200 |
| 303 | iso_pu_bacteria | 8019597564 | 8019598754 | 200 |
| 304 | iso_pu_bacteria | 8019608314 | 8019609620 | 200 |
| 305 | iso_pu_bacteria | 8019648815 | 8019655653 | 200 |
| 306 | iso_pu_bacteria | 8055742211 | 8055744652 | 200 |
| 307 | 3300005937 | Ga0081455_10098227 | Ga0081455_100982273 | 201 |
| 308 | 3300006844 | Ga0075428_100495259 | Ga0075428_1004952592 | 201 |
| 309 | 3300006846 | Ga0075430_100009804 | Ga0075430_1000098049 | 201 |
| 310 | 3300006847 | Ga0075431_100005807 | Ga0075431_10000580710 | 201 |
| 311 | 3300006914 | Ga0075436_100349687 | Ga0075436_1003496872 | 201 |
| 312 | 3300021377 | Ga0213874_10103358 | Ga0213874_101033582 | 201 |
| 313 | 3300035691 | Ga0373931_0171794 | Ga0373931_0171794_48_662 | 201 |
| 314 | 3300039447 | Ga0436361_0779011 | Ga0436361_0779011_126_731 | 201 |
| 315 | 3300050507 | nmdc:mga05p37_603096_c1 | nmdc:mga05p37_603096_c1_494_1111 | 201 |
| 316 | 3300050507 | nmdc:mga05p37_85288_c1 | nmdc:mga05p37_85288_c1_2909_3523 | 201 |
| 317 | 3300050508 | nmdc:mga09592_502459_c1 | nmdc:mga09592_502459_c1_310_927 | 201 |
| 318 | 3300050509 | nmdc:mga0qj67_107560_c1 | nmdc:mga0qj67_107560_c1_997_1614 | 201 |
| 319 | 3300050512 | nmdc:mga0n895_146074_c1 | nmdc:mga0n895_146074_c1_419_1033 | 201 |
| 320 | 3300050514 | nmdc:mga08x19_518073_c1 | nmdc:mga08x19_518073_c1_163_777 | 201 |
| 321 | iso_pu_bacteria | 2513237104 | 2513719093 | 201 |
| 322 | iso_pu_bacteria | 2906643746 | 2906651279 | 201 |
| 323 | 3300005336 | Ga0070680_100035084 | Ga0070680_1000350844 | 203 |
| 324 | 3300005434 | Ga0070709_10004640 | Ga0070709_100046404 | 203 |
| 325 | 3300005435 | Ga0070714_100125504 | Ga0070714_1001255042 | 203 |
| 326 | 3300005436 | Ga0070713_100621165 | Ga0070713_1006211652 | 203 |
| 327 | 3300005437 | Ga0070710_10000534 | Ga0070710_1000053418 | 203 |
| 328 | 3300005439 | Ga0070711_100000548 | Ga0070711_1000005484 | 203 |
| 329 | 3300005530 | Ga0070679_100203108 | Ga0070679_1002031082 | 203 |
| 330 | 3300005563 | Ga0068855_100200177 | Ga0068855_1002001773 | 203 |
| 331 | 3300005614 | Ga0068856_100058718 | Ga0068856_1000587183 | 203 |
| 332 | 3300005616 | Ga0068852_100010119 | Ga0068852_1000101193 | 203 |
| 333 | 3300005983 | Ga0081540_1069864 | Ga0081540_10698642 | 203 |
| 334 | 3300006028 | Ga0070717_10088384 | Ga0070717_100883843 | 203 |
| 335 | 3300006175 | Ga0070712_100205525 | Ga0070712_1002055252 | 203 |
| 336 | 3300006852 | Ga0075433_10000513 | Ga0075433_1000051321 | 203 |
| 337 | 3300009551 | Ga0105238_10560970 | Ga0105238_105609702 | 203 |
| 338 | 3300021358 | Ga0213873_10018929 | Ga0213873_100189292 | 203 |
| 339 | 3300021384 | Ga0213876_10069397 | Ga0213876_100693973 | 203 |
| 340 | 3300025898 | Ga0207692_10000091 | Ga0207692_1000009118 | 203 |
| 341 | 3300025906 | Ga0207699_10000782 | Ga0207699_1000078216 | 203 |
| 342 | 3300025915 | Ga0207693_10029076 | Ga0207693_100290765 | 203 |
| 343 | 3300025916 | Ga0207663_10047322 | Ga0207663_100473222 | 203 |
| 344 | 3300025917 | Ga0207660_10048097 | Ga0207660_100480973 | 203 |
| 345 | 3300025924 | Ga0207694_10266785 | Ga0207694_102667853 | 203 |
| 346 | 3300025928 | Ga0207700_10018197 | Ga0207700_100181974 | 203 |
| 347 | 3300025929 | Ga0207664_10023054 | Ga0207664_100230544 | 203 |
| 348 | 3300025949 | Ga0207667_10050013 | Ga0207667_100500132 | 203 |
| 349 | 3300026041 | Ga0207639_11000265 | Ga0207639_110002651 | 203 |
| 350 | 3300026078 | Ga0207702_10579719 | Ga0207702_105797192 | 203 |
| 351 | 3300027907 | Ga0207428_10221335 | Ga0207428_102213352 | 203 |
| 352 | 3300035085 | Ga0373929_0059958 | Ga0373929_0059958_215_853 | 203 |
| 353 | 3300035088 | Ga0373940_0008127 | Ga0373940_0008127_646_1284 | 203 |
| 354 | 3300035112 | Ga0373932_0003500 | Ga0373932_0003500_1375_2013 | 203 |
| 355 | 3300035121 | Ga0373960_0080014 | Ga0373960_0080014_19_657 | 203 |
