F475844

General Info

Members Datasets Scaffolds Average Seq Length
696 473 568 202

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10047508|Ga0316583_100475081
Length 197
Sequence MRQPRAWQRMLSGRRLDLLDPTPVDIEIEDIAHGLAFVARWNGQTRGDWPYSVAEHSLLVEEIFSRRPGAEPRWRLAALLHDAPEYVIGDMISPVKAAVGPGYGDLDARLSAAVHLRFGLPAVLPVAVKKAIKVADKASAWLEAVQIAGFSEAEANRLFGRPGDTVLRGLEIRLRPPAVVRADFLRRHHELLESLSA

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
12 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
13 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
14 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
15 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
16 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
17 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
18 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
19 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
20 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
21 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
22 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
23 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
24 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
25 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
26 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
27 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
28 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
29 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
30 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
31 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
32 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
33 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
34 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
35 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
36 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
37 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
40 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
41 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
42 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
43 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
44 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
45 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
46 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
47 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
48 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
49 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
50 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
51 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
52 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
53 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
54 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
55 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
56 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
57 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
58 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
59 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
60 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
61 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
62 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
63 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
64 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
65 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
66 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
67 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
68 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
69 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
70 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
71 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
72 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
73 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
74 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
75 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
76 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
77 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
78 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
79 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
80 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
81 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
82 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
83 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
84 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
85 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
86 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
87 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
88 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
89 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
90 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
91 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
92 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
93 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
94 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
95 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
96 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
97 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
98 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
99 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
100 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
101 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
102 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
103 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
104 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
105 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
106 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
107 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
110 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
111 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
112 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
114 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
115 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
116 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
117 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
118 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
119 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
127 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
130 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
131 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
132 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
133 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
134 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
135 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
136 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
137 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
151 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
152 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
153 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
154 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
155 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
161 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
162 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
163 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
164 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
165 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
166 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
167 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
168 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
169 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
170 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
171 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
172 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
175 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
176 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
177 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
178 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
179 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
189 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
190 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
191 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
192 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
193 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
194 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
195 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
196 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
247 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
248 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
249 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
259 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
260 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
261 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
265 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
266 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
269 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
270 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
286 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
347 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
370 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
371 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
372 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
373 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
374 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
375 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
376 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
377 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
378 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
379 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
398 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
418 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
423 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
424 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
425 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
426 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
427 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