| 356 | 3300035691 | Ga0373931_0000351 | Ga0373931_0000351_2606_3244 | 203 |
| 357 | 3300046507 | Ga0495606_0053725 | Ga0495606_0053725_1217_1834 | 203 |
| 358 | 3300050511 | nmdc:mga08y16_95603_c1 | nmdc:mga08y16_95603_c1_632_1270 | 203 |
| 359 | 3300050512 | nmdc:mga0n895_567399_c1 | nmdc:mga0n895_567399_c1_113_751 | 203 |
| 360 | 3300050515 | nmdc:mga0a205_10887_c1 | nmdc:mga0a205_10887_c1_2075_2713 | 203 |
| 361 | 3300060353 | Ga0501082_0254233 | Ga0501082_0254233_717_1346 | 203 |
| 362 | 3300060353 | Ga0501082_0305812 | Ga0501082_0305812_461_1087 | 203 |
| 363 | 3300003214 | JGI25165J46597_1005214 | JGI25165J46597_10052143 | 204 |
| 364 | 3300003215 | JGI25153J46596_10002451 | JGI25153J46596_100024514 | 204 |
| 365 | 3300003215 | JGI25153J46596_10019495 | JGI25153J46596_100194953 | 204 |
| 366 | 3300003215 | JGI25153J46596_10021561 | JGI25153J46596_100215613 | 204 |
| 367 | 3300003215 | JGI25153J46596_10052238 | JGI25153J46596_100522381 | 204 |
| 368 | 3300003354 | JGI25160J50197_1000862 | JGI25160J50197_100086215 | 204 |
| 369 | 3300003354 | JGI25160J50197_1001471 | JGI25160J50197_100147110 | 204 |
| 370 | 3300003762 | Ga0055542_1003091 | Ga0055542_10030914 | 204 |
| 371 | 3300004625 | Ga0055543_1004845 | Ga0055543_10048454 | 204 |
| 372 | 3300005262 | Ga0065165_1002362 | Ga0065165_10023626 | 204 |
| 373 | 3300005262 | Ga0065165_1006702 | Ga0065165_10067023 | 204 |
| 374 | 3300005329 | Ga0070683_100069621 | Ga0070683_1000696212 | 204 |
| 375 | 3300005336 | Ga0070680_100012456 | Ga0070680_1000124566 | 204 |
| 376 | 3300005339 | Ga0070660_100023176 | Ga0070660_1000231764 | 204 |
| 377 | 3300005347 | Ga0070668_100006917 | Ga0070668_1000069172 | 204 |
| 378 | 3300005347 | Ga0070668_100075380 | Ga0070668_1000753804 | 204 |
| 379 | 3300005355 | Ga0070671_100023510 | Ga0070671_1000235103 | 204 |
| 380 | 3300005367 | Ga0070667_100043976 | Ga0070667_1000439761 | 204 |
| 381 | 3300005444 | Ga0070694_100031808 | Ga0070694_1000318083 | 204 |
| 382 | 3300005455 | Ga0070663_100024485 | Ga0070663_1000244853 | 204 |
| 383 | 3300005455 | Ga0070663_100342056 | Ga0070663_1003420562 | 204 |
| 384 | 3300005458 | Ga0070681_10013695 | Ga0070681_100136956 | 204 |
| 385 | 3300005459 | Ga0068867_100696245 | Ga0068867_1006962452 | 204 |
| 386 | 3300005530 | Ga0070679_100091249 | Ga0070679_1000912493 | 204 |
| 387 | 3300005535 | Ga0070684_100032160 | Ga0070684_1000321603 | 204 |
| 388 | 3300005539 | Ga0068853_100022837 | Ga0068853_1000228374 | 204 |
| 389 | 3300005539 | Ga0068853_100286902 | Ga0068853_1002869023 | 204 |
| 390 | 3300005545 | Ga0070695_100035976 | Ga0070695_1000359763 | 204 |
| 391 | 3300005547 | Ga0070693_100105285 | Ga0070693_1001052852 | 204 |
| 392 | 3300005548 | Ga0070665_100245353 | Ga0070665_1002453532 | 204 |
| 393 | 3300005563 | Ga0068855_100056975 | Ga0068855_1000569753 | 204 |
| 394 | 3300005563 | Ga0068855_101271753 | Ga0068855_1012717532 | 204 |
| 395 | 3300005577 | Ga0068857_100020685 | Ga0068857_1000206855 | 204 |
| 396 | 3300005577 | Ga0068857_100228397 | Ga0068857_1002283972 | 204 |
| 397 | 3300005614 | Ga0068856_100262168 | Ga0068856_1002621682 | 204 |
| 398 | 3300005616 | Ga0068852_100137152 | Ga0068852_1001371522 | 204 |
| 399 | 3300005719 | Ga0068861_100109753 | Ga0068861_1001097532 | 204 |
| 400 | 3300005834 | Ga0068851_10054871 | Ga0068851_100548712 | 204 |
| 401 | 3300005841 | Ga0068863_100398512 | Ga0068863_1003985122 | 204 |
| 402 | 3300005842 | Ga0068858_100078600 | Ga0068858_1000786004 | 204 |
| 403 | 3300005844 | Ga0068862_100670901 | Ga0068862_1006709012 | 204 |
| 404 | 3300006038 | Ga0075365_10008203 | Ga0075365_100082035 | 204 |
| 405 | 3300006042 | Ga0075368_10008255 | Ga0075368_100082554 | 204 |
| 406 | 3300006048 | Ga0075363_100007746 | Ga0075363_1000077463 | 204 |
| 407 | 3300006048 | Ga0075363_100195103 | Ga0075363_1001951032 | 204 |
| 408 | 3300006051 | Ga0075364_10035843 | Ga0075364_100358434 | 204 |
| 409 | 3300006175 | Ga0070712_100261472 | Ga0070712_1002614722 | 204 |
| 410 | 3300006178 | Ga0075367_10113131 | Ga0075367_101131312 | 204 |
| 411 | 3300006186 | Ga0075369_10068346 | Ga0075369_100683462 | 204 |
| 412 | 3300006195 | Ga0075366_10006253 | Ga0075366_100062534 | 204 |
| 413 | 3300006195 | Ga0075366_10023086 | Ga0075366_100230864 | 204 |
| 414 | 3300006195 | Ga0075366_10446679 | Ga0075366_104466792 | 204 |
| 415 | 3300006353 | Ga0075370_10136652 | Ga0075370_101366522 | 204 |
| 416 | 3300009093 | Ga0105240_10004761 | Ga0105240_1000476118 | 204 |
| 417 | 3300009093 | Ga0105240_10007546 | Ga0105240_1000754619 | 204 |
| 418 | 3300009093 | Ga0105240_10130948 | Ga0105240_101309483 | 204 |
| 419 | 3300009101 | Ga0105247_10105210 | Ga0105247_101052102 | 204 |
| 420 | 3300009174 | Ga0105241_10177655 | Ga0105241_101776553 | 204 |
| 421 | 3300009174 | Ga0105241_10281291 | Ga0105241_102812912 | 204 |
| 422 | 3300009177 | Ga0105248_10047698 | Ga0105248_100476984 | 204 |
| 423 | 3300009545 | Ga0105237_10015590 | Ga0105237_100155902 | 204 |
| 424 | 3300009545 | Ga0105237_10028914 | Ga0105237_100289144 | 204 |
| 425 | 3300009545 | Ga0105237_10998320 | Ga0105237_109983201 | 204 |
| 426 | 3300009551 | Ga0105238_10003869 | Ga0105238_100038698 | 204 |
| 427 | 3300009551 | Ga0105238_10555258 | Ga0105238_105552582 | 204 |
| 428 | 3300009553 | Ga0105249_10446314 | Ga0105249_104463142 | 204 |
| 429 | 3300010375 | Ga0105239_10018844 | Ga0105239_100188444 | 204 |
| 430 | 3300010375 | Ga0105239_10082874 | Ga0105239_100828743 | 204 |
| 431 | 3300010375 | Ga0105239_10109682 | Ga0105239_101096823 | 204 |
| 432 | 3300010375 | Ga0105239_10148114 | Ga0105239_101481142 | 204 |
| 433 | 3300013105 | Ga0157369_10000685 | Ga0157369_100006854 | 204 |
| 434 | 3300013296 | Ga0157374_10070980 | Ga0157374_100709803 | 204 |
| 435 | 3300013308 | Ga0157375_10970152 | Ga0157375_109701521 | 204 |
| 436 | 3300014325 | Ga0163163_10143448 | Ga0163163_101434482 | 204 |
| 437 | 3300014968 | Ga0157379_10203769 | Ga0157379_102037692 | 204 |
| 438 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001355 | 204 |
| 439 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005355 | 204 |
| 440 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003409 | 204 |
| 441 | 3300021324 | Ga0214545_1035621 | Ga0214545_10356213 | 204 |
| 442 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002358 | 204 |
| 443 | 3300025253 | Ga0209677_104884 | Ga0209677_1048842 | 204 |
| 444 | 3300025254 | Ga0209148_1000654 | Ga0209148_100065424 | 204 |
| 445 | 3300025261 | Ga0209233_1001456 | Ga0209233_10014563 | 204 |
| 446 | 3300025272 | Ga0209455_1010095 | Ga0209455_10100952 | 204 |
| 447 | 3300025295 | Ga0209564_1032890 | Ga0209564_10328903 | 204 |
| 448 | 3300025297 | Ga0209758_1000320 | Ga0209758_100032082 | 204 |
| 449 | 3300025297 | Ga0209758_1001495 | Ga0209758_10014957 | 204 |
| 450 | 3300025297 | Ga0209758_1011255 | Ga0209758_10112552 | 204 |
| 451 | 3300025297 | Ga0209758_1037460 | Ga0209758_10374602 | 204 |
| 452 | 3300025297 | Ga0209758_1060429 | Ga0209758_10604292 | 204 |
| 453 | 3300025297 | Ga0209758_1060430 | Ga0209758_10604302 | 204 |
| 454 | 3300025302 | Ga0207426_1000746 | Ga0207426_100074616 | 204 |
| 455 | 3300025302 | Ga0207426_1004351 | Ga0207426_10043514 | 204 |
| 456 | 3300025304 | Ga0209257_1012298 | Ga0209257_10122984 | 204 |
| 457 | 3300025304 | Ga0209257_1038158 | Ga0209257_10381583 | 204 |
| 458 | 3300025321 | Ga0207656_10138113 | Ga0207656_101381132 | 204 |
| 459 | 3300025901 | Ga0207688_10031744 | Ga0207688_100317443 | 204 |
| 460 | 3300025904 | Ga0207647_10030422 | Ga0207647_100304223 | 204 |
| 461 | 3300025909 | Ga0207705_10032876 | Ga0207705_100328763 | 204 |
| 462 | 3300025911 | Ga0207654_10008841 | Ga0207654_100088414 | 204 |