428 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
429 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
432 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
433 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
434 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
437 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
438 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
439 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
440 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
441 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
446 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
447 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
448 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
449 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
450 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
451 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
452 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
455 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
456 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
457 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
458 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
459 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
460 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
461 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
462 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
463 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
464 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
465 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
466 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
467 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
468 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
469 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
470 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
471 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
472 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
473 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.58
Metatranscriptomes 0.14
Isolates 18.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.36
Nodule 12.36
Rhizoplane 5.75
Rhizosphere 55.6
Stem 0
Stem Tuber 0.14
Unclassified 12.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1005214 3300003214 Bacteria 2561
2 JGI25153J46596_10002451 3300003215 Bacteria 10699
3 JGI25153J46596_10019495 3300003215 Bacteria 2597
4 JGI25153J46596_10021561 3300003215 Bacteria 2398
5 JGI25153J46596_10052238 3300003215 Bacteria 1165
6 JGI25160J50197_1000862 3300003354 Bacteria 16124
7 JGI25160J50197_1001471 3300003354 Bacteria 11739
8 Ga0055542_1003091 3300003762 Bacteria 4775
9 JGI25405J52794_10074805 3300003911 Bacteria 741
10 Ga0055543_1004845 3300004625 Bacteria 3566
11 Ga0065165_1002362 3300005262 Bacteria 16354
12 Ga0065165_1006702 3300005262 Bacteria 5926
13 Ga0070676_10313696 3300005328 Bacteria 1067
14 Ga0070683_100069621 3300005329 Bacteria 3281
15 Ga0070680_100012456 3300005336 Bacteria 6610
16 Ga0070680_100035084 3300005336 Bacteria 4049
17 Ga0070660_100023176 3300005339 Bacteria 4598
18 Ga0070668_100006917 3300005347 Bacteria 8408
19 Ga0070668_100011847 3300005347 Bacteria 6496
20 Ga0070668_100075380 3300005347 Bacteria 2634
21 Ga0070671_100023510 3300005355 Bacteria 5044
22 Ga0070667_100043976 3300005367 Bacteria 3749
23 Ga0070709_10004640 3300005434 Bacteria 7417
24 Ga0070714_100125504 3300005435 Bacteria 2288
25 Ga0070713_100621165 3300005436 Bacteria 1028
26 Ga0070710_10000534 3300005437 Bacteria 17971
27 Ga0070711_100000548 3300005439 Bacteria 19604
28 Ga0070694_100031808 3300005444 Bacteria 3461
29 Ga0070663_100024485 3300005455 Bacteria 4064
30 Ga0070663_100342056 3300005455 Bacteria 1209
31 Ga0070681_10013695 3300005458 Bacteria 8071
32 Ga0068867_100696245 3300005459 Bacteria 896
33 Ga0070679_100091249 3300005530 Bacteria 3034
34 Ga0070679_100203108 3300005530 Bacteria 1947
35 Ga0070684_100032160 3300005535 Bacteria 4470
36 Ga0068853_100022837 3300005539 Bacteria 5228
37 Ga0068853_100286902 3300005539 Bacteria 1518
38 Ga0070695_100035976 3300005545 Bacteria 3114
39 Ga0070693_100105285 3300005547 Bacteria 1726
40 Ga0070665_100245353 3300005548 Bacteria 1791
41 Ga0070704_100169462 3300005549 Bacteria 1735
42 Ga0068855_100056975 3300005563 Bacteria 4582
43 Ga0068855_100200177 3300005563 Bacteria 2249
44 Ga0068855_101271753 3300005563 Bacteria 763
45 Ga0068857_100020685 3300005577 Bacteria 5791
46 Ga0068857_100228397 3300005577 Bacteria 1702
47 Ga0068854_101011280 3300005578 Bacteria 736
48 Ga0068856_100058718 3300005614 Bacteria 3800
49 Ga0068856_100262168 3300005614 Bacteria 1744
50 Ga0070702_100224953 3300005615 Bacteria 1257
51 Ga0068852_100010119 3300005616 Bacteria 7023
52 Ga0068852_100137152 3300005616 Bacteria 2260
53 Ga0068859_100133756 3300005617 Bacteria 2552
54 Ga0068861_100109753 3300005719 Bacteria 2209
55 Ga0068851_10054871 3300005834 Bacteria 2030
56 Ga0068863_100125930 3300005841 Bacteria 2444
57 Ga0068863_100398512 3300005841 Bacteria 1346
58 Ga0068858_100078600 3300005842 Bacteria 3066
59 Ga0068862_100088409 3300005844 Bacteria 2696
60 Ga0068862_100670901 3300005844 Bacteria 1002
61 Ga0081455_10000086 3300005937 Bacteria 101126
62 Ga0081455_10002017 3300005937 Bacteria 24282
63 Ga0081455_10058037 3300005937 Bacteria 3277
64 Ga0081455_10098227 3300005937 Bacteria 2357
65 Ga0081540_1069864 3300005983 Bacteria 1629
66 Ga0070717_10088384 3300006028 Bacteria 2612
67 Ga0070717_11080557 3300006028 Bacteria 731
68 Ga0075365_10008203 3300006038 Bacteria 5911
69 Ga0075368_10008255 3300006042 Bacteria 3701
70 Ga0075363_100007746 3300006048 Bacteria 4960
71 Ga0075363_100195103 3300006048 Bacteria 1156
72 Ga0075364_10035843 3300006051 Bacteria 3206
73 Ga0075364_10039975 3300006051 Bacteria 3041
74 Ga0070712_100205525 3300006175 Bacteria 1550
75 Ga0070712_100261472 3300006175 Bacteria 1387
76 Ga0075367_10113131 3300006178 Bacteria 1667
77 Ga0075369_10068346 3300006186 Bacteria 1561
78 Ga0075366_10006253 3300006195 Bacteria 6510
79 Ga0075366_10023086 3300006195 Bacteria 3624
80 Ga0075366_10446679 3300006195 Bacteria 798
81 Ga0075370_10136652 3300006353 Bacteria 1432
82 Ga0075428_100495259 3300006844 Bacteria 1308
83 Ga0075428_100699522 3300006844 Bacteria 1080
84 Ga0075430_100009804 3300006846 Bacteria 8102
85 Ga0075431_100005807 3300006847 Bacteria 12211
86 Ga0075433_10000513 3300006852 Bacteria 25290
87 Ga0075433_10188624 3300006852 Bacteria 1834
88 Ga0075429_100325787 3300006880 Bacteria 1344
89 Ga0075436_100349687 3300006914 Bacteria 1065
90 Ga0097620_100133751 3300006931 Bacteria 2552
91 Ga0105240_10002871 3300009093 Bacteria 27247
92 Ga0105240_10004761 3300009093 Bacteria 20490
93 Ga0105240_10007546 3300009093 Bacteria 15763
94 Ga0105240_10130948 3300009093 Bacteria 3009
95 Ga0111539_10016218 3300009094 Bacteria 9241
96 Ga0105247_10105210 3300009101 Bacteria 1809
97 Ga0114129_10173299 3300009147 Bacteria 2940
98 Ga0114129_10542625 3300009147 Bacteria 1513
99 Ga0105241_10177655 3300009174 Bacteria 1763
100 Ga0105241_10281291 3300009174 Bacteria 1421
101 Ga0105248_10047698 3300009177 Bacteria 4803
102 Ga0105237_10015590 3300009545 Bacteria 7905
103 Ga0105237_10028914 3300009545 Bacteria 5641
104 Ga0105237_10998320 3300009545 Bacteria 844
105 Ga0105238_10003869 3300009551 Bacteria 14870
106 Ga0105238_10005018 3300009551 Bacteria 13082
107 Ga0105238_10555258 3300009551 Bacteria 1153
108 Ga0105238_10560970 3300009551 Bacteria 1147
109 Ga0105249_10446314 3300009553 Bacteria 1332
110 Ga0105239_10018844 3300010375 Bacteria 7625
111 Ga0105239_10082874 3300010375 Bacteria 3532
112 Ga0105239_10109682 3300010375 Bacteria 3059
113 Ga0105239_10148114 3300010375 Bacteria 2619
114 Ga0105239_10296140 3300010375 Bacteria 1822
115 Ga0105246_10056523 3300011119 Bacteria 2713
116 Ga0157369_10000685 3300013105 Bacteria 43830
117 Ga0157374_10070980 3300013296 Bacteria 3283
118 Ga0157375_10371631 3300013308 Bacteria 1596
119 Ga0157375_10970152 3300013308 Bacteria 991
120 Ga0163163_10143448 3300014325 Bacteria 2431
121 Ga0157380_10294294 3300014326 Bacteria 1492
122 Ga0157379_10203769 3300014968 Bacteria 1789
123 Ga0157376_10675816 3300014969 Bacteria 1035
124 Ga0206353_11573899 3300020082 Bacteria 1118
125 Ga0214544_1000001 3300021320 Bacteria 783667
126 Ga0214542_1000005 3300021321 Bacteria 389646
127 Ga0214545_1000003 3300021324 Bacteria 720274
128 Ga0214545_1035621 3300021324 Bacteria 1634
129 Ga0214543_1000002 3300021327 Bacteria 712733
130 Ga0213873_10018929 3300021358 Bacteria 1590
131 Ga0213872_10087414 3300021361 Bacteria 1396
132 Ga0213874_10103358 3300021377 Bacteria 950
133 Ga0213876_10069397 3300021384 Bacteria 1861
134 Ga0213876_10267544 3300021384 Bacteria 908
135 Ga0209677_104884 3300025253 Bacteria 3676
136 Ga0209148_1000654 3300025254 Bacteria 29905
137 Ga0209233_1001456 3300025261 Bacteria 9342
138 Ga0209455_1010095 3300025272 Bacteria 2426
139 Ga0209564_1032890 3300025295 Bacteria 1552
140 Ga0209758_1000320 3300025297 Bacteria 92649
141 Ga0209758_1001495 3300025297 Bacteria 27238
142 Ga0209758_1011255 3300025297 Bacteria 5209
143 Ga0209758_1037460 3300025297 Bacteria 1874
144 Ga0209758_1060429 3300025297 Bacteria 1255
145 Ga0209758_1060430 3300025297 Bacteria 1255
146 Ga0207426_1000746 3300025302 Bacteria 36609
147 Ga0207426_1004351 3300025302 Bacteria 6962
148 Ga0209257_1012298 3300025304 Bacteria 3979
149 Ga0209257_1038158 3300025304 Bacteria 1458
150 Ga0207656_10016053 3300025321 Bacteria 2908
151 Ga0207656_10138113 3300025321 Bacteria 1147
152 Ga0207692_10000091 3300025898 Bacteria 26705
153 Ga0207688_10031744 3300025901 Bacteria 2917
154 Ga0207647_10030422 3300025904 Bacteria 3484
155 Ga0207699_10000782 3300025906 Bacteria 15227
156 Ga0207645_10510000 3300025907 Bacteria 815
157 Ga0207705_10032876 3300025909 Bacteria 3706
158 Ga0207654_10008841 3300025911 Bacteria 5110
159 Ga0207654_10010107 3300025911 Bacteria 4800
160 Ga0207707_10001881 3300025912 Bacteria 19162
161 Ga0207695_10000503 3300025913 Bacteria 83026
162 Ga0207695_10102221 3300025913 Bacteria 2859
163 Ga0207695_10302211 3300025913 Bacteria 1491
164 Ga0207671_10263060 3300025914 Bacteria 1358
165 Ga0207671_10575208 3300025914 Bacteria 898
166 Ga0207693_10029076 3300025915 Bacteria 4368
167 Ga0207693_10430565 3300025915 Bacteria 1031
168 Ga0207663_10047322 3300025916 Bacteria 2655
169 Ga0207660_10005375 3300025917 Bacteria 8316
170 Ga0207660_10048097 3300025917 Bacteria 3018
171 Ga0207657_10005742 3300025919 Bacteria 12944
172 Ga0207657_10061871 3300025919 Bacteria 3207
173 Ga0207649_10642742 3300025920 Bacteria 819
174 Ga0207652_10001649 3300025921 Bacteria 19585
175 Ga0207681_10609515 3300025923 Bacteria 903
176 Ga0207694_10041393 3300025924 Bacteria 3550
177 Ga0207694_10266785 3300025924 Bacteria 1403
178 Ga0207700_10018197 3300025928 Bacteria 4715
179 Ga0207664_10023054 3300025929 Bacteria 4659
180 Ga0207644_10020693 3300025931 Bacteria 4476
181 Ga0207690_10003499 3300025932 Bacteria 9366
182 Ga0207690_10137839 3300025932 Bacteria 1794
183 Ga0207690_10291594 3300025932 Bacteria 1274
184 Ga0207661_10049173 3300025944 Bacteria 3355
185 Ga0207667_10037563 3300025949 Bacteria 5176
186 Ga0207667_10050013 3300025949 Bacteria 4412
187 Ga0207667_10231534 3300025949 Bacteria 1892
188 Ga0207667_10264307 3300025949 Bacteria 1760
189 Ga0207712_10292993 3300025961 Bacteria 1332
190 Ga0207668_10015251 3300025972 Bacteria 4770
191 Ga0207668_10191950 3300025972 Bacteria 1619
192 Ga0207668_10216734 3300025972 Bacteria 1534
193 Ga0207658_10563461 3300025986 Bacteria 1020
194 Ga0207703_10561468 3300026035 Bacteria 1077
195 Ga0207639_10021282 3300026041 Bacteria 4656
196 Ga0207639_10029266 3300026041 Bacteria 4030
197 Ga0207639_10087060 3300026041 Bacteria 2489
198 Ga0207639_11000265 3300026041 Bacteria 783
199 Ga0207678_10036640 3300026067 Bacteria 4270
200 Ga0207678_10044490 3300026067 Bacteria 3840
201 Ga0207678_10108119 3300026067 Bacteria 2372
202 Ga0207678_10359567 3300026067 Bacteria 1256
203 Ga0207678_10632672 3300026067 Bacteria 939
204 Ga0207708_10104812 3300026075 Bacteria 2191
205 Ga0207702_10141120 3300026078 Bacteria 2180
206 Ga0207702_10224566 3300026078 Bacteria 1752
207 Ga0207702_10579719 3300026078 Bacteria 1099
208 Ga0207641_10106892 3300026088 Bacteria 2474
209 Ga0207641_10303079 3300026088 Bacteria 1510
210 Ga0207641_10512830 3300026088 Bacteria 1166
211 Ga0207648_10410844 3300026089 Bacteria 1228
212 Ga0207648_10481755 3300026089 Bacteria 1133
213 Ga0207674_10023609 3300026116 Bacteria 6584
214 Ga0207674_10255838 3300026116 Bacteria 1698
215 Ga0207675_100113164 3300026118 Bacteria 2562
216 Ga0207698_10005624 3300026142 Bacteria 7758
217 Ga0207698_10165117 3300026142 Bacteria 1942
218 Ga0209813_10039071 3300027866 Bacteria 1437
219 Ga0207428_10221335 3300027907 Bacteria 1419
220 Ga0268266_10161520 3300028379 Bacteria 2027
221 Ga0268266_10323426 3300028379 Bacteria 1444
222 Ga0268265_10124676 3300028380 Bacteria 2129
223 Ga0268265_10925306 3300028380 Bacteria 857
224 Ga0265319_1051150 3300028563 Bacteria 1363
225 Ga0265334_10006729 3300028573 Bacteria 4937
226 Ga0265338_10022804 3300028800 Bacteria 6463
227 Ga0265338_10026178 3300028800 Bacteria 5894
228 Ga0265338_10026523 3300028800 Bacteria 5841
229 Ga0265338_10083442 3300028800 Bacteria 2673
230 Ga0265338_10094210 3300028800 Bacteria 2464
231 Ga0265320_10115032 3300031240 Bacteria 1230
232 Ga0265327_10074629 3300031251 Bacteria 1689
233 Ga0316576_10008259 3300031727 Bacteria 6625
234 Ga0307413_10185353 3300031824 Bacteria 1488
235 Ga0307410_10236883 3300031852 Bacteria 1412
236 Ga0307409_100073567 3300031995 Bacteria 2726
237 Ga0307416_100126903 3300032002 Bacteria 2287
238 Ga0307416_101039223 3300032002 Bacteria 923
239 Ga0307416_101174244 3300032002 Bacteria 873
240 Ga0307411_10028563 3300032005 Bacteria 3393
241 Ga0307415_100183628 3300032126 Bacteria 1644
242 Ga0316583_10047508 3300032133 Bacteria 1513
243 Ga0307510_10132792 3300033180 Bacteria 2156
244 Ga0373958_0053448 3300034819 Bacteria 858
245 Ga0373959_0021175 3300034820 Bacteria 1246
246 Ga0373938_0041745 3300034957 Bacteria 1021
247 Ga0373928_0016212 3300035084 Bacteria 1523
248 Ga0373929_0059958 3300035085 Bacteria 888
249 Ga0373940_0008127 3300035088 Bacteria 2396
250 Ga0373940_0025751 3300035088 Bacteria 1534
251 Ga0373949_0057201 3300035090 Bacteria 996
252 Ga0373932_0003500 3300035112 Bacteria 3771
253 Ga0373939_0014883 3300035114 Bacteria 2026
254 Ga0373960_0080014 3300035121 Bacteria 1027
255 Ga0373961_0242858 3300035241 Bacteria 649
256 Ga0373931_0000351 3300035691 Bacteria 18984
257 Ga0373931_0171794 3300035691 Bacteria 1278
258 Ga0373935_0303963 3300035692 Bacteria 1128
259 Ga0373927_0001984 3300035695 Bacteria 15075
260 Ga0373933_0000038 3300035724 Bacteria 80976
261 Ga0373937_0231953 3300036401 Bacteria 1738
262 Ga0373925_0417112 3300037068 Bacteria 1096
263 Ga0395899_0000026 3300037312 Bacteria 345291
264 Ga0395898_0198937 3300037466 Bacteria 1914
265 Ga0395905_0896989 3300037471 Bacteria 789
266 Ga0436364_0531241 3300037853 Bacteria 769
267 Ga0400483_075974 3300039062 Bacteria 3308
268 Ga0400483_080646 3300039062 Bacteria 14829
269 Ga0400483_085672 3300039062 Bacteria 2820
270 Ga0400483_114150 3300039062 Bacteria 2205
271 Ga0400483_115380 3300039062 Bacteria 1822
272 Ga0400483_118604 3300039062 Bacteria 1172
273 Ga0400483_156125 3300039062 Bacteria 1187
274 Ga0400483_212347 3300039062 Bacteria 3877
275 Ga0400483_216717 3300039062 Bacteria 1932
276 Ga0400483_229872 3300039062 Bacteria 12743
277 Ga0400483_238163 3300039062 Bacteria 1866
278 Ga0400483_242397 3300039062 Bacteria 1616
279 Ga0436365_0365623 3300039437 Bacteria 31548
280 Ga0436365_0434683 3300039437 Bacteria 808
281 Ga0436365_0711553 3300039437 Bacteria 97884
282 Ga0436365_1902327 3300039437 Bacteria 890
283 Ga0436360_0753528 3300039438 Bacteria 798
284 Ga0436360_1213167 3300039438 Bacteria 1991
285 Ga0436361_0552255 3300039447 Bacteria 1114
286 Ga0436361_0779011 3300039447 Bacteria 1870
287 Ga0436361_0805306 3300039447 Bacteria 3569
288 Ga0436363_0149506 3300039450 Bacteria 2325
289 Ga0436363_1007251 3300039450 Bacteria 928
290 Ga0436363_1378300 3300039450 Bacteria 7286
291 Ga0436362_0272811 3300039453 Bacteria 1919
292 Ga0436362_1067038 3300039453 Bacteria 1075
293 Ga0466972_0000363 3300044658 Bacteria 24488
294 Ga0466972_0084083 3300044658 Bacteria 1513
295 Ga0466972_0140517 3300044658 Bacteria 1136
296 Ga0466965_0035434 3300044683 Bacteria 2445
297 Ga0466961_0201509 3300044693 Bacteria 1231
298 Ga0466964_0071255 3300044706 Bacteria 1470
299 Ga0466968_0001648 3300044735 Bacteria 8067
300 Ga0466968_0037667 3300044735 Bacteria 2030
301 Ga0466968_0056259 3300044735 Bacteria 1689
302 Ga0466968_0129873 3300044735 Bacteria 1146
303 Ga0466970_0374253 3300044765 Bacteria 810
304 Ga0466959_0057334 3300045049 Bacteria 2840
305 Ga0451576_0001020 3300045051 Bacteria 51854
306 Ga0466967_0606679 3300045976 Bacteria 1080
307 Ga0495603_0045503 3300046455 Bacteria 2617
308 Ga0495590_0046319 3300046457 Bacteria 1517
309 Ga0495629_0000900 3300046459 Bacteria 23863
310 Ga0495638_0003425 3300046460 Bacteria 12493
311 Ga0495651_0021715 3300046462 Bacteria 4989
312 Ga0495651_0051135 3300046462 Bacteria 3187
313 Ga0495651_0233019 3300046462 Bacteria 1267
314 Ga0495651_0666486 3300046462 Bacteria 651
315 Ga0495653_0022549 3300046463 Bacteria 5093
316 Ga0495653_0227682 3300046463 Bacteria 1249
317 Ga0495605_0119724 3300046474 Bacteria 1194
318 Ga0495662_0103820 3300046476 Bacteria 1391
319 Ga0495664_0005450 3300046477 Bacteria 6991
320 Ga0495584_0260622 3300046491 Bacteria 881
321 Ga0495606_0023497 3300046507 Bacteria 4464
322 Ga0495606_0035170 3300046507 Bacteria 3428
323 Ga0495606_0053725 3300046507 Bacteria 2613
324 Ga0495606_0192703 3300046507 Bacteria 1167
325 Ga0495608_0110982 3300046511 Bacteria 1763
326 Ga0495610_0074036 3300046512 Bacteria 1581
327 Ga0495610_0196402 3300046512 Bacteria 829
328 Ga0495618_0379552 3300046514 Bacteria 867
329 Ga0495628_0040123 3300046516 Bacteria 3742
330 Ga0495628_0174794 3300046516 Bacteria 1627
331 Ga0495630_0035846 3300046517 Bacteria 3707
332 Ga0495631_0098170 3300046518 Bacteria 1261
333 Ga0495631_0206960 3300046518 Bacteria 839
334 Ga0495632_0238846 3300046519 Bacteria 818
335 Ga0495637_0146650 3300046520 Bacteria 893
336 Ga0495643_0005438 3300046522 Bacteria 8618
337 Ga0495643_0072904 3300046522 Bacteria 1800
338 Ga0495643_0223834 3300046522 Bacteria 891
339 Ga0495648_0169772 3300046524 Bacteria 1119
340 Ga0495642_0053360 3300046528 Bacteria 1666
341 Ga0495652_0027943 3300046529 Bacteria 4968
342 Ga0495652_0216450 3300046529 Bacteria 1442
343 Ga0495652_0218332 3300046529 Bacteria 1434
344 Ga0495654_0117540 3300046530 Bacteria 1207
345 Ga0495640_0038743 3300046533 Bacteria 3351
346 Ga0495640_0051430 3300046533 Bacteria 2832
347 Ga0495587_0016459 3300046536 Bacteria 4599
348 Ga0495645_0020249 3300046543 Bacteria 4797
349 Ga0495622_0000699 3300046557 Bacteria 19021
350 Ga0495622_0030034 3300046557 Bacteria 2539
351 Ga0495622_0032398 3300046557 Bacteria 2441
352 Ga0495622_0108540 3300046557 Bacteria 1271
353 Ga0495622_0172696 3300046557 Bacteria 971
354 Ga0495667_0044118 3300046559 Bacteria 2953
355 Ga0495656_0319067 3300046615 Bacteria 800
356 Ga0495668_0020048 3300046616 Bacteria 3846
357 Ga0495668_0092934 3300046616 Bacteria 1652
358 Ga0495634_0398920 3300046642 Bacteria 817
359 Ga0495625_0526427 3300046660 Bacteria 719
360 Ga0495635_0006765 3300046663 Bacteria 8010
361 Ga0495635_0023237 3300046663 Bacteria 4321
362 Ga0495661_0199095 3300046665 Bacteria 1050
363 Ga0495657_0006673 3300046675 Bacteria 9015
364 Ga0495657_0068992 3300046675 Bacteria 2314
365 Ga0495599_0331056 3300046678 Bacteria 915
366 Ga0495623_0029798 3300046679 Bacteria 3511
367 Ga0495646_0022884 3300046680 Bacteria 3937
368 Ga0495658_0397585 3300046683 Bacteria 878
369 Ga0495613_0036466 3300046689 Bacteria 3646
370 Ga0495613_0046098 3300046689 Bacteria 3224
371 Ga0495613_0473520 3300046689 Bacteria 846
372 Ga0495624_0290679 3300046690 Bacteria 986
373 Ga0495649_0079608 3300046694 Bacteria 1752
374 Ga0495600_0007520 3300046809 Bacteria 6669
375 Ga0495600_0048237 3300046809 Bacteria 2778
376 Ga0495581_0025276 3300047315 Bacteria 3444
377 Ga0495604_0006276 3300047317 Bacteria 9434
378 Ga0495604_0040819 3300047317 Bacteria 3641
379 Ga0495674_0013016 3300047319 Bacteria 7831
380 Ga0495672_0007741 3300047320 Bacteria 8039
381 Ga0495672_0298362 3300047320 Bacteria 764
382 Ga0495676_0021088 3300047321 Bacteria 5702
383 Ga0495680_0007943 3300047322 Bacteria 9680