| 463 | 3300025911 | Ga0207654_10010107 | Ga0207654_100101074 | 204 |
| 464 | 3300025912 | Ga0207707_10001881 | Ga0207707_1000188112 | 204 |
| 465 | 3300025913 | Ga0207695_10000503 | Ga0207695_1000050322 | 204 |
| 466 | 3300025913 | Ga0207695_10102221 | Ga0207695_101022213 | 204 |
| 467 | 3300025913 | Ga0207695_10302211 | Ga0207695_103022112 | 204 |
| 468 | 3300025914 | Ga0207671_10263060 | Ga0207671_102630602 | 204 |
| 469 | 3300025914 | Ga0207671_10575208 | Ga0207671_105752081 | 204 |
| 470 | 3300025915 | Ga0207693_10430565 | Ga0207693_104305651 | 204 |
| 471 | 3300025917 | Ga0207660_10005375 | Ga0207660_100053755 | 204 |
| 472 | 3300025919 | Ga0207657_10005742 | Ga0207657_100057424 | 204 |
| 473 | 3300025919 | Ga0207657_10061871 | Ga0207657_100618714 | 204 |
| 474 | 3300025920 | Ga0207649_10642742 | Ga0207649_106427421 | 204 |
| 475 | 3300025921 | Ga0207652_10001649 | Ga0207652_1000164913 | 204 |
| 476 | 3300025923 | Ga0207681_10609515 | Ga0207681_106095151 | 204 |
| 477 | 3300025924 | Ga0207694_10041393 | Ga0207694_100413932 | 204 |
| 478 | 3300025931 | Ga0207644_10020693 | Ga0207644_100206934 | 204 |
| 479 | 3300025932 | Ga0207690_10137839 | Ga0207690_101378392 | 204 |
| 480 | 3300025932 | Ga0207690_10291594 | Ga0207690_102915942 | 204 |
| 481 | 3300025944 | Ga0207661_10049173 | Ga0207661_100491733 | 204 |
| 482 | 3300025949 | Ga0207667_10037563 | Ga0207667_100375633 | 204 |
| 483 | 3300025949 | Ga0207667_10264307 | Ga0207667_102643073 | 204 |
| 484 | 3300025961 | Ga0207712_10292993 | Ga0207712_102929932 | 204 |
| 485 | 3300025972 | Ga0207668_10191950 | Ga0207668_101919502 | 204 |
| 486 | 3300025972 | Ga0207668_10216734 | Ga0207668_102167343 | 204 |
| 487 | 3300025986 | Ga0207658_10563461 | Ga0207658_105634611 | 204 |
| 488 | 3300026035 | Ga0207703_10561468 | Ga0207703_105614682 | 204 |
| 489 | 3300026041 | Ga0207639_10021282 | Ga0207639_100212823 | 204 |
| 490 | 3300026041 | Ga0207639_10087060 | Ga0207639_100870602 | 204 |
| 491 | 3300026067 | Ga0207678_10036640 | Ga0207678_100366404 | 204 |
| 492 | 3300026067 | Ga0207678_10044490 | Ga0207678_100444904 | 204 |
| 493 | 3300026067 | Ga0207678_10359567 | Ga0207678_103595672 | 204 |
| 494 | 3300026067 | Ga0207678_10632672 | Ga0207678_106326722 | 204 |
| 495 | 3300026078 | Ga0207702_10141120 | Ga0207702_101411202 | 204 |
| 496 | 3300026078 | Ga0207702_10224566 | Ga0207702_102245662 | 204 |
| 497 | 3300026088 | Ga0207641_10303079 | Ga0207641_103030793 | 204 |
| 498 | 3300026089 | Ga0207648_10410844 | Ga0207648_104108442 | 204 |
| 499 | 3300026089 | Ga0207648_10481755 | Ga0207648_104817552 | 204 |
| 500 | 3300026116 | Ga0207674_10023609 | Ga0207674_100236096 | 204 |
| 501 | 3300026116 | Ga0207674_10255838 | Ga0207674_102558382 | 204 |
| 502 | 3300026118 | Ga0207675_100113164 | Ga0207675_1001131643 | 204 |
| 503 | 3300026142 | Ga0207698_10005624 | Ga0207698_100056243 | 204 |
| 504 | 3300026142 | Ga0207698_10165117 | Ga0207698_101651172 | 204 |
| 505 | 3300027866 | Ga0209813_10039071 | Ga0209813_100390712 | 204 |
| 506 | 3300028379 | Ga0268266_10161520 | Ga0268266_101615202 | 204 |
| 507 | 3300028379 | Ga0268266_10323426 | Ga0268266_103234262 | 204 |
| 508 | 3300028380 | Ga0268265_10925306 | Ga0268265_109253062 | 204 |
| 509 | 3300033180 | Ga0307510_10132792 | Ga0307510_101327922 | 204 |
| 510 | 3300034819 | Ga0373958_0053448 | Ga0373958_0053448_48_683 | 204 |
| 511 | 3300034820 | Ga0373959_0021175 | Ga0373959_0021175_266_901 | 204 |
| 512 | 3300034957 | Ga0373938_0041745 | Ga0373938_0041745_148_783 | 204 |
| 513 | 3300035084 | Ga0373928_0016212 | Ga0373928_0016212_817_1452 | 204 |
| 514 | 3300035088 | Ga0373940_0025751 | Ga0373940_0025751_522_1157 | 204 |
| 515 | 3300035090 | Ga0373949_0057201 | Ga0373949_0057201_339_974 | 204 |
| 516 | 3300035114 | Ga0373939_0014883 | Ga0373939_0014883_1237_1872 | 204 |
| 517 | 3300037471 | Ga0395905_0896989 | Ga0395905_0896989_56_670 | 204 |
| 518 | 3300044658 | Ga0466972_0000363 | Ga0466972_0000363_13331_13945 | 204 |
| 519 | 3300044658 | Ga0466972_0084083 | Ga0466972_0084083_37_651 | 204 |
| 520 | 3300044658 | Ga0466972_0140517 | Ga0466972_0140517_28_642 | 204 |
| 521 | 3300044693 | Ga0466961_0201509 | Ga0466961_0201509_438_1052 | 204 |
| 522 | 3300044706 | Ga0466964_0071255 | Ga0466964_0071255_193_807 | 204 |
| 523 | 3300044735 | Ga0466968_0001648 | Ga0466968_0001648_7225_7839 | 204 |
| 524 | 3300044735 | Ga0466968_0037667 | Ga0466968_0037667_176_790 | 204 |
| 525 | 3300044735 | Ga0466968_0056259 | Ga0466968_0056259_20_634 | 204 |
| 526 | 3300044765 | Ga0466970_0374253 | Ga0466970_0374253_127_741 | 204 |
| 527 | 3300046459 | Ga0495629_0000900 | Ga0495629_0000900_20286_20900 | 204 |
| 528 | 3300046460 | Ga0495638_0003425 | Ga0495638_0003425_9245_9859 | 204 |
| 529 | 3300046462 | Ga0495651_0021715 | Ga0495651_0021715_2954_3571 | 204 |
| 530 | 3300046462 | Ga0495651_0051135 | Ga0495651_0051135_209_823 | 204 |
| 531 | 3300046463 | Ga0495653_0022549 | Ga0495653_0022549_2898_3515 | 204 |
| 532 | 3300046463 | Ga0495653_0227682 | Ga0495653_0227682_499_1113 | 204 |
| 533 | 3300046474 | Ga0495605_0119724 | Ga0495605_0119724_500_1114 | 204 |
| 534 | 3300046476 | Ga0495662_0103820 | Ga0495662_0103820_511_1125 | 204 |
| 535 | 3300046477 | Ga0495664_0005450 | Ga0495664_0005450_533_1150 | 204 |
| 536 | 3300046491 | Ga0495584_0260622 | Ga0495584_0260622_68_682 | 204 |
| 537 | 3300046507 | Ga0495606_0023497 | Ga0495606_0023497_3721_4335 | 204 |
| 538 | 3300046507 | Ga0495606_0035170 | Ga0495606_0035170_2480_3094 | 204 |
| 539 | 3300046511 | Ga0495608_0110982 | Ga0495608_0110982_783_1397 | 204 |
| 540 | 3300046512 | Ga0495610_0074036 | Ga0495610_0074036_541_1155 | 204 |
| 541 | 3300046512 | Ga0495610_0196402 | Ga0495610_0196402_78_692 | 204 |
| 542 | 3300046514 | Ga0495618_0379552 | Ga0495618_0379552_128_742 | 204 |
| 543 | 3300046516 | Ga0495628_0040123 | Ga0495628_0040123_1325_1942 | 204 |
| 544 | 3300046518 | Ga0495631_0206960 | Ga0495631_0206960_79_693 | 204 |
| 545 | 3300046519 | Ga0495632_0238846 | Ga0495632_0238846_145_759 | 204 |
| 546 | 3300046522 | Ga0495643_0005438 | Ga0495643_0005438_5697_6311 | 204 |
| 547 | 3300046522 | Ga0495643_0072904 | Ga0495643_0072904_1095_1709 | 204 |
| 548 | 3300046522 | Ga0495643_0223834 | Ga0495643_0223834_254_868 | 204 |
| 549 | 3300046529 | Ga0495652_0027943 | Ga0495652_0027943_2958_3575 | 204 |
| 550 | 3300046529 | Ga0495652_0218332 | Ga0495652_0218332_283_897 | 204 |
| 551 | 3300046533 | Ga0495640_0038743 | Ga0495640_0038743_1985_2599 | 204 |
| 552 | 3300046533 | Ga0495640_0051430 | Ga0495640_0051430_1045_1662 | 204 |
| 553 | 3300046536 | Ga0495587_0016459 | Ga0495587_0016459_1752_2369 | 204 |
| 554 | 3300046543 | Ga0495645_0020249 | Ga0495645_0020249_1798_2415 | 204 |
| 555 | 3300046557 | Ga0495622_0030034 | Ga0495622_0030034_182_796 | 204 |
| 556 | 3300046557 | Ga0495622_0032398 | Ga0495622_0032398_848_1462 | 204 |
| 557 | 3300046559 | Ga0495667_0044118 | Ga0495667_0044118_2127_2744 | 204 |
| 558 | 3300046616 | Ga0495668_0020048 | Ga0495668_0020048_1603_2217 | 204 |
| 559 | 3300046642 | Ga0495634_0398920 | Ga0495634_0398920_178_795 | 204 |
| 560 | 3300046663 | Ga0495635_0006765 | Ga0495635_0006765_4591_5205 | 204 |
| 561 | 3300046663 | Ga0495635_0023237 | Ga0495635_0023237_893_1510 | 204 |
| 562 | 3300046665 | Ga0495661_0199095 | Ga0495661_0199095_415_1029 | 204 |
| 563 | 3300046675 | Ga0495657_0006673 | Ga0495657_0006673_2783_3400 | 204 |
| 564 | 3300046675 | Ga0495657_0068992 | Ga0495657_0068992_657_1271 | 204 |
| 565 | 3300046678 | Ga0495599_0331056 | Ga0495599_0331056_131_748 | 204 |
| 566 | 3300046679 | Ga0495623_0029798 | Ga0495623_0029798_37_654 | 204 |