384 Ga0495683_0054012 3300047323 Bacteria 2003
385 Ga0495683_0180299 3300047323 Bacteria 965
386 Ga0495687_175112 3300047443 Bacteria 706
387 Ga0495675_0003949 3300047444 Bacteria 8991
388 Ga0495673_0108636 3300047469 Bacteria 1112
389 Ga0495673_0185425 3300047469 Bacteria 786
390 Ga0495686_0197279 3300047472 Bacteria 1157
391 Ga0495593_0063295 3300047673 Bacteria 1932
392 Ga0495602_0013244 3300048088 Bacteria 8434
393 Ga0495602_0610040 3300048088 Bacteria 749
394 Ga0496100_0058924 3300048903 Bacteria 2522
395 Ga0496100_0118101 3300048903 Bacteria 1852
396 Ga0496101_0045623 3300048904 Bacteria 3140
397 Ga0496101_0053843 3300048904 Bacteria 2904
398 Ga0496101_0108815 3300048904 Bacteria 2084
399 Ga0496102_0025794 3300048905 Bacteria 5234
400 Ga0496102_0605867 3300048905 Bacteria 1018
401 Ga0496102_0915356 3300048905 Bacteria 798
402 Ga0496102_1026283 3300048905 Bacteria 745
403 Ga0496103_0007433 3300048906 Bacteria 6530
404 Ga0496103_0173750 3300048906 Bacteria 1384
405 Ga0496104_0002707 3300048907 Bacteria 15254
406 Ga0496104_0029300 3300048907 Bacteria 5105
407 Ga0496104_0033366 3300048907 Bacteria 4794
408 Ga0496104_0301152 3300048907 Bacteria 1515
409 Ga0496104_0522280 3300048907 Bacteria 1098
410 Ga0496105_0003571 3300048908 Bacteria 11538
411 Ga0496105_0077048 3300048908 Bacteria 2753
412 Ga0496105_0140306 3300048908 Bacteria 1989
413 Ga0496106_0349625 3300048909 Bacteria 1187
414 Ga0496106_0753678 3300048909 Bacteria 774
415 Ga0496107_0071425 3300048910 Bacteria 2522
416 Ga0496107_0099485 3300048910 Bacteria 2131
417 Ga0496108_0034095 3300048911 Bacteria 4229
418 Ga0496109_0062374 3300048912 Bacteria 3408
419 Ga0496110_0083477 3300048913 Bacteria 2850
420 Ga0496111_0241288 3300048914 Bacteria 1342
421 Ga0496112_0052736 3300048915 Bacteria 3992
422 Ga0496112_0094636 3300048915 Bacteria 2958
423 Ga0496113_0120823 3300048916 Bacteria 2048
424 Ga0496113_0414979 3300048916 Bacteria 1081
425 Ga0496114_0191788 3300048917 Bacteria 1788
426 Ga0496114_0313449 3300048917 Bacteria 1386
427 Ga0496114_0333313 3300048917 Bacteria 1341
428 Ga0496115_0027942 3300048918 Bacteria 4416
429 Ga0496115_0218994 3300048918 Bacteria 1571
430 Ga0496115_0231656 3300048918 Bacteria 1523
431 Ga0496115_0260701 3300048918 Bacteria 1425
432 Ga0496115_0557190 3300048918 Bacteria 915
433 Ga0496115_0627416 3300048918 Bacteria 852
434 Ga0496116_0014259 3300048919 Bacteria 6357
435 Ga0496116_0043348 3300048919 Bacteria 3066
436 Ga0496117_0055450 3300048920 Bacteria 2769
437 Ga0496117_0222959 3300048920 Bacteria 1048
438 Ga0496118_0043905 3300048921 Bacteria 3507
439 Ga0496118_0068846 3300048921 Bacteria 2568
440 Ga0496118_0115119 3300048921 Bacteria 1771
441 Ga0496118_0383671 3300048921 Bacteria 736
442 Ga0496119_0018956 3300048922 Bacteria 5095
443 Ga0496119_0105269 3300048922 Bacteria 1576
444 Ga0496120_0023635 3300048923 Bacteria 3844
445 Ga0496121_0004381 3300048924 Bacteria 19069
446 Ga0496121_0093712 3300048924 Bacteria 2337
447 Ga0496121_0226031 3300048924 Bacteria 1314
448 Ga0496121_0451774 3300048924 Bacteria 828
449 Ga0496122_0087738 3300048925 Bacteria 2136
450 Ga0496122_0188080 3300048925 Bacteria 1222
451 Ga0496123_0105528 3300048926 Bacteria 1626
452 Ga0496124_0095498 3300048927 Bacteria 2416
453 Ga0496124_0269060 3300048927 Bacteria 1249
454 Ga0496125_0051118 3300048928 Bacteria 3412
455 Ga0496125_0064011 3300048928 Bacteria 2927
456 Ga0496125_0104161 3300048928 Bacteria 2079
457 Ga0496125_0256258 3300048928 Bacteria 1100
458 Ga0496126_0020402 3300048929 Bacteria 6498
459 Ga0496126_0041687 3300048929 Bacteria 4246
460 Ga0495682_0027484 3300049460 Bacteria 2110
461 Ga0501031_0022736 3300049568 Bacteria 4087
462 Ga0501032_0000119 3300049569 Bacteria 65020
463 Ga0501033_0015916 3300049570 Bacteria 5696
464 Ga0501033_0019157 3300049570 Bacteria 5174
465 Ga0501034_0000413 3300049571 Bacteria 71861
466 Ga0501034_0001333 3300049571 Bacteria 33330
467 Ga0501034_0024474 3300049571 Bacteria 6142
468 Ga0501034_0031661 3300049571 Bacteria 5373
469 Ga0501034_0045102 3300049571 Bacteria 4456
470 Ga0501036_0000614 3300049572 Bacteria 25905
471 Ga0501037_0000288 3300049573 Bacteria 42724
472 Ga0501037_0005289 3300049573 Bacteria 9393
473 Ga0501038_0000046 3300049574 Bacteria 106465
474 Ga0501039_0000003 3300049575 Bacteria 357424
475 Ga0501039_0488441 3300049575 Bacteria 967
476 Ga0501040_0867520 3300049576 Bacteria 654
477 Ga0501041_0293562 3300049577 Bacteria 1024
478 Ga0501041_0551734 3300049577 Bacteria 734
479 Ga0501043_0000051 3300049579 Bacteria 106957
480 Ga0501046_0452338 3300049580 Bacteria 923
481 Ga0501047_0358203 3300049581 Bacteria 1295
482 Ga0501047_0615906 3300049581 Bacteria 906
483 Ga0501047_0957430 3300049581 Bacteria 669
484 Ga0501071_0661671 3300049587 Bacteria 804
485 Ga0501072_0340796 3300049588 Bacteria 1191
486 Ga0501073_0504863 3300049589 Bacteria 836
487 Ga0501075_0373526 3300049591 Bacteria 1087
488 Ga0501077_0101197 3300049593 Bacteria 1826
489 Ga0501035_0000102 3300049822 Bacteria 106915
490 Ga0501035_0243868 3300049822 Bacteria 1528
491 Ga0501044_0001230 3300049823 Bacteria 30435
492 Ga0501044_0135164 3300049823 Bacteria 2457
493 nmdc:mga03n38_171368_c1 3300050490 Bacteria 1106
494 nmdc:mga00v17_17467_c1 3300050491 Bacteria 4062
495 nmdc:mga0yw44_322388_c1 3300050492 Bacteria 1038
496 nmdc:mga0yw44_9102_c1 3300050492 Bacteria 4995
497 nmdc:mga0k408_75413_c1 3300050493 Bacteria 1971
498 nmdc:mga0k408_91430_c1 3300050493 Bacteria 1788
499 nmdc:mga06z11_35953_c1 3300050494 Bacteria 2441
500 nmdc:mga04h51_8605_c1 3300050495 Bacteria 2734
501 nmdc:mga07m45_12697_c1 3300050496 Bacteria 4454
502 nmdc:mga07m45_14394_c1 3300050496 Bacteria 4213
503 nmdc:mga05p37_329011_c1 3300050507 Bacteria 1806
504 nmdc:mga05p37_541177_c1 3300050507 Bacteria 1328
505 nmdc:mga05p37_603096_c1 3300050507 Bacteria 1239
506 nmdc:mga05p37_85288_c1 3300050507 Bacteria 3891
507 nmdc:mga09592_502459_c1 3300050508 Bacteria 1044
508 nmdc:mga0qj67_107560_c1 3300050509 Bacteria 2250
509 nmdc:mga06r32_61080_c1 3300050510 Bacteria 3627
510 nmdc:mga08y16_125828_c1 3300050511 Bacteria 2666
511 nmdc:mga08y16_4733_c1 3300050511 Bacteria 14195
512 nmdc:mga08y16_95603_c1 3300050511 Bacteria 3095
513 nmdc:mga0n895_146074_c1 3300050512 Bacteria 2394
514 nmdc:mga0n895_193085_c1 3300050512 Bacteria 2067
515 nmdc:mga0n895_567399_c1 3300050512 Bacteria 1140
516 nmdc:mga08x19_518073_c1 3300050514 Bacteria 842
517 nmdc:mga0a205_10887_c1 3300050515 Bacteria 8369
518 nmdc:mga0a205_265521_c1 3300050515 Bacteria 1594
519 nmdc:mga0a205_891617_c1 3300050515 Bacteria 736
520 nmdc:mga0sz30_50125_c1 3300050516 Bacteria 1770
521 nmdc:mga0sz30_50701_c1 3300050516 Bacteria 1760
522 Ga0500610_0355241 3300053079 Bacteria 618
523 Ga0495655_0044091 3300053083 Bacteria 1152
524 Ga0495595_0155847 3300053084 Bacteria 1125
525 Ga0495619_0046460 3300053085 Bacteria 2855
526 Ga0500578_0123944 3300053086 Bacteria 1623
527 Ga0500643_000047 3300053087 Bacteria 148938
528 Ga0500643_008375 3300053087 Bacteria 4065
529 Ga0500651_0035166 3300053093 Bacteria 3158
530 Ga0500651_0320785 3300053093 Bacteria 885
531 Ga0500566_0027227 3300053094 Bacteria 3345
532 Ga0500566_0141474 3300053094 Bacteria 1276
533 Ga0500640_034386 3300053095 Bacteria 2226
534 Ga0500650_0163777 3300053098 Bacteria 1025
535 Ga0500555_007180 3300053103 Bacteria 3165
536 Ga0500555_051460 3300053103 Bacteria 1126
537 Ga0500556_0000326 3300053104 Bacteria 35770
538 Ga0500556_0128367 3300053104 Bacteria 992
539 Ga0500558_169387 3300053106 Bacteria 792
540 Ga0500595_033458 3300053119 Bacteria 1706
541 Ga0500595_045758 3300053119 Bacteria 1380
542 Ga0500614_070537 3300053123 Bacteria 958
543 Ga0500618_037738 3300053125 Bacteria 1116
544 Ga0500642_0008914 3300053130 Bacteria 3456
545 Ga0500642_0010822 3300053130 Bacteria 3235
546 Ga0500655_004973 3300053133 Bacteria 2390
547 Ga0500658_0112542 3300053134 Bacteria 1199
548 Ga0500658_0420634 3300053134 Bacteria 610
549 Ga0500559_0028573 3300053136 Bacteria 2383
550 Ga0500568_0067797 3300053139 Bacteria 1370
551 Ga0500573_0262309 3300053140 Bacteria 884
552 Ga0500577_0052342 3300053142 Bacteria 1539
553 Ga0500589_187102 3300053147 Bacteria 808
554 Ga0500590_230533 3300053148 Bacteria 755
555 Ga0500616_0002793 3300053153 Bacteria 14061
556 Ga0500616_0087570 3300053153 Bacteria 1550
557 Ga0500620_016927 3300053155 Bacteria 2093
558 Ga0500622_0006265 3300053156 Bacteria 6952
559 Ga0500633_0067440 3300053160 Bacteria 1272
560 Ga0500638_019612 3300053162 Bacteria 3172
561 Ga0500637_0002010 3300053178 Bacteria 8872
562 Ga0500609_025756 3300053731 Bacteria 806
563 Ga0500552_002212 3300053733 Bacteria 1885
564 Ga0500599_000212 3300053736 Bacteria 5460
565 Ga0500601_000078 3300053737 Bacteria 20015
566 Ga0500661_005887 3300055283 Bacteria 2286
567 Ga0501082_0254233 3300060353 Bacteria 1529
568 Ga0501082_0305812 3300060353 Bacteria 1385

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10104812 Ga0207708_101048121 168
2 3300005844 Ga0068862_100088409 Ga0068862_1000884093 169
3 3300028380 Ga0268265_10124676 Ga0268265_101246763 169
4 3300046615 Ga0495656_0319067 Ga0495656_0319067_59_652 171
5 3300028800 Ga0265338_10022804 Ga0265338_100228045 172
6 3300044735 Ga0466968_0129873 Ga0466968_0129873_131_727 173
7 3300048903 Ga0496100_0118101 Ga0496100_0118101_1283_1837 178
8 3300005937 Ga0081455_10000086 Ga0081455_1000008629 179
9 3300006844 Ga0075428_100699522 Ga0075428_1006995222 179
10 3300009094 Ga0111539_10016218 Ga0111539_100162189 179
11 3300050511 nmdc:mga08y16_4733_c1 nmdc:mga08y16_4733_c1_2415_3044 179
12 3300005328 Ga0070676_10313696 Ga0070676_103136962 183
13 3300005841 Ga0068863_100125930 Ga0068863_1001259302 183
14 3300006880 Ga0075429_100325787 Ga0075429_1003257872 183
15 3300021361 Ga0213872_10087414 Ga0213872_100874142 183
16 3300021384 Ga0213876_10267544 Ga0213876_102675441 183
17 3300025907 Ga0207645_10510000 Ga0207645_105100001 183
18 3300026088 Ga0207641_10106892 Ga0207641_101068922 183
19 3300028563 Ga0265319_1051150 Ga0265319_10511502 183
20 3300028573 Ga0265334_10006729 Ga0265334_100067293 183
21 3300028800 Ga0265338_10026523 Ga0265338_100265233 183
22 3300028800 Ga0265338_10083442 Ga0265338_100834422 183
23 3300028800 Ga0265338_10094210 Ga0265338_100942102 183
24 3300031240 Ga0265320_10115032 Ga0265320_101150321 183