| 567 | 3300046680 | Ga0495646_0022884 | Ga0495646_0022884_198_815 | 204 |
| 568 | 3300046689 | Ga0495613_0036466 | Ga0495613_0036466_476_1090 | 204 |
| 569 | 3300046689 | Ga0495613_0046098 | Ga0495613_0046098_2432_3049 | 204 |
| 570 | 3300046690 | Ga0495624_0290679 | Ga0495624_0290679_20_637 | 204 |
| 571 | 3300046694 | Ga0495649_0079608 | Ga0495649_0079608_278_892 | 204 |
| 572 | 3300046809 | Ga0495600_0007520 | Ga0495600_0007520_1608_2225 | 204 |
| 573 | 3300046809 | Ga0495600_0048237 | Ga0495600_0048237_621_1235 | 204 |
| 574 | 3300047315 | Ga0495581_0025276 | Ga0495581_0025276_2277_2891 | 204 |
| 575 | 3300047317 | Ga0495604_0006276 | Ga0495604_0006276_2990_3607 | 204 |
| 576 | 3300047317 | Ga0495604_0040819 | Ga0495604_0040819_2022_2636 | 204 |
| 577 | 3300047319 | Ga0495674_0013016 | Ga0495674_0013016_5262_5879 | 204 |
| 578 | 3300047321 | Ga0495676_0021088 | Ga0495676_0021088_3901_4515 | 204 |
| 579 | 3300047322 | Ga0495680_0007943 | Ga0495680_0007943_6741_7358 | 204 |
| 580 | 3300047323 | Ga0495683_0054012 | Ga0495683_0054012_925_1539 | 204 |
| 581 | 3300047323 | Ga0495683_0180299 | Ga0495683_0180299_315_929 | 204 |
| 582 | 3300047443 | Ga0495687_175112 | Ga0495687_175112_45_659 | 204 |
| 583 | 3300047444 | Ga0495675_0003949 | Ga0495675_0003949_6067_6684 | 204 |
| 584 | 3300047469 | Ga0495673_0108636 | Ga0495673_0108636_235_849 | 204 |
| 585 | 3300047469 | Ga0495673_0185425 | Ga0495673_0185425_91_705 | 204 |
| 586 | 3300047472 | Ga0495686_0197279 | Ga0495686_0197279_326_940 | 204 |
| 587 | 3300047673 | Ga0495593_0063295 | Ga0495593_0063295_1239_1853 | 204 |
| 588 | 3300048088 | Ga0495602_0013244 | Ga0495602_0013244_5045_5662 | 204 |
| 589 | 3300048088 | Ga0495602_0610040 | Ga0495602_0610040_101_715 | 204 |
| 590 | 3300048903 | Ga0496100_0058924 | Ga0496100_0058924_1313_1927 | 204 |
| 591 | 3300048904 | Ga0496101_0045623 | Ga0496101_0045623_217_852 | 204 |
| 592 | 3300048904 | Ga0496101_0053843 | Ga0496101_0053843_1086_1700 | 204 |
| 593 | 3300048904 | Ga0496101_0108815 | Ga0496101_0108815_546_1160 | 204 |
| 594 | 3300048905 | Ga0496102_0025794 | Ga0496102_0025794_3965_4579 | 204 |
| 595 | 3300048905 | Ga0496102_0915356 | Ga0496102_0915356_109_723 | 204 |
| 596 | 3300048906 | Ga0496103_0007433 | Ga0496103_0007433_3641_4255 | 204 |
| 597 | 3300048906 | Ga0496103_0173750 | Ga0496103_0173750_593_1207 | 204 |
| 598 | 3300048907 | Ga0496104_0002707 | Ga0496104_0002707_11252_11866 | 204 |
| 599 | 3300048907 | Ga0496104_0029300 | Ga0496104_0029300_1169_1804 | 204 |
| 600 | 3300048907 | Ga0496104_0033366 | Ga0496104_0033366_1096_1710 | 204 |
| 601 | 3300048907 | Ga0496104_0301152 | Ga0496104_0301152_690_1304 | 204 |
| 602 | 3300048907 | Ga0496104_0522280 | Ga0496104_0522280_337_951 | 204 |
| 603 | 3300048908 | Ga0496105_0003571 | Ga0496105_0003571_8655_9269 | 204 |
| 604 | 3300048908 | Ga0496105_0077048 | Ga0496105_0077048_1967_2581 | 204 |
| 605 | 3300048908 | Ga0496105_0140306 | Ga0496105_0140306_334_948 | 204 |
| 606 | 3300048909 | Ga0496106_0753678 | Ga0496106_0753678_35_649 | 204 |
| 607 | 3300048910 | Ga0496107_0099485 | Ga0496107_0099485_314_949 | 204 |
| 608 | 3300048911 | Ga0496108_0034095 | Ga0496108_0034095_1949_2563 | 204 |
| 609 | 3300048912 | Ga0496109_0062374 | Ga0496109_0062374_260_874 | 204 |
| 610 | 3300048913 | Ga0496110_0083477 | Ga0496110_0083477_238_852 | 204 |
| 611 | 3300048914 | Ga0496111_0241288 | Ga0496111_0241288_52_666 | 204 |
| 612 | 3300048915 | Ga0496112_0052736 | Ga0496112_0052736_2823_3437 | 204 |
| 613 | 3300048915 | Ga0496112_0094636 | Ga0496112_0094636_1286_1921 | 204 |
| 614 | 3300048916 | Ga0496113_0120823 | Ga0496113_0120823_232_867 | 204 |
| 615 | 3300048916 | Ga0496113_0414979 | Ga0496113_0414979_236_850 | 204 |
| 616 | 3300048917 | Ga0496114_0191788 | Ga0496114_0191788_25_660 | 204 |
| 617 | 3300048917 | Ga0496114_0313449 | Ga0496114_0313449_670_1284 | 204 |
| 618 | 3300048917 | Ga0496114_0333313 | Ga0496114_0333313_706_1320 | 204 |
| 619 | 3300048918 | Ga0496115_0027942 | Ga0496115_0027942_959_1594 | 204 |
| 620 | 3300048918 | Ga0496115_0218994 | Ga0496115_0218994_60_674 | 204 |
| 621 | 3300048918 | Ga0496115_0260701 | Ga0496115_0260701_178_792 | 204 |
| 622 | 3300048918 | Ga0496115_0557190 | Ga0496115_0557190_160_774 | 204 |
| 623 | 3300048919 | Ga0496116_0014259 | Ga0496116_0014259_207_821 | 204 |
| 624 | 3300048919 | Ga0496116_0043348 | Ga0496116_0043348_2140_2754 | 204 |
| 625 | 3300048920 | Ga0496117_0055450 | Ga0496117_0055450_999_1613 | 204 |
| 626 | 3300048920 | Ga0496117_0222959 | Ga0496117_0222959_193_807 | 204 |
| 627 | 3300048921 | Ga0496118_0043905 | Ga0496118_0043905_742_1356 | 204 |
| 628 | 3300048921 | Ga0496118_0068846 | Ga0496118_0068846_1686_2300 | 204 |
| 629 | 3300048921 | Ga0496118_0115119 | Ga0496118_0115119_132_746 | 204 |
| 630 | 3300048921 | Ga0496118_0383671 | Ga0496118_0383671_55_669 | 204 |
| 631 | 3300048922 | Ga0496119_0018956 | Ga0496119_0018956_1296_1910 | 204 |
| 632 | 3300048922 | Ga0496119_0105269 | Ga0496119_0105269_130_744 | 204 |
| 633 | 3300048923 | Ga0496120_0023635 | Ga0496120_0023635_445_1059 | 204 |
| 634 | 3300048924 | Ga0496121_0004381 | Ga0496121_0004381_13578_14192 | 204 |
| 635 | 3300048924 | Ga0496121_0093712 | Ga0496121_0093712_1617_2231 | 204 |
| 636 | 3300048924 | Ga0496121_0226031 | Ga0496121_0226031_342_956 | 204 |
| 637 | 3300048925 | Ga0496122_0087738 | Ga0496122_0087738_606_1220 | 204 |
| 638 | 3300048925 | Ga0496122_0188080 | Ga0496122_0188080_137_751 | 204 |
| 639 | 3300048926 | Ga0496123_0105528 | Ga0496123_0105528_707_1321 | 204 |
| 640 | 3300048927 | Ga0496124_0095498 | Ga0496124_0095498_687_1301 | 204 |
| 641 | 3300048927 | Ga0496124_0269060 | Ga0496124_0269060_235_849 | 204 |
| 642 | 3300048928 | Ga0496125_0051118 | Ga0496125_0051118_1868_2482 | 204 |
| 643 | 3300048928 | Ga0496125_0064011 | Ga0496125_0064011_167_781 | 204 |
| 644 | 3300048928 | Ga0496125_0104161 | Ga0496125_0104161_500_1114 | 204 |
| 645 | 3300048928 | Ga0496125_0256258 | Ga0496125_0256258_372_986 | 204 |
| 646 | 3300048929 | Ga0496126_0020402 | Ga0496126_0020402_3365_3979 | 204 |
| 647 | 3300048929 | Ga0496126_0041687 | Ga0496126_0041687_573_1187 | 204 |
| 648 | 3300049460 | Ga0495682_0027484 | Ga0495682_0027484_532_1146 | 204 |
| 649 | 3300049593 | Ga0501077_0101197 | Ga0501077_0101197_122_766 | 204 |
| 650 | 3300050490 | nmdc:mga03n38_171368_c1 | nmdc:mga03n38_171368_c1_267_881 | 204 |
| 651 | 3300050492 | nmdc:mga0yw44_322388_c1 | nmdc:mga0yw44_322388_c1_111_725 | 204 |
| 652 | 3300050492 | nmdc:mga0yw44_9102_c1 | nmdc:mga0yw44_9102_c1_376_990 | 204 |
| 653 | 3300050493 | nmdc:mga0k408_75413_c1 | nmdc:mga0k408_75413_c1_544_1158 | 204 |
| 654 | 3300050493 | nmdc:mga0k408_91430_c1 | nmdc:mga0k408_91430_c1_602_1216 | 204 |
| 655 | 3300050494 | nmdc:mga06z11_35953_c1 | nmdc:mga06z11_35953_c1_460_1074 | 204 |
| 656 | 3300050495 | nmdc:mga04h51_8605_c1 | nmdc:mga04h51_8605_c1_428_1042 | 204 |
| 657 | 3300050496 | nmdc:mga07m45_12697_c1 | nmdc:mga07m45_12697_c1_1266_1880 | 204 |
| 658 | 3300050496 | nmdc:mga07m45_14394_c1 | nmdc:mga07m45_14394_c1_2494_3108 | 204 |
| 659 | 3300050512 | nmdc:mga0n895_193085_c1 | nmdc:mga0n895_193085_c1_602_1237 | 204 |
| 660 | 3300050515 | nmdc:mga0a205_265521_c1 | nmdc:mga0a205_265521_c1_610_1257 | 204 |
| 661 | 3300050516 | nmdc:mga0sz30_50125_c1 | nmdc:mga0sz30_50125_c1_644_1258 | 204 |
| 662 | 3300050516 | nmdc:mga0sz30_50701_c1 | nmdc:mga0sz30_50701_c1_959_1573 | 204 |
| 663 | 3300053083 | Ga0495655_0044091 | Ga0495655_0044091_337_951 | 204 |
| 664 | 3300053084 | Ga0495595_0155847 | Ga0495595_0155847_281_898 | 204 |
| 665 | 3300053085 | Ga0495619_0046460 | Ga0495619_0046460_2114_2731 | 204 |
| 666 | 3300053086 | Ga0500578_0123944 | Ga0500578_0123944_19_633 | 204 |