25 3300031251 Ga0265327_10074629 Ga0265327_100746292 183
26 3300035692 Ga0373935_0303963 Ga0373935_0303963_228_821 183
27 3300037466 Ga0395898_0198937 Ga0395898_0198937_935_1534 183
28 3300039062 Ga0400483_118604 Ga0400483_118604_449_1018 183
29 3300039062 Ga0400483_156125 Ga0400483_156125_503_1096 183
30 3300039438 Ga0436360_1213167 Ga0436360_1213167_77_670 183
31 3300039447 Ga0436361_0552255 Ga0436361_0552255_120_719 183
32 3300039447 Ga0436361_0805306 Ga0436361_0805306_2202_2801 183
33 3300039453 Ga0436362_1067038 Ga0436362_1067038_354_947 183
34 3300044683 Ga0466965_0035434 Ga0466965_0035434_1207_1800 183
35 3300045049 Ga0466959_0057334 Ga0466959_0057334_1607_2200 183
36 3300046455 Ga0495603_0045503 Ga0495603_0045503_398_955 183
37 3300046457 Ga0495590_0046319 Ga0495590_0046319_52_609 183
38 3300046516 Ga0495628_0174794 Ga0495628_0174794_741_1307 183
39 3300046517 Ga0495630_0035846 Ga0495630_0035846_3004_3570 183
40 3300046528 Ga0495642_0053360 Ga0495642_0053360_260_817 183
41 3300046529 Ga0495652_0216450 Ga0495652_0216450_536_1126 183
42 3300046557 Ga0495622_0000699 Ga0495622_0000699_16102_16659 183
43 3300046557 Ga0495622_0108540 Ga0495622_0108540_441_1007 183
44 3300046557 Ga0495622_0172696 Ga0495622_0172696_27_587 183
45 3300046616 Ga0495668_0092934 Ga0495668_0092934_410_967 183
46 3300046683 Ga0495658_0397585 Ga0495658_0397585_229_786 183
47 3300047320 Ga0495672_0007741 Ga0495672_0007741_3198_3755 183
48 3300048909 Ga0496106_0349625 Ga0496106_0349625_374_964 183
49 3300048910 Ga0496107_0071425 Ga0496107_0071425_345_935 183
50 3300048918 Ga0496115_0231656 Ga0496115_0231656_122_712 183
51 3300048918 Ga0496115_0627416 Ga0496115_0627416_40_636 183
52 3300049581 Ga0501047_0957430 Ga0501047_0957430_23_625 183
53 3300053087 Ga0500643_008375 Ga0500643_008375_1437_2030 183
54 3300053103 Ga0500555_051460 Ga0500555_051460_411_1004 183
55 3300053119 Ga0500595_045758 Ga0500595_045758_632_1189 183
56 3300053133 Ga0500655_004973 Ga0500655_004973_592_1149 183
57 3300053178 Ga0500637_0002010 Ga0500637_0002010_1645_2202 183
58 3300013308 Ga0157375_10371631 Ga0157375_103716311 184
59 3300014326 Ga0157380_10294294 Ga0157380_102942942 184
60 3300039062 Ga0400483_075974 Ga0400483_075974_2210_2773 184
61 3300039062 Ga0400483_085672 Ga0400483_085672_1040_1606 184
62 3300039062 Ga0400483_115380 Ga0400483_115380_853_1416 184
63 3300039062 Ga0400483_216717 Ga0400483_216717_622_1215 184
64 3300039062 Ga0400483_238163 Ga0400483_238163_395_961 184
65 3300046520 Ga0495637_0146650 Ga0495637_0146650_26_649 184
66 3300047320 Ga0495672_0298362 Ga0495672_0298362_20_655 184
67 3300049570 Ga0501033_0019157 Ga0501033_0019157_1258_1863 184
68 3300049571 Ga0501034_0024474 Ga0501034_0024474_5395_6000 184
69 3300049573 Ga0501037_0005289 Ga0501037_0005289_7884_8489 184
70 3300049576 Ga0501040_0867520 Ga0501040_0867520_26_601 184
71 3300049577 Ga0501041_0293562 Ga0501041_0293562_393_956 184
72 3300049581 Ga0501047_0358203 Ga0501047_0358203_641_1246 184
73 3300049822 Ga0501035_0243868 Ga0501035_0243868_306_911 184
74 3300049823 Ga0501044_0135164 Ga0501044_0135164_1833_2438 184
75 3300050491 nmdc:mga00v17_17467_c1 nmdc:mga00v17_17467_c1_2287_2847 184
76 3300006852 Ga0075433_10188624 Ga0075433_101886242 185
77 3300048905 Ga0496102_0605867 Ga0496102_0605867_184_744 185
78 3300053098 Ga0500650_0163777 Ga0500650_0163777_407_976 185
79 3300005578 Ga0068854_101011280 Ga0068854_1010112801 187
80 3300009093 Ga0105240_10002871 Ga0105240_100028715 187
81 3300009551 Ga0105238_10005018 Ga0105238_1000501811 187
82 3300010375 Ga0105239_10296140 Ga0105239_102961403 187
83 3300020082 Ga0206353_11573899 Ga0206353_115738991 187
84 3300025321 Ga0207656_10016053 Ga0207656_100160533 187
85 3300035241 Ga0373961_0242858 Ga0373961_0242858_40_612 187
86 3300035695 Ga0373927_0001984 Ga0373927_0001984_3508_4071 187
87 3300035724 Ga0373933_0000038 Ga0373933_0000038_70635_71198 187
88 3300036401 Ga0373937_0231953 Ga0373937_0231953_50_634 187
89 3300039437 Ga0436365_0365623 Ga0436365_0365623_17898_18464 187
90 3300039437 Ga0436365_1902327 Ga0436365_1902327_306_878 187
91 3300039438 Ga0436360_0753528 Ga0436360_0753528_57_623 187
92 3300039450 Ga0436363_1007251 Ga0436363_1007251_248_814 187
93 3300039453 Ga0436362_0272811 Ga0436362_0272811_298_864 187
94 3300045976 Ga0466967_0606679 Ga0466967_0606679_198_761 187
95 3300046462 Ga0495651_0666486 Ga0495651_0666486_45_629 187
96 3300046507 Ga0495606_0192703 Ga0495606_0192703_23_586 187
97 3300046518 Ga0495631_0098170 Ga0495631_0098170_688_1251 187
98 3300046524 Ga0495648_0169772 Ga0495648_0169772_50_613 187
99 3300046530 Ga0495654_0117540 Ga0495654_0117540_30_593 187
100 3300046660 Ga0495625_0526427 Ga0495625_0526427_21_584 187
101 3300046689 Ga0495613_0473520 Ga0495613_0473520_52_615 187
102 3300048905 Ga0496102_1026283 Ga0496102_1026283_24_596 187
103 3300050511 nmdc:mga08y16_125828_c1 nmdc:mga08y16_125828_c1_2078_2650 187
104 3300050515 nmdc:mga0a205_891617_c1 nmdc:mga0a205_891617_c1_137_709 187
105 3300053079 Ga0500610_0355241 Ga0500610_0355241_31_594 187
106 3300053130 Ga0500642_0010822 Ga0500642_0010822_32_595 187
107 3300053134 Ga0500658_0420634 Ga0500658_0420634_20_583 187
108 iso_pu_bacteria 2854681122 2854681172 187
109 iso_pu_bacteria 3000017691 3000020693 187
110 iso_pu_bacteria 2899259804 2899260895 188
111 3300009147 Ga0114129_10542625 Ga0114129_105426251 189
112 3300050507 nmdc:mga05p37_541177_c1 nmdc:mga05p37_541177_c1_31_666 189
113 iso_pu_bacteria 2898795034 2898795676 189
114 iso_pu_bacteria 2834578030 2834578240 190
115 iso_pu_bacteria 2919679072 2919680417 190
116 iso_pu_bacteria 3000405567 3000408205 190
117 3300006051 Ga0075364_10039975 Ga0075364_100399751 191
118 3300046462 Ga0495651_0233019 Ga0495651_0233019_614_1243 191
119 3300049589 Ga0501073_0504863 Ga0501073_0504863_58_642 191
120 iso_pu_bacteria 2713897090 2715498755 191
121 iso_pu_bacteria 2836160341 2836163271 191
122 iso_pu_bacteria 2855020534 2855021251 191
123 iso_pu_bacteria 2899275550 2899279114 191
124 iso_pu_bacteria 8057132660 8057135055 191
125 3300032133 Ga0316583_10047508 Ga0316583_100475081 192
126 3300031727 Ga0316576_10008259 Ga0316576_100082592 193
127 3300037068 Ga0373925_0417112 Ga0373925_0417112_337_924 193
128 3300039062 Ga0400483_080646 Ga0400483_080646_10228_10812 193
129 3300039062 Ga0400483_114150 Ga0400483_114150_1150_1749 193
130 3300039062 Ga0400483_212347 Ga0400483_212347_943_1533 193
131 3300039062 Ga0400483_229872 Ga0400483_229872_1327_1911 193
132 3300039062 Ga0400483_242397 Ga0400483_242397_497_1096 193
133 3300049571 Ga0501034_0000413 Ga0501034_0000413_38382_38981 193
134 3300049575 Ga0501039_0488441 Ga0501039_0488441_296_886 193
135 3300049587 Ga0501071_0661671 Ga0501071_0661671_189_779 193
136 3300049588 Ga0501072_0340796 Ga0501072_0340796_96_686 193
137 3300049591 Ga0501075_0373526 Ga0501075_0373526_23_613 193
138 3300003911 JGI25405J52794_10074805 JGI25405J52794_100748051 194
139 3300005937 Ga0081455_10002017 Ga0081455_100020178 194
140 3300005937 Ga0081455_10058037 Ga0081455_100580374 194
141 3300006028 Ga0070717_11080557 Ga0070717_110805571 195
142 3300039437 Ga0436365_0434683 Ga0436365_0434683_108_695 195
143 3300031824 Ga0307413_10185353 Ga0307413_101853532 196
144 3300031852 Ga0307410_10236883 Ga0307410_102368833 196
145 3300031995 Ga0307409_100073567 Ga0307409_1000735674 196
146 3300032002 Ga0307416_100126903 Ga0307416_1001269032 196
147 3300032005 Ga0307411_10028563 Ga0307411_100285634 196
148 3300032126 Ga0307415_100183628 Ga0307415_1001836282 196
149 3300037853 Ga0436364_0531241 Ga0436364_0531241_76_669 196
150 3300026088 Ga0207641_10512830 Ga0207641_105128302 197
151 3300028800 Ga0265338_10026178 Ga0265338_100261786 197
152 3300032002 Ga0307416_101039223 Ga0307416_1010392232 197
153 3300032002 Ga0307416_101174244 Ga0307416_1011742441 197
154 3300049568 Ga0501031_0022736 Ga0501031_0022736_3293_3901 197
155 3300049569 Ga0501032_0000119 Ga0501032_0000119_46058_46666 197
156 3300049570 Ga0501033_0015916 Ga0501033_0015916_143_751 197
157 3300049571 Ga0501034_0001333 Ga0501034_0001333_14368_14976 197
158 3300049571 Ga0501034_0045102 Ga0501034_0045102_3082_3693 197
159 3300049572 Ga0501036_0000614 Ga0501036_0000614_143_751 197
160 3300049573 Ga0501037_0000288 Ga0501037_0000288_130_738 197
161 3300049574 Ga0501038_0000046 Ga0501038_0000046_18255_18863 197
162 3300049575 Ga0501039_0000003 Ga0501039_0000003_8765_9373 197
163 3300049577 Ga0501041_0551734 Ga0501041_0551734_32_640 197
164 3300049579 Ga0501043_0000051 Ga0501043_0000051_106187_106795 197
165 3300049580 Ga0501046_0452338 Ga0501046_0452338_197_805 197
166 3300049581 Ga0501047_0615906 Ga0501047_0615906_120_728 197
167 3300049822 Ga0501035_0000102 Ga0501035_0000102_161_769 197
168 3300049823 Ga0501044_0001230 Ga0501044_0001230_27411_28019 197
169 3300005347 Ga0070668_100011847 Ga0070668_1000118472 198
170 3300005617 Ga0068859_100133756 Ga0068859_1001337562 198
171 3300006931 Ga0097620_100133751 Ga0097620_1001337512 198
172 3300025949 Ga0207667_10231534 Ga0207667_102315342 198
173 3300025972 Ga0207668_10015251 Ga0207668_100152512 198
174 3300039450 Ga0436363_1378300 Ga0436363_1378300_2230_2826 198
175 3300045051 Ga0451576_0001020 Ga0451576_0001020_18871_19479 198
176 3300005549 Ga0070704_100169462 Ga0070704_1001694623 199
177 3300005615 Ga0070702_100224953 Ga0070702_1002249532 199
178 3300011119 Ga0105246_10056523 Ga0105246_100565233 199
179 3300014969 Ga0157376_10675816 Ga0157376_106758161 199
180 3300025932 Ga0207690_10003499 Ga0207690_100034997 199
181 3300026041 Ga0207639_10029266 Ga0207639_100292662 199
182 3300026067 Ga0207678_10108119 Ga0207678_101081192 199
183 3300037312 Ga0395899_0000026 Ga0395899_0000026_302715_303401 199
184 3300048924 Ga0496121_0451774 Ga0496121_0451774_154_774 199
185 3300049571 Ga0501034_0031661 Ga0501034_0031661_4551_5177 199
186 3300053104 Ga0500556_0000326 Ga0500556_0000326_14929_15552 199
187 3300053153 Ga0500616_0002793 Ga0500616_0002793_1176_1799 199
188 iso_pu_bacteria 2840878972 2840881608 199
189 3300009147 Ga0114129_10173299 Ga0114129_101732994 200
190 3300039437 Ga0436365_0711553 Ga0436365_0711553_73815_74477 200
191 3300039450 Ga0436363_0149506 Ga0436363_0149506_1389_2051 200
192 3300050507 nmdc:mga05p37_329011_c1 nmdc:mga05p37_329011_c1_584_1195 200
193 3300050510 nmdc:mga06r32_61080_c1 nmdc:mga06r32_61080_c1_639_1250 200
194 iso_pu_bacteria 2513237094 2513637092 200
195 iso_pu_bacteria 2513237095 2513652525 200
196 iso_pu_bacteria 2513237102 2513705958 200
197 iso_pu_bacteria 2513237161 2514012296 200
198 iso_pu_bacteria 2517093001 2517104794 200
199 iso_pu_bacteria 2528768022 2528855363 200
200 iso_pu_bacteria 2617270741 2617373121 200
201 iso_pu_bacteria 2791355196 2793061266 200
202 iso_pu_bacteria 2802429603 2805918639 200
203 iso_pu_bacteria 2816332527 2818236975 200
204 iso_pu_bacteria 2824617872 2824625792 200
205 iso_pu_bacteria 2824626560 2824633810 200
206 iso_pu_bacteria 2824635225 2824642189 200
207 iso_pu_bacteria 2824644064 2824649593 200
208 iso_pu_bacteria 2824661429 2824670340 200
209 iso_pu_bacteria 2824671348 2824678120 200
210 iso_pu_bacteria 2824679649 2824686634 200
211 iso_pu_bacteria 2824687955 2824694248 200
212 iso_pu_bacteria 2824696289 2824703078 200
213 iso_pu_bacteria 2824704595 2824711776 200
214 iso_pu_bacteria 2824714736 2824719552 200
215 iso_pu_bacteria 2824723954 2824729981 200
216 iso_pu_bacteria 2824732956 2824739101 200
217 iso_pu_bacteria 2824746037 2824751974 200
218 iso_pu_bacteria 2824753945 2824763105 200
219 iso_pu_bacteria 2824763712 2824772895 200
220 iso_pu_bacteria 2824773399 2824779681 200
221 iso_pu_bacteria 2838122688 2838127123 200
222 iso_pu_bacteria 2841941048 2841947360 200
223 iso_pu_bacteria 2841949485 2841955851 200
224 iso_pu_bacteria 2841957949 2841961702 200
225 iso_pu_bacteria 2841966195 2841974316 200
226 iso_pu_bacteria 2841974524 2841981024 200
227 iso_pu_bacteria 2841983080 2841987223 200
228 iso_pu_bacteria 2842038055 2842041147 200
229 iso_pu_bacteria 2842045827 2842045908 200
230 iso_pu_bacteria 2844315083 2844320395 200
231 iso_pu_bacteria 2847939898 2847948164 200
232 iso_pu_bacteria 2849076700 2849077928 200
233 iso_pu_bacteria 2874620515 2874625740 200
234 iso_pu_bacteria 2874628541 2874632920 200
235 iso_pu_bacteria 2879099564 2879105408 200
236 iso_pu_bacteria 2881364244 2881370348 200
237 iso_pu_bacteria 2885366525 2885368356 200
238 iso_pu_bacteria 2888378607 2888385900 200
239 iso_pu_bacteria 2903727486 2903732944 200
240 iso_pu_bacteria 2904666416 2904673899 200
241 iso_pu_bacteria 2904711408 2904711491 200
242 iso_pu_bacteria 2906602504 2906607276 200
243 iso_pu_bacteria 2906626472 2906630215 200
244 iso_pu_bacteria 2908775508 2908781573 200
245 iso_pu_bacteria 2922368715 2922376208 200
246 iso_pu_bacteria 2922393267 2922393588 200
247 iso_pu_bacteria 2929615660 2929622986 200
248 iso_pu_bacteria 2929624759 2929631581 200
249 iso_pu_bacteria 2932784394 2932789371 200
250 iso_pu_bacteria 2932794094 2932797713 200
251 iso_pu_bacteria 2932801729 2932804231 200
252 iso_pu_bacteria 2932809354 2932816417 200
253 iso_pu_bacteria 2932818245 2932822000 200
254 iso_pu_bacteria 2932828146 2932831978 200
255 iso_pu_bacteria 2933577622 2933584810 200
256 iso_pu_bacteria 2935616580 2935621917 200
257 iso_pu_bacteria 2935638405 2935644074 200
258 iso_pu_bacteria 2935665750 2935669012 200
259 iso_pu_bacteria 2935675223 2935683686 200
260 iso_pu_bacteria 2935684952 2935692374 200
261 iso_pu_bacteria 2935694250 2935700458 200
262 iso_pu_bacteria 2935703347 2935708914 200
263 iso_pu_bacteria 2935713505 2935720388 200
264 iso_pu_bacteria 2935722832 2935729669 200
265 iso_pu_bacteria 2935732158 2935739349 200
266 iso_pu_bacteria 2935741537 2935748110 200
267 iso_pu_bacteria 2935750917 2935758313 200
268 iso_pu_bacteria 2935760218 2935767392 200
269 iso_pu_bacteria 2935777560 2935781291 200
270 iso_pu_bacteria 2935801545 2935805728 200
271 iso_pu_bacteria 2935810662 2935815716 200
272 iso_pu_bacteria 2935827899 2935833325 200
273 iso_pu_bacteria 2935837841 2935842028 200
274 iso_pu_bacteria 2935855204 2935860164 200
275 iso_pu_bacteria 2935864058 2935867560 200
276 iso_pu_bacteria 2935873716 2935878629 200
277 iso_pu_bacteria 2935883170 2935890412 200
278 iso_pu_bacteria 2935959822 2935965239 200
279 iso_pu_bacteria 2935992306 2935998093 200
280 iso_pu_bacteria 2936002035 2936006794 200
281 iso_pu_bacteria 2936037263 2936040954 200
282 iso_pu_bacteria 2940556831 2940564217 200
283 iso_pu_bacteria 2941538514 2941546579 200
284 iso_pu_bacteria 3005483717 3005486209 200
285 iso_pu_bacteria 3005587118 3005588474 200
286 iso_pu_bacteria 3005710791 3005716189 200
287 iso_pu_bacteria 3005718088 3005723564 200
288 iso_pu_bacteria 8016511872 8016520198 200
289 iso_pu_bacteria 8016522445 8016528103 200
290 iso_pu_bacteria 8016530956 8016533233 200
291 iso_pu_bacteria 8016539877 8016546472 200
292 iso_pu_bacteria 8016557553 8016564009 200
293 iso_pu_bacteria 8016566248 8016571555 200
294 iso_pu_bacteria 8016575299 8016575802 200
295 iso_pu_bacteria 8016595262 8016601720 200
296 iso_pu_bacteria 8016613128 8016616332 200
297 iso_pu_bacteria 8016622563 8016624803 200
298 iso_pu_bacteria 8017057580 8017065363 200
299 iso_pu_bacteria 8019530166 8019533025 200
300 iso_pu_bacteria 8019538911 8019546824 200
301 iso_pu_bacteria 8019547302 8019551846 200
302 iso_pu_bacteria 8019576017 8019584749 200
303 iso_pu_bacteria 8019597564 8019598754 200
304 iso_pu_bacteria 8019608314 8019609620 200
305 iso_pu_bacteria 8019648815 8019655653 200
306 iso_pu_bacteria 8055742211 8055744652 200
307 3300005937 Ga0081455_10098227 Ga0081455_100982273 201
308 3300006844 Ga0075428_100495259 Ga0075428_1004952592 201
309 3300006846 Ga0075430_100009804 Ga0075430_1000098049 201
310 3300006847 Ga0075431_100005807 Ga0075431_10000580710 201
311 3300006914 Ga0075436_100349687 Ga0075436_1003496872 201
312 3300021377 Ga0213874_10103358 Ga0213874_101033582 201
313 3300035691 Ga0373931_0171794 Ga0373931_0171794_48_662 201
314 3300039447 Ga0436361_0779011 Ga0436361_0779011_126_731 201
315 3300050507 nmdc:mga05p37_603096_c1 nmdc:mga05p37_603096_c1_494_1111 201
316 3300050507 nmdc:mga05p37_85288_c1 nmdc:mga05p37_85288_c1_2909_3523 201
317 3300050508 nmdc:mga09592_502459_c1 nmdc:mga09592_502459_c1_310_927 201
318 3300050509 nmdc:mga0qj67_107560_c1 nmdc:mga0qj67_107560_c1_997_1614 201
319 3300050512 nmdc:mga0n895_146074_c1 nmdc:mga0n895_146074_c1_419_1033 201
320 3300050514 nmdc:mga08x19_518073_c1 nmdc:mga08x19_518073_c1_163_777 201
321 iso_pu_bacteria 2513237104 2513719093 201
322 iso_pu_bacteria 2906643746 2906651279 201
323 3300005336 Ga0070680_100035084 Ga0070680_1000350844 203
324 3300005434 Ga0070709_10004640 Ga0070709_100046404 203
325 3300005435 Ga0070714_100125504 Ga0070714_1001255042 203
326 3300005436 Ga0070713_100621165 Ga0070713_1006211652 203
327 3300005437 Ga0070710_10000534 Ga0070710_1000053418 203
328 3300005439 Ga0070711_100000548 Ga0070711_1000005484 203
329 3300005530 Ga0070679_100203108 Ga0070679_1002031082 203
330 3300005563 Ga0068855_100200177 Ga0068855_1002001773 203
331 3300005614 Ga0068856_100058718 Ga0068856_1000587183 203
332 3300005616 Ga0068852_100010119 Ga0068852_1000101193 203
333 3300005983 Ga0081540_1069864 Ga0081540_10698642 203
334 3300006028 Ga0070717_10088384 Ga0070717_100883843 203
335 3300006175 Ga0070712_100205525 Ga0070712_1002055252 203
336 3300006852 Ga0075433_10000513 Ga0075433_1000051321 203
337 3300009551 Ga0105238_10560970 Ga0105238_105609702 203
338 3300021358 Ga0213873_10018929 Ga0213873_100189292 203
339 3300021384 Ga0213876_10069397 Ga0213876_100693973 203
340 3300025898 Ga0207692_10000091 Ga0207692_1000009118 203
341 3300025906 Ga0207699_10000782 Ga0207699_1000078216 203
342 3300025915 Ga0207693_10029076 Ga0207693_100290765 203
343 3300025916 Ga0207663_10047322 Ga0207663_100473222 203
344 3300025917 Ga0207660_10048097 Ga0207660_100480973 203
345 3300025924 Ga0207694_10266785 Ga0207694_102667853 203
346 3300025928 Ga0207700_10018197 Ga0207700_100181974 203
347 3300025929 Ga0207664_10023054 Ga0207664_100230544 203
348 3300025949 Ga0207667_10050013 Ga0207667_100500132 203
349 3300026041 Ga0207639_11000265 Ga0207639_110002651 203
350 3300026078 Ga0207702_10579719 Ga0207702_105797192 203
351 3300027907 Ga0207428_10221335 Ga0207428_102213352 203
352 3300035085 Ga0373929_0059958 Ga0373929_0059958_215_853 203
353 3300035088 Ga0373940_0008127 Ga0373940_0008127_646_1284 203
354 3300035112 Ga0373932_0003500 Ga0373932_0003500_1375_2013 203
355 3300035121 Ga0373960_0080014 Ga0373960_0080014_19_657 203
356 3300035691 Ga0373931_0000351 Ga0373931_0000351_2606_3244 203
357 3300046507 Ga0495606_0053725 Ga0495606_0053725_1217_1834 203
358 3300050511 nmdc:mga08y16_95603_c1 nmdc:mga08y16_95603_c1_632_1270 203
359 3300050512 nmdc:mga0n895_567399_c1 nmdc:mga0n895_567399_c1_113_751 203
360 3300050515 nmdc:mga0a205_10887_c1 nmdc:mga0a205_10887_c1_2075_2713 203
361 3300060353 Ga0501082_0254233 Ga0501082_0254233_717_1346 203
362 3300060353 Ga0501082_0305812 Ga0501082_0305812_461_1087 203
363 3300003214 JGI25165J46597_1005214 JGI25165J46597_10052143 204
364 3300003215 JGI25153J46596_10002451 JGI25153J46596_100024514 204
365 3300003215 JGI25153J46596_10019495 JGI25153J46596_100194953 204
366 3300003215 JGI25153J46596_10021561 JGI25153J46596_100215613 204
367 3300003215 JGI25153J46596_10052238 JGI25153J46596_100522381 204
368 3300003354 JGI25160J50197_1000862 JGI25160J50197_100086215 204
369 3300003354 JGI25160J50197_1001471 JGI25160J50197_100147110 204
370 3300003762 Ga0055542_1003091 Ga0055542_10030914 204
371 3300004625 Ga0055543_1004845 Ga0055543_10048454 204
372 3300005262 Ga0065165_1002362 Ga0065165_10023626 204
373 3300005262 Ga0065165_1006702 Ga0065165_10067023 204
374 3300005329 Ga0070683_100069621 Ga0070683_1000696212 204
375 3300005336 Ga0070680_100012456 Ga0070680_1000124566 204
376 3300005339 Ga0070660_100023176 Ga0070660_1000231764 204
377 3300005347 Ga0070668_100006917 Ga0070668_1000069172 204
378 3300005347 Ga0070668_100075380 Ga0070668_1000753804 204
379 3300005355 Ga0070671_100023510 Ga0070671_1000235103 204
380 3300005367 Ga0070667_100043976 Ga0070667_1000439761 204
381 3300005444 Ga0070694_100031808 Ga0070694_1000318083 204
382 3300005455 Ga0070663_100024485 Ga0070663_1000244853 204
383 3300005455 Ga0070663_100342056 Ga0070663_1003420562 204
384 3300005458 Ga0070681_10013695 Ga0070681_100136956 204
385 3300005459 Ga0068867_100696245 Ga0068867_1006962452 204
386 3300005530 Ga0070679_100091249 Ga0070679_1000912493 204
387 3300005535 Ga0070684_100032160 Ga0070684_1000321603 204
388 3300005539 Ga0068853_100022837 Ga0068853_1000228374 204
389 3300005539 Ga0068853_100286902 Ga0068853_1002869023 204
390 3300005545 Ga0070695_100035976 Ga0070695_1000359763 204
391 3300005547 Ga0070693_100105285 Ga0070693_1001052852 204
392 3300005548 Ga0070665_100245353 Ga0070665_1002453532 204
393 3300005563 Ga0068855_100056975 Ga0068855_1000569753 204
394 3300005563 Ga0068855_101271753 Ga0068855_1012717532 204
395 3300005577 Ga0068857_100020685 Ga0068857_1000206855 204
396 3300005577 Ga0068857_100228397 Ga0068857_1002283972 204
397 3300005614 Ga0068856_100262168 Ga0068856_1002621682 204
398 3300005616 Ga0068852_100137152 Ga0068852_1001371522 204
399 3300005719 Ga0068861_100109753 Ga0068861_1001097532 204
400 3300005834 Ga0068851_10054871 Ga0068851_100548712 204
401 3300005841 Ga0068863_100398512 Ga0068863_1003985122 204
402 3300005842 Ga0068858_100078600 Ga0068858_1000786004 204
403 3300005844 Ga0068862_100670901 Ga0068862_1006709012 204
404 3300006038 Ga0075365_10008203 Ga0075365_100082035 204
405 3300006042 Ga0075368_10008255 Ga0075368_100082554 204
406 3300006048 Ga0075363_100007746 Ga0075363_1000077463 204
407 3300006048 Ga0075363_100195103 Ga0075363_1001951032 204
408 3300006051 Ga0075364_10035843 Ga0075364_100358434 204
409 3300006175 Ga0070712_100261472 Ga0070712_1002614722 204
410 3300006178 Ga0075367_10113131 Ga0075367_101131312 204
411 3300006186 Ga0075369_10068346 Ga0075369_100683462 204
412 3300006195 Ga0075366_10006253 Ga0075366_100062534 204
413 3300006195 Ga0075366_10023086 Ga0075366_100230864 204
414 3300006195 Ga0075366_10446679 Ga0075366_104466792 204
415 3300006353 Ga0075370_10136652 Ga0075370_101366522 204
416 3300009093 Ga0105240_10004761 Ga0105240_1000476118 204
417 3300009093 Ga0105240_10007546 Ga0105240_1000754619 204
418 3300009093 Ga0105240_10130948 Ga0105240_101309483 204
419 3300009101 Ga0105247_10105210 Ga0105247_101052102 204
420 3300009174 Ga0105241_10177655 Ga0105241_101776553 204
421 3300009174 Ga0105241_10281291 Ga0105241_102812912 204
422 3300009177 Ga0105248_10047698 Ga0105248_100476984 204
423 3300009545 Ga0105237_10015590 Ga0105237_100155902 204
424 3300009545 Ga0105237_10028914 Ga0105237_100289144 204
425 3300009545 Ga0105237_10998320 Ga0105237_109983201 204
426 3300009551 Ga0105238_10003869 Ga0105238_100038698 204
427 3300009551 Ga0105238_10555258 Ga0105238_105552582 204
428 3300009553 Ga0105249_10446314 Ga0105249_104463142 204
429 3300010375 Ga0105239_10018844 Ga0105239_100188444 204
430 3300010375 Ga0105239_10082874 Ga0105239_100828743 204
431 3300010375 Ga0105239_10109682 Ga0105239_101096823 204
432 3300010375 Ga0105239_10148114 Ga0105239_101481142 204
433 3300013105 Ga0157369_10000685 Ga0157369_100006854 204
434 3300013296 Ga0157374_10070980 Ga0157374_100709803 204
435 3300013308 Ga0157375_10970152 Ga0157375_109701521 204
436 3300014325 Ga0163163_10143448 Ga0163163_101434482 204
437 3300014968 Ga0157379_10203769 Ga0157379_102037692 204
438 3300021320 Ga0214544_1000001 Ga0214544_1000001355 204
439 3300021321 Ga0214542_1000005 Ga0214542_1000005355 204
440 3300021324 Ga0214545_1000003 Ga0214545_1000003409 204
441 3300021324 Ga0214545_1035621 Ga0214545_10356213 204
442 3300021327 Ga0214543_1000002 Ga0214543_1000002358 204
443 3300025253 Ga0209677_104884 Ga0209677_1048842 204
444 3300025254 Ga0209148_1000654 Ga0209148_100065424 204
445 3300025261 Ga0209233_1001456 Ga0209233_10014563 204
446 3300025272 Ga0209455_1010095 Ga0209455_10100952 204
447 3300025295 Ga0209564_1032890 Ga0209564_10328903 204
448 3300025297 Ga0209758_1000320 Ga0209758_100032082 204
449 3300025297 Ga0209758_1001495 Ga0209758_10014957 204
450 3300025297 Ga0209758_1011255 Ga0209758_10112552 204
451 3300025297 Ga0209758_1037460 Ga0209758_10374602 204
452 3300025297 Ga0209758_1060429 Ga0209758_10604292 204
453 3300025297 Ga0209758_1060430 Ga0209758_10604302 204
454 3300025302 Ga0207426_1000746 Ga0207426_100074616 204
455 3300025302 Ga0207426_1004351 Ga0207426_10043514 204
456 3300025304 Ga0209257_1012298 Ga0209257_10122984 204
457 3300025304 Ga0209257_1038158 Ga0209257_10381583 204
458 3300025321 Ga0207656_10138113 Ga0207656_101381132 204
459 3300025901 Ga0207688_10031744 Ga0207688_100317443 204
460 3300025904 Ga0207647_10030422 Ga0207647_100304223 204
461 3300025909 Ga0207705_10032876 Ga0207705_100328763 204
462 3300025911 Ga0207654_10008841 Ga0207654_100088414 204
463 3300025911 Ga0207654_10010107 Ga0207654_100101074 204
464 3300025912 Ga0207707_10001881 Ga0207707_1000188112 204
465 3300025913 Ga0207695_10000503 Ga0207695_1000050322 204
466 3300025913 Ga0207695_10102221 Ga0207695_101022213 204
467 3300025913 Ga0207695_10302211 Ga0207695_103022112 204
468 3300025914 Ga0207671_10263060 Ga0207671_102630602 204
469 3300025914 Ga0207671_10575208 Ga0207671_105752081 204
470 3300025915 Ga0207693_10430565 Ga0207693_104305651 204
471 3300025917 Ga0207660_10005375 Ga0207660_100053755 204
472 3300025919 Ga0207657_10005742 Ga0207657_100057424 204
473 3300025919 Ga0207657_10061871 Ga0207657_100618714 204
474 3300025920 Ga0207649_10642742 Ga0207649_106427421 204
475 3300025921 Ga0207652_10001649 Ga0207652_1000164913 204
476 3300025923 Ga0207681_10609515 Ga0207681_106095151 204
477 3300025924 Ga0207694_10041393 Ga0207694_100413932 204
478 3300025931 Ga0207644_10020693 Ga0207644_100206934 204
479 3300025932 Ga0207690_10137839 Ga0207690_101378392 204
480 3300025932 Ga0207690_10291594 Ga0207690_102915942 204
481 3300025944 Ga0207661_10049173 Ga0207661_100491733 204
482 3300025949 Ga0207667_10037563 Ga0207667_100375633 204
483 3300025949 Ga0207667_10264307 Ga0207667_102643073 204
484 3300025961 Ga0207712_10292993 Ga0207712_102929932 204
485 3300025972 Ga0207668_10191950 Ga0207668_101919502 204
486 3300025972 Ga0207668_10216734 Ga0207668_102167343 204
487 3300025986 Ga0207658_10563461 Ga0207658_105634611 204
488 3300026035 Ga0207703_10561468 Ga0207703_105614682 204
489 3300026041 Ga0207639_10021282 Ga0207639_100212823 204
490 3300026041 Ga0207639_10087060 Ga0207639_100870602 204
491 3300026067 Ga0207678_10036640 Ga0207678_100366404 204
492 3300026067 Ga0207678_10044490 Ga0207678_100444904 204
493 3300026067 Ga0207678_10359567 Ga0207678_103595672 204
494 3300026067 Ga0207678_10632672 Ga0207678_106326722 204
495 3300026078 Ga0207702_10141120 Ga0207702_101411202 204
496 3300026078 Ga0207702_10224566 Ga0207702_102245662 204
497 3300026088 Ga0207641_10303079 Ga0207641_103030793 204
498 3300026089 Ga0207648_10410844 Ga0207648_104108442 204
499 3300026089 Ga0207648_10481755 Ga0207648_104817552 204
500 3300026116 Ga0207674_10023609 Ga0207674_100236096 204
501 3300026116 Ga0207674_10255838 Ga0207674_102558382 204
502 3300026118 Ga0207675_100113164 Ga0207675_1001131643 204
503 3300026142 Ga0207698_10005624 Ga0207698_100056243 204
504 3300026142 Ga0207698_10165117 Ga0207698_101651172 204
505 3300027866 Ga0209813_10039071 Ga0209813_100390712 204
506 3300028379 Ga0268266_10161520 Ga0268266_101615202 204
507 3300028379 Ga0268266_10323426 Ga0268266_103234262 204
508 3300028380 Ga0268265_10925306 Ga0268265_109253062 204
509 3300033180 Ga0307510_10132792 Ga0307510_101327922 204
510 3300034819 Ga0373958_0053448 Ga0373958_0053448_48_683 204
511 3300034820 Ga0373959_0021175 Ga0373959_0021175_266_901 204
512 3300034957 Ga0373938_0041745 Ga0373938_0041745_148_783 204
513 3300035084 Ga0373928_0016212 Ga0373928_0016212_817_1452 204
514 3300035088 Ga0373940_0025751 Ga0373940_0025751_522_1157 204
515 3300035090 Ga0373949_0057201 Ga0373949_0057201_339_974 204
516 3300035114 Ga0373939_0014883 Ga0373939_0014883_1237_1872 204
517 3300037471 Ga0395905_0896989 Ga0395905_0896989_56_670 204
518 3300044658 Ga0466972_0000363 Ga0466972_0000363_13331_13945 204
519 3300044658 Ga0466972_0084083 Ga0466972_0084083_37_651 204
520 3300044658 Ga0466972_0140517 Ga0466972_0140517_28_642 204
521 3300044693 Ga0466961_0201509 Ga0466961_0201509_438_1052 204
522 3300044706 Ga0466964_0071255 Ga0466964_0071255_193_807 204
523 3300044735 Ga0466968_0001648 Ga0466968_0001648_7225_7839 204
524 3300044735 Ga0466968_0037667 Ga0466968_0037667_176_790 204
525 3300044735 Ga0466968_0056259 Ga0466968_0056259_20_634 204
526 3300044765 Ga0466970_0374253 Ga0466970_0374253_127_741 204
527 3300046459 Ga0495629_0000900 Ga0495629_0000900_20286_20900 204
528 3300046460 Ga0495638_0003425 Ga0495638_0003425_9245_9859 204
529 3300046462 Ga0495651_0021715 Ga0495651_0021715_2954_3571 204
530 3300046462 Ga0495651_0051135 Ga0495651_0051135_209_823 204
531 3300046463 Ga0495653_0022549 Ga0495653_0022549_2898_3515 204
532 3300046463 Ga0495653_0227682 Ga0495653_0227682_499_1113 204
533 3300046474 Ga0495605_0119724 Ga0495605_0119724_500_1114 204
534 3300046476 Ga0495662_0103820 Ga0495662_0103820_511_1125 204
535 3300046477 Ga0495664_0005450 Ga0495664_0005450_533_1150 204
536 3300046491 Ga0495584_0260622 Ga0495584_0260622_68_682 204
537 3300046507 Ga0495606_0023497 Ga0495606_0023497_3721_4335 204
538 3300046507 Ga0495606_0035170 Ga0495606_0035170_2480_3094 204
539 3300046511 Ga0495608_0110982 Ga0495608_0110982_783_1397 204
540 3300046512 Ga0495610_0074036 Ga0495610_0074036_541_1155 204
541 3300046512 Ga0495610_0196402 Ga0495610_0196402_78_692 204
542 3300046514 Ga0495618_0379552 Ga0495618_0379552_128_742 204
543 3300046516 Ga0495628_0040123 Ga0495628_0040123_1325_1942 204
544 3300046518 Ga0495631_0206960 Ga0495631_0206960_79_693 204
545 3300046519 Ga0495632_0238846 Ga0495632_0238846_145_759 204
546 3300046522 Ga0495643_0005438 Ga0495643_0005438_5697_6311 204
547 3300046522 Ga0495643_0072904 Ga0495643_0072904_1095_1709 204
548 3300046522 Ga0495643_0223834 Ga0495643_0223834_254_868 204
549 3300046529 Ga0495652_0027943 Ga0495652_0027943_2958_3575 204
550 3300046529 Ga0495652_0218332 Ga0495652_0218332_283_897 204
551 3300046533 Ga0495640_0038743 Ga0495640_0038743_1985_2599 204
552 3300046533 Ga0495640_0051430 Ga0495640_0051430_1045_1662 204
553 3300046536 Ga0495587_0016459 Ga0495587_0016459_1752_2369 204
554 3300046543 Ga0495645_0020249 Ga0495645_0020249_1798_2415 204
555 3300046557 Ga0495622_0030034 Ga0495622_0030034_182_796 204
556 3300046557 Ga0495622_0032398 Ga0495622_0032398_848_1462 204
557 3300046559 Ga0495667_0044118 Ga0495667_0044118_2127_2744 204
558 3300046616 Ga0495668_0020048 Ga0495668_0020048_1603_2217 204
559 3300046642 Ga0495634_0398920 Ga0495634_0398920_178_795 204
560 3300046663 Ga0495635_0006765 Ga0495635_0006765_4591_5205 204
561 3300046663 Ga0495635_0023237 Ga0495635_0023237_893_1510 204
562 3300046665 Ga0495661_0199095 Ga0495661_0199095_415_1029 204
563 3300046675 Ga0495657_0006673 Ga0495657_0006673_2783_3400 204
564 3300046675 Ga0495657_0068992 Ga0495657_0068992_657_1271 204
565 3300046678 Ga0495599_0331056 Ga0495599_0331056_131_748 204
566 3300046679 Ga0495623_0029798 Ga0495623_0029798_37_654 204
567 3300046680 Ga0495646_0022884 Ga0495646_0022884_198_815 204
568 3300046689 Ga0495613_0036466 Ga0495613_0036466_476_1090 204
569 3300046689 Ga0495613_0046098 Ga0495613_0046098_2432_3049 204
570 3300046690 Ga0495624_0290679 Ga0495624_0290679_20_637 204
571 3300046694 Ga0495649_0079608 Ga0495649_0079608_278_892 204
572 3300046809 Ga0495600_0007520 Ga0495600_0007520_1608_2225 204
573 3300046809 Ga0495600_0048237 Ga0495600_0048237_621_1235 204
574 3300047315 Ga0495581_0025276 Ga0495581_0025276_2277_2891 204
575 3300047317 Ga0495604_0006276 Ga0495604_0006276_2990_3607 204
576 3300047317 Ga0495604_0040819 Ga0495604_0040819_2022_2636 204
577 3300047319 Ga0495674_0013016 Ga0495674_0013016_5262_5879 204
578 3300047321 Ga0495676_0021088 Ga0495676_0021088_3901_4515 204
579 3300047322 Ga0495680_0007943 Ga0495680_0007943_6741_7358 204
580 3300047323 Ga0495683_0054012 Ga0495683_0054012_925_1539 204
581 3300047323 Ga0495683_0180299 Ga0495683_0180299_315_929 204
582 3300047443 Ga0495687_175112 Ga0495687_175112_45_659 204
583 3300047444 Ga0495675_0003949 Ga0495675_0003949_6067_6684 204
584 3300047469 Ga0495673_0108636 Ga0495673_0108636_235_849 204
585 3300047469 Ga0495673_0185425 Ga0495673_0185425_91_705 204
586 3300047472 Ga0495686_0197279 Ga0495686_0197279_326_940 204
587 3300047673 Ga0495593_0063295 Ga0495593_0063295_1239_1853 204
588 3300048088 Ga0495602_0013244 Ga0495602_0013244_5045_5662 204
589 3300048088 Ga0495602_0610040 Ga0495602_0610040_101_715 204
590 3300048903 Ga0496100_0058924 Ga0496100_0058924_1313_1927 204
591 3300048904 Ga0496101_0045623 Ga0496101_0045623_217_852 204
592 3300048904 Ga0496101_0053843 Ga0496101_0053843_1086_1700 204
593 3300048904 Ga0496101_0108815 Ga0496101_0108815_546_1160 204
594 3300048905 Ga0496102_0025794 Ga0496102_0025794_3965_4579 204
595 3300048905 Ga0496102_0915356 Ga0496102_0915356_109_723 204
596 3300048906 Ga0496103_0007433 Ga0496103_0007433_3641_4255 204
597 3300048906 Ga0496103_0173750 Ga0496103_0173750_593_1207 204
598 3300048907 Ga0496104_0002707 Ga0496104_0002707_11252_11866 204
599 3300048907 Ga0496104_0029300 Ga0496104_0029300_1169_1804 204
600 3300048907 Ga0496104_0033366 Ga0496104_0033366_1096_1710 204
601 3300048907 Ga0496104_0301152 Ga0496104_0301152_690_1304 204
602 3300048907 Ga0496104_0522280 Ga0496104_0522280_337_951 204
603 3300048908 Ga0496105_0003571 Ga0496105_0003571_8655_9269 204
604 3300048908 Ga0496105_0077048 Ga0496105_0077048_1967_2581 204
605 3300048908 Ga0496105_0140306 Ga0496105_0140306_334_948 204
606 3300048909 Ga0496106_0753678 Ga0496106_0753678_35_649 204
607 3300048910 Ga0496107_0099485 Ga0496107_0099485_314_949 204
608 3300048911 Ga0496108_0034095 Ga0496108_0034095_1949_2563 204
609 3300048912 Ga0496109_0062374 Ga0496109_0062374_260_874 204
610 3300048913 Ga0496110_0083477 Ga0496110_0083477_238_852 204
611 3300048914 Ga0496111_0241288 Ga0496111_0241288_52_666 204
612 3300048915 Ga0496112_0052736 Ga0496112_0052736_2823_3437 204
613 3300048915 Ga0496112_0094636 Ga0496112_0094636_1286_1921 204
614 3300048916 Ga0496113_0120823 Ga0496113_0120823_232_867 204
615 3300048916 Ga0496113_0414979 Ga0496113_0414979_236_850 204
616 3300048917 Ga0496114_0191788 Ga0496114_0191788_25_660 204
617 3300048917 Ga0496114_0313449 Ga0496114_0313449_670_1284 204
618 3300048917 Ga0496114_0333313 Ga0496114_0333313_706_1320 204
619 3300048918 Ga0496115_0027942 Ga0496115_0027942_959_1594 204
620 3300048918 Ga0496115_0218994 Ga0496115_0218994_60_674 204
621 3300048918 Ga0496115_0260701 Ga0496115_0260701_178_792 204
622 3300048918 Ga0496115_0557190 Ga0496115_0557190_160_774 204
623 3300048919 Ga0496116_0014259 Ga0496116_0014259_207_821 204
624 3300048919 Ga0496116_0043348 Ga0496116_0043348_2140_2754 204
625 3300048920 Ga0496117_0055450 Ga0496117_0055450_999_1613 204
626 3300048920 Ga0496117_0222959 Ga0496117_0222959_193_807 204
627 3300048921 Ga0496118_0043905 Ga0496118_0043905_742_1356 204
628 3300048921 Ga0496118_0068846 Ga0496118_0068846_1686_2300 204
629 3300048921 Ga0496118_0115119 Ga0496118_0115119_132_746 204
630 3300048921 Ga0496118_0383671 Ga0496118_0383671_55_669 204
631 3300048922 Ga0496119_0018956 Ga0496119_0018956_1296_1910 204
632 3300048922 Ga0496119_0105269 Ga0496119_0105269_130_744 204
633 3300048923 Ga0496120_0023635 Ga0496120_0023635_445_1059 204
634 3300048924 Ga0496121_0004381 Ga0496121_0004381_13578_14192 204
635 3300048924 Ga0496121_0093712 Ga0496121_0093712_1617_2231 204
636 3300048924 Ga0496121_0226031 Ga0496121_0226031_342_956 204
637 3300048925 Ga0496122_0087738 Ga0496122_0087738_606_1220 204
638 3300048925 Ga0496122_0188080 Ga0496122_0188080_137_751 204
639 3300048926 Ga0496123_0105528 Ga0496123_0105528_707_1321 204
640 3300048927 Ga0496124_0095498 Ga0496124_0095498_687_1301 204
641 3300048927 Ga0496124_0269060 Ga0496124_0269060_235_849 204
642 3300048928 Ga0496125_0051118 Ga0496125_0051118_1868_2482 204
643 3300048928 Ga0496125_0064011 Ga0496125_0064011_167_781 204
644 3300048928 Ga0496125_0104161 Ga0496125_0104161_500_1114 204
645 3300048928 Ga0496125_0256258 Ga0496125_0256258_372_986 204
646 3300048929 Ga0496126_0020402 Ga0496126_0020402_3365_3979 204
647 3300048929 Ga0496126_0041687 Ga0496126_0041687_573_1187 204
648 3300049460 Ga0495682_0027484 Ga0495682_0027484_532_1146 204
649 3300049593 Ga0501077_0101197 Ga0501077_0101197_122_766 204
650 3300050490 nmdc:mga03n38_171368_c1 nmdc:mga03n38_171368_c1_267_881 204
651 3300050492 nmdc:mga0yw44_322388_c1 nmdc:mga0yw44_322388_c1_111_725 204
652 3300050492 nmdc:mga0yw44_9102_c1 nmdc:mga0yw44_9102_c1_376_990 204
653 3300050493 nmdc:mga0k408_75413_c1 nmdc:mga0k408_75413_c1_544_1158 204
654 3300050493 nmdc:mga0k408_91430_c1 nmdc:mga0k408_91430_c1_602_1216 204
655 3300050494 nmdc:mga06z11_35953_c1 nmdc:mga06z11_35953_c1_460_1074 204
656 3300050495 nmdc:mga04h51_8605_c1 nmdc:mga04h51_8605_c1_428_1042 204
657 3300050496 nmdc:mga07m45_12697_c1 nmdc:mga07m45_12697_c1_1266_1880 204
658 3300050496 nmdc:mga07m45_14394_c1 nmdc:mga07m45_14394_c1_2494_3108 204
659 3300050512 nmdc:mga0n895_193085_c1 nmdc:mga0n895_193085_c1_602_1237 204
660 3300050515 nmdc:mga0a205_265521_c1 nmdc:mga0a205_265521_c1_610_1257 204
661 3300050516 nmdc:mga0sz30_50125_c1 nmdc:mga0sz30_50125_c1_644_1258 204
662 3300050516 nmdc:mga0sz30_50701_c1 nmdc:mga0sz30_50701_c1_959_1573 204
663 3300053083 Ga0495655_0044091 Ga0495655_0044091_337_951 204
664 3300053084 Ga0495595_0155847 Ga0495595_0155847_281_898 204
665 3300053085 Ga0495619_0046460 Ga0495619_0046460_2114_2731 204
666 3300053086 Ga0500578_0123944 Ga0500578_0123944_19_633 204
667 3300053087 Ga0500643_000047 Ga0500643_000047_32871_33485 204
668 3300053093 Ga0500651_0035166 Ga0500651_0035166_1764_2378 204
669 3300053093 Ga0500651_0320785 Ga0500651_0320785_78_692 204
670 3300053094 Ga0500566_0027227 Ga0500566_0027227_2319_2933 204
671 3300053094 Ga0500566_0141474 Ga0500566_0141474_257_871 204
672 3300053095 Ga0500640_034386 Ga0500640_034386_559_1173 204
673 3300053103 Ga0500555_007180 Ga0500555_007180_545_1159 204
674 3300053104 Ga0500556_0128367 Ga0500556_0128367_197_811 204
675 3300053106 Ga0500558_169387 Ga0500558_169387_17_631 204
676 3300053119 Ga0500595_033458 Ga0500595_033458_22_636 204
677 3300053123 Ga0500614_070537 Ga0500614_070537_249_863 204
678 3300053125 Ga0500618_037738 Ga0500618_037738_12_626 204
679 3300053130 Ga0500642_0008914 Ga0500642_0008914_297_911 204
680 3300053134 Ga0500658_0112542 Ga0500658_0112542_209_823 204
681 3300053136 Ga0500559_0028573 Ga0500559_0028573_1463_2077 204
682 3300053139 Ga0500568_0067797 Ga0500568_0067797_738_1352 204
683 3300053140 Ga0500573_0262309 Ga0500573_0262309_166_780 204
684 3300053142 Ga0500577_0052342 Ga0500577_0052342_724_1338 204
685 3300053147 Ga0500589_187102 Ga0500589_187102_37_651 204
686 3300053148 Ga0500590_230533 Ga0500590_230533_76_690 204
687 3300053153 Ga0500616_0087570 Ga0500616_0087570_908_1522 204
688 3300053155 Ga0500620_016927 Ga0500620_016927_252_866 204
689 3300053156 Ga0500622_0006265 Ga0500622_0006265_5170_5784 204
690 3300053160 Ga0500633_0067440 Ga0500633_0067440_622_1236 204
691 3300053162 Ga0500638_019612 Ga0500638_019612_929_1543 204
692 3300053731 Ga0500609_025756 Ga0500609_025756_78_692 204
693 3300053733 Ga0500552_002212 Ga0500552_002212_842_1456 204
694 3300053736 Ga0500599_000212 Ga0500599_000212_517_1131 204
695 3300053737 Ga0500601_000078 Ga0500601_000078_10813_11427 204
696 3300055283 Ga0500661_005887 Ga0500661_005887_1144_1758 204

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gz4-assembly1.cif.gz_C 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens 0.9047 13 203
2gz4-assembly1.cif.gz_C 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens 0.8688 13 203
2dqb-assembly1.cif.gz_A crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.6181 39 151
7oiw-assembly2.cif.gz_B structure of s. aureus rel catalytic domains in complex with pppgpp 0.5368 37 166
5tka-assembly1.cif.gz_A-2 structure of the hd-domain phosphohydrolase oxsa 0.5215 34 202
ID Description Score Start End Superfamily
2gz4D00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9069 13 202 1.10.3210.10
2gz4D00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8621 13 202 1.10.3210.10
af_P76514_1_178_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.734 15 202 1.10.3210.10
af_P76514_1_178_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6951 15 202 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5407 39 149 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A258SRH7-F1-model_v4 Hydrolase 0.985 13 73
AF-A0A3D2P790-F1-model_v4 Hydrolase 0.9777 13 77
AF-A0A526QFV6-F1-model_v4 Hydrolase 0.9682 13 79 GO:0016787
AF-A4U2D7-F1-model_v4 Uncharacterized protein 0.9499 13 97
AF-A0A839Z8R5-F1-model_v4 HD family hydrolase 0.9353 13 202

Feature Viewer

pLDDT pTM Quality
89.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map