| 667 | 3300053087 | Ga0500643_000047 | Ga0500643_000047_32871_33485 | 204 |
| 668 | 3300053093 | Ga0500651_0035166 | Ga0500651_0035166_1764_2378 | 204 |
| 669 | 3300053093 | Ga0500651_0320785 | Ga0500651_0320785_78_692 | 204 |
| 670 | 3300053094 | Ga0500566_0027227 | Ga0500566_0027227_2319_2933 | 204 |
| 671 | 3300053094 | Ga0500566_0141474 | Ga0500566_0141474_257_871 | 204 |
| 672 | 3300053095 | Ga0500640_034386 | Ga0500640_034386_559_1173 | 204 |
| 673 | 3300053103 | Ga0500555_007180 | Ga0500555_007180_545_1159 | 204 |
| 674 | 3300053104 | Ga0500556_0128367 | Ga0500556_0128367_197_811 | 204 |
| 675 | 3300053106 | Ga0500558_169387 | Ga0500558_169387_17_631 | 204 |
| 676 | 3300053119 | Ga0500595_033458 | Ga0500595_033458_22_636 | 204 |
| 677 | 3300053123 | Ga0500614_070537 | Ga0500614_070537_249_863 | 204 |
| 678 | 3300053125 | Ga0500618_037738 | Ga0500618_037738_12_626 | 204 |
| 679 | 3300053130 | Ga0500642_0008914 | Ga0500642_0008914_297_911 | 204 |
| 680 | 3300053134 | Ga0500658_0112542 | Ga0500658_0112542_209_823 | 204 |
| 681 | 3300053136 | Ga0500559_0028573 | Ga0500559_0028573_1463_2077 | 204 |
| 682 | 3300053139 | Ga0500568_0067797 | Ga0500568_0067797_738_1352 | 204 |
| 683 | 3300053140 | Ga0500573_0262309 | Ga0500573_0262309_166_780 | 204 |
| 684 | 3300053142 | Ga0500577_0052342 | Ga0500577_0052342_724_1338 | 204 |
| 685 | 3300053147 | Ga0500589_187102 | Ga0500589_187102_37_651 | 204 |
| 686 | 3300053148 | Ga0500590_230533 | Ga0500590_230533_76_690 | 204 |
| 687 | 3300053153 | Ga0500616_0087570 | Ga0500616_0087570_908_1522 | 204 |
| 688 | 3300053155 | Ga0500620_016927 | Ga0500620_016927_252_866 | 204 |
| 689 | 3300053156 | Ga0500622_0006265 | Ga0500622_0006265_5170_5784 | 204 |
| 690 | 3300053160 | Ga0500633_0067440 | Ga0500633_0067440_622_1236 | 204 |
| 691 | 3300053162 | Ga0500638_019612 | Ga0500638_019612_929_1543 | 204 |
| 692 | 3300053731 | Ga0500609_025756 | Ga0500609_025756_78_692 | 204 |
| 693 | 3300053733 | Ga0500552_002212 | Ga0500552_002212_842_1456 | 204 |
| 694 | 3300053736 | Ga0500599_000212 | Ga0500599_000212_517_1131 | 204 |
| 695 | 3300053737 | Ga0500601_000078 | Ga0500601_000078_10813_11427 | 204 |
| 696 | 3300055283 | Ga0500661_005887 | Ga0500661_005887_1144_1758 | 204 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gz4-assembly1.cif.gz_C | 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens | 0.9047 | 13 | 203 |
| 2gz4-assembly1.cif.gz_C | 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens | 0.8688 | 13 | 203 |
| 2dqb-assembly1.cif.gz_A | crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase | 0.6181 | 39 | 151 |
| 7oiw-assembly2.cif.gz_B | structure of s. aureus rel catalytic domains in complex with pppgpp | 0.5368 | 37 | 166 |
| 5tka-assembly1.cif.gz_A-2 | structure of the hd-domain phosphohydrolase oxsa | 0.5215 | 34 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gz4D00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9069 | 13 | 202 | 1.10.3210.10 |
| 2gz4D00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8621 | 13 | 202 | 1.10.3210.10 |
| af_P76514_1_178_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.734 | 15 | 202 | 1.10.3210.10 |
| af_P76514_1_178_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6951 | 15 | 202 | 1.10.3210.10 |
| af_Q2FZ08_320_474_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5407 | 39 | 149 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258SRH7-F1-model_v4 | Hydrolase | 0.985 | 13 | 73 |
|
| AF-A0A3D2P790-F1-model_v4 | Hydrolase | 0.9777 | 13 | 77 |
|
| AF-A0A526QFV6-F1-model_v4 | Hydrolase | 0.9682 | 13 | 79 |
GO:0016787
|
| AF-A4U2D7-F1-model_v4 | Uncharacterized protein | 0.9499 | 13 | 97 |
|
| AF-A0A839Z8R5-F1-model_v4 | HD family hydrolase | 0.9353 | 13 | 202 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar