F475824

General Info

Members Datasets Scaffolds Average Seq Length
696 300 1392 206

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10128987|Ga0065707_101289872
Length 236
Sequence LSIEMGSDTRGERTERGDGPPRVSEPKGRYSPGSINAVRQQALRQLEQFEVLMRQGHFDYGNGFHGRVYLNAHQLFRQPSTIWRLAQDLLDVLPGDLLEKTDVVAGPVMGGALLAHTLAGLLDGRRALTHPPCSFAPFGSRGDNFTLRDFYARQMSGKRVLLADDVRNTGKTFQRCAELVRQAGGTVLATVQIVDRMEAVADAGVPNYALVEYKAPANVAAADCPMCGAGEPITSF

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
180 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
291 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.89
Nodule 0
Rhizoplane 1.87
Rhizosphere 92.1
Stem 0
Stem Tuber 0
Unclassified 14.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10128987 3300005295 Bacteria 1955
2 Ga0065714_10136433 3300005288 Unclassified 1205
3 Ga0065715_10016403 3300005293 Bacteria 3332
4 Ga0070676_10005015 3300005328 Bacteria 7014
5 Ga0070676_10159991 3300005328 Bacteria 1448
6 Ga0070690_100063803 3300005330 Bacteria 2378
7 Ga0070670_100002072 3300005331 Bacteria 16413
8 Ga0070670_100005373 3300005331 Bacteria 10815
9 Ga0070670_100072162 3300005331 Bacteria 2965
10 Ga0070670_100106806 3300005331 Bacteria 2412
11 Ga0070677_10014330 3300005333 Bacteria 2789
12 Ga0068869_100019724 3300005334 Bacteria 4613
13 Ga0068869_100059158 3300005334 Bacteria 2804
14 Ga0068869_100611206 3300005334 Unclassified 922
15 Ga0070666_10254202 3300005335 Bacteria 1244
16 Ga0070682_100645023 3300005337 Unclassified 842
17 Ga0068868_100178030 3300005338 Bacteria 1763
18 Ga0070660_100627962 3300005339 Bacteria 899
19 Ga0070689_100180034 3300005340 Bacteria 1716
20 Ga0070689_100874676 3300005340 Unclassified 794
21 Ga0070691_10174390 3300005341 Bacteria 1116
22 Ga0070691_10252866 3300005341 Bacteria 946
23 Ga0070687_100067274 3300005343 Bacteria 1912
24 Ga0070661_100450556 3300005344 Bacteria 1024
25 Ga0070692_10087101 3300005345 Bacteria 1692
26 Ga0070668_100569563 3300005347 Bacteria 988
27 Ga0070669_100022646 3300005353 Bacteria 4493
28 Ga0070669_100059870 3300005353 Bacteria 2796
29 Ga0070675_100025675 3300005354 Bacteria 4723
30 Ga0070675_100093286 3300005354 Bacteria 2524
31 Ga0070675_100240118 3300005354 Bacteria 1583
32 Ga0070675_100288200 3300005354 Bacteria 1444
33 Ga0070675_100296079 3300005354 Bacteria 1425
34 Ga0070675_100340216 3300005354 Bacteria 1329
35 Ga0070675_100412782 3300005354 Bacteria 1206
36 Ga0070671_100060543 3300005355 Bacteria 3152
37 Ga0070671_100880026 3300005355 Unclassified 782
38 Ga0070674_100044189 3300005356 Bacteria 3035
39 Ga0070674_100207499 3300005356 Bacteria 1517
40 Ga0070674_100358753 3300005356 Bacteria 1179
41 Ga0070673_100009421 3300005364 Bacteria 6554
42 Ga0070673_100158952 3300005364 Bacteria 1920
43 Ga0070688_100068109 3300005365 Bacteria 2269
44 Ga0070688_100258760 3300005365 Bacteria 1242
45 Ga0070659_100053258 3300005366 Bacteria 3185
46 Ga0070659_100074746 3300005366 Bacteria 2700
47 Ga0070667_100060468 3300005367 Bacteria 3205
48 Ga0070667_100108882 3300005367 Bacteria 2401
49 Ga0070667_100388657 3300005367 Bacteria 1268
50 Ga0070667_100532455 3300005367 Bacteria 1079
51 Ga0070667_100889247 3300005367 Unclassified 829
52 Ga0070714_100901872 3300005435 Bacteria 858
53 Ga0070701_10022047 3300005438 Bacteria 3049
54 Ga0070705_100001469 3300005440 Bacteria 12474
55 Ga0070705_100182572 3300005440 Bacteria 1422
56 Ga0070700_100017542 3300005441 Bacteria 4097
57 Ga0070700_100076197 3300005441 Bacteria 2153
58 Ga0070700_100098839 3300005441 Bacteria 1919
59 Ga0070694_100000327 3300005444 Bacteria 25612
60 Ga0070694_100323323 3300005444 Bacteria 1188
61 Ga0070663_100019094 3300005455 Bacteria 4510
62 Ga0070663_100135292 3300005455 Bacteria 1876
63 Ga0070663_100153837 3300005455 Bacteria 1766
64 Ga0070663_100713033 3300005455 Bacteria 854
65 Ga0070678_100121112 3300005456 Bacteria 2063
66 Ga0070678_100321643 3300005456 Bacteria 1321
67 Ga0070678_100872269 3300005456 Bacteria 821
68 Ga0070662_100055525 3300005457 Bacteria 2874
69 Ga0070662_100518019 3300005457 Bacteria 996
70 Ga0070681_10126722 3300005458 Bacteria 2486
71 Ga0068867_100007585 3300005459 Bacteria 7678
72 Ga0068867_100038097 3300005459 Bacteria 3499
73 Ga0070685_10094714 3300005466 Bacteria 1814
74 Ga0070706_100182956 3300005467 Unclassified 1957
75 Ga0070707_100542555 3300005468 Bacteria 1125
76 Ga0070707_100902539 3300005468 Unclassified 848
77 Ga0070679_100070178 3300005530 Bacteria 3496
78 Ga0070672_100076824 3300005543 Bacteria 2669
79 Ga0070672_100172812 3300005543 Bacteria 1798
80 Ga0070672_100424590 3300005543 Bacteria 1142
81 Ga0070672_100756944 3300005543 Bacteria 853
82 Ga0070686_100238225 3300005544 Bacteria 1323
83 Ga0070693_100012619 3300005547 Bacteria 4279
84 Ga0070704_100032910 3300005549 Bacteria 3502
85 Ga0070664_100162180 3300005564 Bacteria 1978
86 Ga0070664_100173158 3300005564 Bacteria 1915
87 Ga0070664_100246831 3300005564 Bacteria 1604
88 Ga0070664_100606921 3300005564 Unclassified 1015
89 Ga0068857_100014083 3300005577 Bacteria 6961
90 Ga0068854_100211274 3300005578 Bacteria 1531
91 Ga0070702_100761864 3300005615 Unclassified 744
92 Ga0068852_100052613 3300005616 Bacteria 3500
93 Ga0068852_100243159 3300005616 Bacteria 1721
94 Ga0068852_100572893 3300005616 Bacteria 1131
95 Ga0068859_100165727 3300005617 Bacteria 2290
96 Ga0068859_100263128 3300005617 Bacteria 1816
97 Ga0068859_100611303 3300005617 Bacteria 1183
98 Ga0068864_100107137 3300005618 Bacteria 2486
99 Ga0068864_100347445 3300005618 Bacteria 1399
100 Ga0068864_100409730 3300005618 Bacteria 1289
101 Ga0068864_101165197 3300005618 Bacteria 769
102 Ga0068866_10060235 3300005718 Bacteria 1967
103 Ga0068861_100880371 3300005719 Bacteria 846
104 Ga0068851_10027144 3300005834 Unclassified 2820
105 Ga0068851_10115240 3300005834 Bacteria 1439
106 Ga0068870_10053107 3300005840 Bacteria 2151
107 Ga0068870_10093925 3300005840 Bacteria 1683
108 Ga0068863_100090250 3300005841 Bacteria 2906
109 Ga0068863_100240805 3300005841 Unclassified 1746
110 Ga0068863_100473547 3300005841 Bacteria 1231
111 Ga0068863_100753313 3300005841 Bacteria 970
112 Ga0068858_100029935 3300005842 Bacteria 5057
113 Ga0068858_100163459 3300005842 Bacteria 2097
114 Ga0068858_100969486 3300005842 Bacteria 833
115 Ga0068860_100066193 3300005843 Bacteria 3432
116 Ga0068860_100112767 3300005843 Bacteria 2600
117 Ga0068860_100134111 3300005843 Bacteria 2378
118 Ga0068860_100140831 3300005843 Unclassified 2318
119 Ga0068860_100154085 3300005843 Bacteria 2214
120 Ga0068860_100563845 3300005843 Bacteria 1142
121 Ga0068862_100020225 3300005844 Bacteria 5560
122 Ga0068862_100282872 3300005844 Bacteria 1521
123 Ga0068862_100483143 3300005844 Bacteria 1173
124 Ga0068862_100545324 3300005844 Bacteria 1107
125 Ga0075368_10002944 3300006042 Bacteria 5624
126 Ga0075368_10011629 3300006042 Bacteria 3204
127 Ga0075368_10014382 3300006042 Bacteria 2922
128 Ga0075363_100029579 3300006048 Bacteria 2830
129 Ga0075363_100131685 3300006048 Bacteria 1403
130 Ga0075364_10010271 3300006051 Bacteria 5650
131 Ga0075364_10027341 3300006051 Bacteria 3643
132 Ga0075364_10052957 3300006051 Bacteria 2653
133 Ga0070712_100229962 3300006175 Bacteria 1472
134 Ga0075362_10005887 3300006177 Bacteria 4526
135 Ga0075367_10014402 3300006178 Bacteria 4280
136 Ga0075367_10042143 3300006178 Bacteria 2670
137 Ga0075367_10050116 3300006178 Bacteria 2464
138 Ga0075366_10038885 3300006195 Bacteria 2810
139 Ga0075366_10068108 3300006195 Unclassified 2118
140 Ga0097621_100130420 3300006237 Bacteria 2140
141 Ga0097621_100191392 3300006237 Bacteria 1772
142 Ga0097621_100557016 3300006237 Bacteria 1044
143 Ga0097621_101178106 3300006237 Bacteria 721
144 Ga0075370_10038398 3300006353 Bacteria 2694
145 Ga0068871_100004824 3300006358 Bacteria 9424
146 Ga0068871_100148491 3300006358 Bacteria 1998
147 Ga0068871_100198783 3300006358 Bacteria 1730
148 Ga0068871_100246593 3300006358 Bacteria 1555
149 Ga0075428_100418988 3300006844 Bacteria 1435
150 Ga0075430_100004074 3300006846 Bacteria 12332
151 Ga0075430_100048049 3300006846 Bacteria 3604
152 Ga0075431_100028563 3300006847 Bacteria 5735
153 Ga0075431_100336762 3300006847 Unclassified 1519
154 Ga0075433_10138990 3300006852 Bacteria 2159
155 Ga0075433_10413301 3300006852 Bacteria 1190
156 Ga0075434_100000141 3300006871 Bacteria 43904
157 Ga0075434_100375681 3300006871 Bacteria 1442
158 Ga0075434_100875008 3300006871 Bacteria 914
159 Ga0068865_100072465 3300006881 Bacteria 2447
160 Ga0068865_100096215 3300006881 Bacteria 2159
161 Ga0068865_100231251 3300006881 Unclassified 1451
162 Ga0068865_100510042 3300006881 Bacteria 1004
163 Ga0097620_100093377 3300006931 Unclassified 3061
164 Ga0097620_100165727 3300006931 Bacteria 2290
165 Ga0097620_100263127 3300006931 Bacteria 1816
166 Ga0097620_100611306 3300006931 Bacteria 1183
167 Ga0075435_100020550 3300007076 Bacteria 5062
168 Ga0075435_100311932 3300007076 Bacteria 1346
169 Ga0111539_10000847 3300009094 Bacteria 39853
170 Ga0111539_10020401 3300009094 Bacteria 8161
171 Ga0111539_10157812 3300009094 Bacteria 2654
172 Ga0111539_10232577 3300009094 Bacteria 2146
173 Ga0111539_10528811 3300009094 Unclassified 1374
174 Ga0105245_10136032 3300009098 Bacteria 2309
175 Ga0105247_10706835 3300009101 Bacteria 759
176 Ga0114129_10001134 3300009147 Bacteria 35181
177 Ga0114129_10035276 3300009147 Bacteria 7066
178 Ga0114129_10042135 3300009147 Bacteria 6429
179 Ga0105243_10098627 3300009148 Bacteria 2421
180 Ga0105242_10019250 3300009176 Bacteria 5348
181 Ga0105242_10257557 3300009176 Bacteria 1575
182 Ga0105242_10689379 3300009176 Bacteria 998
183 Ga0105242_10863055 3300009176 Unclassified 902
184 Ga0105248_10063503 3300009177 Bacteria 4145
185 Ga0105248_10267539 3300009177 Bacteria 1924
186 Ga0105248_10403212 3300009177 Bacteria 1540
187 Ga0105238_11400141 3300009551 Bacteria 726
188 Ga0105249_10685546 3300009553 Bacteria 1084
189 Ga0105249_10800295 3300009553 Unclassified 1007
190 Ga0105249_11296774 3300009553 Bacteria 800
191 Ga0105249_11356427 3300009553 Bacteria 783
192 Ga0105239_10216918 3300010375 Bacteria 2145
193 Ga0157378_11043059 3300013297 Bacteria 853
194 Ga0163162_10165623 3300013306 Unclassified 2334
195 Ga0163162_10181629 3300013306 Bacteria 2230
196 Ga0157372_10336901 3300013307 Bacteria 1757
197 Ga0157375_10987865 3300013308 Bacteria 982
198 Ga0163163_10000023 3300014325 Bacteria 185843
199 Ga0157380_10065646 3300014326 Bacteria 2917
200 Ga0157380_10096214 3300014326 Bacteria 2454
201 Ga0157380_10140586 3300014326 Bacteria 2074
202 Ga0157380_10346397 3300014326 Bacteria 1388
203 Ga0157380_10820426 3300014326 Bacteria 949
204 Ga0157380_10868450 3300014326 Bacteria 925
205 Ga0157377_10444700 3300014745 Bacteria 893
206 Ga0157377_10571009 3300014745 Unclassified 802
207 Ga0207697_10059374 3300025315 Bacteria 1590
208 Ga0207682_10051347 3300025893 Bacteria 1708
209 Ga0207682_10069002 3300025893 Bacteria 1494
210 Ga0207682_10113788 3300025893 Unclassified 1194
211 Ga0207642_10173390 3300025899 Bacteria 1169
212 Ga0207688_10384601 3300025901 Bacteria 868
213 Ga0207680_10539728 3300025903 Bacteria 832
214 Ga0207647_10067681 3300025904 Bacteria 2164
215 Ga0207645_10004782 3300025907 Bacteria 9954
216 Ga0207645_10018534 3300025907 Bacteria 4577
217 Ga0207643_10037642 3300025908 Unclassified 2714
218 Ga0207643_10322660 3300025908 Unclassified 965
219 Ga0207693_10206475 3300025915 Bacteria 1544
220 Ga0207660_10471246 3300025917 Bacteria 1017
221 Ga0207662_10020398 3300025918 Bacteria 3782
222 Ga0207657_10064295 3300025919 Bacteria 3132
223 Ga0207657_10439754 3300025919 Bacteria 1024
224 Ga0207649_10327898 3300025920 Bacteria 1127
225 Ga0207652_10017874 3300025921 Bacteria 5810
226 Ga0207646_10762771 3300025922 Unclassified 863
227 Ga0207681_10319455 3300025923 Bacteria 1234
228 Ga0207681_10403584 3300025923 Bacteria 1104
229 Ga0207650_10014512 3300025925 Bacteria 5474
230 Ga0207650_10167414 3300025925 Bacteria 1745
231 Ga0207650_10312267 3300025925 Unclassified 1286
232 Ga0207659_10006525 3300025926 Bacteria 7156
233 Ga0207659_10106032 3300025926 Bacteria 2127
234 Ga0207659_10350915 3300025926 Bacteria 1224
235 Ga0207659_10369135 3300025926 Bacteria 1194
236 Ga0207659_10418259 3300025926 Bacteria 1124
237 Ga0207659_10513998 3300025926 Bacteria 1015
238 Ga0207659_10514675 3300025926 Bacteria 1014
239 Ga0207644_10017181 3300025931 Bacteria 4880
240 Ga0207644_10025008 3300025931 Bacteria 4102
241 Ga0207690_10098234 3300025932 Bacteria 2085
242 Ga0207690_10495965 3300025932 Bacteria 987
243 Ga0207706_10068253 3300025933 Bacteria 3129
244 Ga0207706_10660221 3300025933 Bacteria 895
245 Ga0207686_10005030 3300025934 Bacteria 7117
246 Ga0207709_10018126 3300025935 Bacteria 3939
247 Ga0207670_10151965 3300025936 Bacteria 1719
248 Ga0207670_10619660 3300025936 Unclassified 890
249 Ga0207669_10083785 3300025937 Bacteria 2052
250 Ga0207669_10214537 3300025937 Bacteria 1408
251 Ga0207669_10340340 3300025937 Unclassified 1155
252 Ga0207669_10377587 3300025937 Unclassified 1103
253 Ga0207704_10060558 3300025938 Bacteria 2343
254 Ga0207704_10113960 3300025938 Unclassified 1834
255 Ga0207704_10463165 3300025938 Unclassified 1014
256 Ga0207691_10041925 3300025940 Bacteria 4222
257 Ga0207691_10092503 3300025940 Bacteria 2708
258 Ga0207711_10030745 3300025941 Bacteria 4530
259 Ga0207689_10004074 3300025942 Bacteria 13281
260 Ga0207689_10050423 3300025942 Bacteria 3432
261 Ga0207689_10055295 3300025942 Unclassified 3267
262 Ga0207689_10346593 3300025942 Bacteria 1234
263 Ga0207679_10127280 3300025945 Bacteria 2038
264 Ga0207651_10007077 3300025960 Bacteria 5954
265 Ga0207651_10073417 3300025960 Bacteria 2432
266 Ga0207712_10189591 3300025961 Unclassified 1622
267 Ga0207658_10213221 3300025986 Bacteria 1620
268 Ga0207658_10361118 3300025986 Bacteria 1267
269 Ga0207658_10711543 3300025986 Unclassified 908
270 Ga0207658_10736501 3300025986 Bacteria 892
271 Ga0207677_10122338 3300026023 Bacteria 1960
272 Ga0207677_10196465 3300026023 Unclassified 1600
273 Ga0207703_10013707 3300026035 Bacteria 6318
274 Ga0207639_10630173 3300026041 Unclassified 991
275 Ga0207678_10012340 3300026067 Bacteria 7501
276 Ga0207678_10026929 3300026067 Bacteria 5015
277 Ga0207678_10115722 3300026067 Bacteria 2288
278 Ga0207678_10332538 3300026067 Bacteria 1308
279 Ga0207708_10008831 3300026075 Bacteria 7458
280 Ga0207708_10017040 3300026075 Bacteria 5469
281 Ga0207708_10089830 3300026075 Bacteria 2368
282 Ga0207641_10080946 3300026088 Bacteria 2819
283 Ga0207641_10622128 3300026088 Bacteria 1059
284 Ga0207641_10659386 3300026088 Bacteria 1028
285 Ga0207648_10000864 3300026089 Bacteria 34096
286 Ga0207648_10101267 3300026089 Bacteria 2524
287 Ga0207676_10037918 3300026095 Unclassified 3677
288 Ga0207676_10340664 3300026095 Bacteria 1383
289 Ga0207676_10393176 3300026095 Bacteria 1294
290 Ga0207674_10054353 3300026116 Bacteria 4077
291 Ga0207674_10485355 3300026116 Bacteria 1194
292 Ga0207675_100002891 3300026118 Bacteria 16880
293 Ga0207675_100217227 3300026118 Bacteria 1841
294 Ga0207675_100725858 3300026118 Bacteria 1004
295 Ga0207675_100865989 3300026118 Bacteria 919
296 Ga0207683_10194963 3300026121 Bacteria 1840
297 Ga0207683_10253507 3300026121 Bacteria 1606
298 Ga0207698_10283099 3300026142 Bacteria 1535
299 Ga0207698_10421915 3300026142 Bacteria 1280
300 Ga0207698_10483171 3300026142 Bacteria 1202
301 Ga0209813_10043169 3300027866 Bacteria 1381
302 Ga0207428_10013427 3300027907 Bacteria 7154
303 Ga0207428_10076067 3300027907 Bacteria 2629
304 Ga0207428_10123166 3300027907 Bacteria 1987
305 Ga0268265_10050519 3300028380 Bacteria 3134
306 Ga0268265_10073335 3300028380 Bacteria 2673
307 Ga0268264_10039246 3300028381 Unclassified 3912
308 Ga0268264_10054193 3300028381 Bacteria 3348
309 Ga0268264_10066373 3300028381 Bacteria 3042
310 Ga0268264_10380180 3300028381 Bacteria 1352
311 Ga0268264_10389744 3300028381 Bacteria 1336
312 Ga0307408_100038211 3300031548 Bacteria 3386
313 Ga0307408_100093733 3300031548 Bacteria 2272
314 Ga0307408_100181262 3300031548 Bacteria 1689
315 Ga0307408_100258813 3300031548 Bacteria 1439
316 Ga0307408_100824043 3300031548 Unclassified 844
317 Ga0307405_10324241 3300031731 Bacteria 1178
318 Ga0307405_10739934 3300031731 Unclassified 818
319 Ga0307413_10112943 3300031824 Bacteria 1822
320 Ga0307413_10135285 3300031824 Bacteria 1694
321 Ga0307413_10178896 3300031824 Bacteria 1510
322 Ga0307410_10009023 3300031852 Bacteria 5568
323 Ga0307406_10048275 3300031901 Bacteria 2688
324 Ga0307406_10063466 3300031901 Unclassified 2393
325 Ga0307406_10358390 3300031901 Bacteria 1142
326 Ga0307407_10069282 3300031903 Unclassified 2093
327 Ga0307407_10249957 3300031903 Bacteria 1214
328 Ga0307412_10079412 3300031911 Bacteria 2263
329 Ga0307412_10279506 3300031911 Bacteria 1310
330 Ga0307412_10362810 3300031911 Bacteria 1167
331 Ga0307409_100097992 3300031995 Unclassified 2423
332 Ga0307409_100335858 3300031995 Bacteria 1420
333 Ga0307409_100353377 3300031995 Bacteria 1388
334 Ga0307409_100663152 3300031995 Bacteria 1038
335 Ga0307416_100035661 3300032002 Bacteria 3803
336 Ga0307416_100057277 3300032002 Bacteria 3152
337 Ga0307416_100077740 3300032002 Bacteria 2788
338 Ga0307416_100205439 3300032002 Unclassified 1873
339 Ga0307416_100383707 3300032002 Bacteria 1436
340 Ga0307416_100606526 3300032002 Unclassified 1175
341 Ga0307416_100886899 3300032002 Bacteria 991
342 Ga0307416_101757369 3300032002 Unclassified 724
343 Ga0307414_10015598 3300032004 Bacteria 4589
344 Ga0307414_10125800 3300032004 Bacteria 1980
345 Ga0307411_10007102 3300032005 Bacteria 5670
346 Ga0307411_10008576 3300032005 Bacteria 5307
347 Ga0307411_10017063 3300032005 Bacteria 4125
348 Ga0307411_10875436 3300032005 Bacteria 796
349 Ga0307415_100007022 3300032126 Bacteria 6125
350 Ga0307415_100087031 3300032126 Bacteria 2250
351 Ga0373948_0051843 3300034817 Bacteria 883
352 Ga0373944_0213586 3300035089 Bacteria 702
353 Ga0373952_0062110 3300035092 Bacteria 916
354 Ga0373923_0091090 3300035111 Bacteria 1334
355 Ga0373923_0201707 3300035111 Bacteria 920
356 Ga0373936_0112615 3300035113 Bacteria 1156
357 Ga0373945_0194780 3300035116 Unclassified 839
358 Ga0373953_0100395 3300035117 Bacteria 1217
359 Ga0373954_0073974 3300035118 Bacteria 1622
360 Ga0373957_0011007 3300035120 Bacteria 3007
361 Ga0373960_0004861 3300035121 Bacteria 3093
362 Ga0373943_0014296 3300035170 Bacteria 3592
363 Ga0373946_0018849 3300035171 Bacteria 2653
364 Ga0373955_0034695 3300035172 Bacteria 2667
365 Ga0373955_0047750 3300035172 Bacteria 2319
366 Ga0373955_0139605 3300035172 Bacteria 1420
367 Ga0373924_0013214 3300035410 Bacteria 3099
368 Ga0373924_0132450 3300035410 Bacteria 1085
369 Ga0373935_0024448 3300035692 Bacteria 3718
370 Ga0373935_0137994 3300035692 Bacteria 1645
371 Ga0373933_0008204 3300035724 Bacteria 5702
372 Ga0373947_0041552 3300035725 Bacteria 2742
373 Ga0373947_0097845 3300035725 Bacteria 1840
374 Ga0373937_0000128 3300036401 Bacteria 73001
375 Ga0373937_0000513 3300036401 Bacteria 35017
376 Ga0373937_0150228 3300036401 Bacteria 2182
377 Ga0373925_0003323 3300037068 Bacteria 12500
378 Ga0373925_0030418 3300037068 Bacteria 3963
379 Ga0395905_0197996 3300037471 Bacteria 1884
380 Ga0451802_1175522 3300041460 Bacteria 1261
381 Ga0451853_2618196 3300041512 Bacteria 1906
382 Ga0439433_0026499 3300041999 Bacteria 1312
383 Ga0450894_004033 3300042131 Bacteria 1917
384 Ga0450895_005218 3300042132 Bacteria 1043
385 Ga0439446_0044812 3300042156 Bacteria 1310
386 Ga0450908_008297 3300042184 Bacteria 1947
387 Ga0439435_0073268 3300042436 Bacteria 1017
388 Ga0439464_0052995 3300042439 Unclassified 1176
389 Ga0439460_0004112 3300042461 Bacteria 3538
390 Ga0439460_0014246 3300042461 Bacteria 2089
391 Ga0450918_046219 3300042531 Unclassified 788
392 Ga0451577_0091381 3300042876 Bacteria 2717
393 Ga0451577_0157571 3300042876 Bacteria 2044
394 Ga0453684_0154757 3300044712 Bacteria 2720
395 Ga0451576_0106012 3300045051 Bacteria 2925
396 Ga0466967_0837338 3300045976 Bacteria 914
397 Ga0495629_0149182 3300046459 Unclassified 1625
398 Ga0495629_0555733 3300046459 Bacteria 770
399 Ga0495651_0011249 3300046462 Bacteria 6879
400 Ga0495651_0174083 3300046462 Bacteria 1530
401 Ga0495582_0112895 3300046473 Bacteria 1527
402 Ga0495584_0304818 3300046491 Unclassified 809
403 Ga0495584_0315767 3300046491 Unclassified 793
404 Ga0495608_0212450 3300046511 Bacteria 1216
405 Ga0495618_0113946 3300046514 Bacteria 1731
406 Ga0495628_0106701 3300046516 Bacteria 2157
407 Ga0495628_0237712 3300046516 Unclassified 1363
408 Ga0495628_0310888 3300046516 Bacteria 1165
409 Ga0495628_0432377 3300046516 Bacteria 958
410 Ga0495630_0082301 3300046517 Bacteria 2430
411 Ga0495630_0576358 3300046517 Bacteria 863
412 Ga0495663_0013521 3300046525 Unclassified 2283
413 Ga0495642_0001306 3300046528 Bacteria 11190
414 Ga0495652_0264135 3300046529 Bacteria 1269
415 Ga0495665_0279027 3300046531 Unclassified 857
416 Ga0495640_0208308 3300046533 Bacteria 1237
417 Ga0495587_0260963 3300046536 Bacteria 973
418 Ga0495598_0006984 3300046537 Bacteria 2570
419 Ga0495598_0153623 3300046537 Unclassified 805
420 Ga0495621_0027438 3300046539 Unclassified 1928
421 Ga0495621_0052072 3300046539 Bacteria 1467
422 Ga0495645_0040697 3300046543 Unclassified 3390
423 Ga0495645_0050526 3300046543 Bacteria 3027
424 Ga0495645_0565962 3300046543 Unclassified 703
425 Ga0495633_0284403 3300046558 Bacteria 752
426 Ga0495667_0017384 3300046559 Bacteria 4857
427 Ga0495634_0103074 3300046642 Bacteria 1842
428 Ga0495635_0104615 3300046663 Bacteria 1935
429 Ga0495635_0114860 3300046663 Bacteria 1838
430 Ga0495659_0005484 3300046664 Bacteria 3989
431 Ga0495659_0023956 3300046664 Unclassified 2077
432 Ga0495659_0092849 3300046664 Unclassified 1160
433 Ga0495659_0102817 3300046664 Unclassified 1108
434 Ga0495599_0050731 3300046678 Bacteria 2600
435 Ga0495599_0137319 3300046678 Bacteria 1517
436 Ga0495599_0178318 3300046678 Bacteria 1310
437 Ga0495599_0478585 3300046678 Bacteria 735
438 Ga0495658_0020317 3300046683 Bacteria 3483
439 Ga0495658_0226898 3300046683 Unclassified 1170
440 Ga0495658_0391478 3300046683 Bacteria 885
441 Ga0495669_0043653 3300046684 Unclassified 1996
442 Ga0495613_0006330 3300046689 Bacteria 8855
443 Ga0495600_0024115 3300046809 Bacteria 3915
444 Ga0495600_0082722 3300046809 Unclassified 2095
445 Ga0495600_0225991 3300046809 Bacteria 1196
446 Ga0495604_0013980 3300047317 Bacteria 6402
447 Ga0495636_0047790 3300047318 Unclassified 1787
448 Ga0495674_0061365 3300047319 Bacteria 3277
449 Ga0495674_0157467 3300047319 Bacteria 1902
450 Ga0495672_0024477 3300047320 Bacteria 3887
451 Ga0495676_0045669 3300047321 Bacteria 3563
452 Ga0495680_0291761 3300047322 Bacteria 1147
453 Ga0495680_0824182 3300047322 Bacteria 604
454 Ga0495675_0346096 3300047444 Bacteria 875
455 Ga0495677_0131470 3300047445 Unclassified 958
456 Ga0495684_0000781 3300047471 Bacteria 25805
457 Ga0495684_0155389 3300047471 Bacteria 1709
458 Ga0495684_0294869 3300047471 Unclassified 1166
459 Ga0495684_0595329 3300047471 Unclassified 747
460 Ga0495614_0205930 3300048089 Bacteria 891
461 Ga0496102_0319910 3300048905 Bacteria 1462
462 Ga0496104_0699422 3300048907 Bacteria 921
463 Ga0496106_0150947 3300048909 Bacteria 1833
464 Ga0496106_0292593 3300048909 Bacteria 1306
465 Ga0496107_0690623 3300048910 Bacteria 751
466 Ga0496108_0909558 3300048911 Bacteria 755
467 Ga0496109_0254817 3300048912 Bacteria 1653
468 Ga0496109_1236854 3300048912 Bacteria 683
469 Ga0496112_0105139 3300048915 Bacteria 2793
470 Ga0496113_0174148 3300048916 Bacteria 1705
471 Ga0496113_0430222 3300048916 Bacteria 1060
472 Ga0496114_0193022 3300048917 Bacteria 1782
473 Ga0501031_0026648 3300049568 Bacteria 3767
474 Ga0501031_0131488 3300049568 Bacteria 1635
475 Ga0501032_0007066 3300049569 Bacteria 8233
476 Ga0501032_0013309 3300049569 Bacteria 5856
477 Ga0501032_0323828 3300049569 Unclassified 994
478 Ga0501032_0496182 3300049569 Bacteria 780
479 Ga0501033_0001074 3300049570 Bacteria 24808
480 Ga0501033_0011155 3300049570 Bacteria 6884
481 Ga0501034_0027311 3300049571 Bacteria 5806
482 Ga0501034_0029124 3300049571 Bacteria 5614
483 Ga0501034_0029209 3300049571 Bacteria 5605
484 Ga0501034_0038383 3300049571 Bacteria 4849
485 Ga0501034_0044058 3300049571 Bacteria 4513
486 Ga0501034_0094480 3300049571 Bacteria 2986
487 Ga0501034_0179776 3300049571 Bacteria 2080
488 Ga0501034_0186837 3300049571 Bacteria 2035
489 Ga0501034_0236222 3300049571 Unclassified 1775
490 Ga0501036_0001495 3300049572 Bacteria 18017
491 Ga0501036_0006163 3300049572 Bacteria 9729
492 Ga0501036_0006706 3300049572 Bacteria 9357
493 Ga0501036_0081578 3300049572 Bacteria 2733
494 Ga0501036_0114497 3300049572 Bacteria 2279
495 Ga0501036_0132414 3300049572 Bacteria 2104
496 Ga0501036_0723931 3300049572 Unclassified 821
497 Ga0501037_0012583 3300049573 Bacteria 6235
498 Ga0501037_0030835 3300049573 Bacteria 3960
499 Ga0501037_0130071 3300049573 Bacteria 1805
500 Ga0501037_0175302 3300049573 Unclassified 1523
501 Ga0501038_0005089 3300049574 Bacteria 12219
502 Ga0501038_0008175 3300049574 Bacteria 9627
503 Ga0501038_0009449 3300049574 Bacteria 8949
504 Ga0501038_0020951 3300049574 Bacteria 5874
505 Ga0501038_0041777 3300049574 Bacteria 3998
506 Ga0501038_0130576 3300049574 Bacteria 2063
507 Ga0501038_0232168 3300049574 Bacteria 1468
508 Ga0501038_0351416 3300049574 Unclassified 1148
509 Ga0501038_0778903 3300049574 Bacteria 712
510 Ga0501039_0001928 3300049575 Bacteria 15372
511 Ga0501039_0020781 3300049575 Bacteria 5032
512 Ga0501039_0074850 3300049575 Bacteria 2632
513 Ga0501039_0133725 3300049575 Bacteria 1947
514 Ga0501039_0180623 3300049575 Unclassified 1659
515 Ga0501040_0012087 3300049576 Bacteria 5653
516 Ga0501040_0042589 3300049576 Bacteria 3093
517 Ga0501040_0068840 3300049576 Unclassified 2441
518 Ga0501040_0208183 3300049576 Bacteria 1390
519 Ga0501040_0678718 3300049576 Unclassified 745
520 Ga0501041_0020436 3300049577 Bacteria 3960
521 Ga0501041_0566908 3300049577 Unclassified 724
522 Ga0501042_0092114 3300049578 Unclassified 2176
523 Ga0501042_0118039 3300049578 Bacteria 1910
524 Ga0501043_0001097 3300049579 Bacteria 23794
525 Ga0501043_0009167 3300049579 Bacteria 7780
526 Ga0501043_0014798 3300049579 Bacteria 6108
527 Ga0501043_0054930 3300049579 Bacteria 3128
528 Ga0501046_0006591 3300049580 Bacteria 10256
529 Ga0501046_0011143 3300049580 Bacteria 7701
530 Ga0501046_0164606 3300049580 Bacteria 1666
531 Ga0501046_0388224 3300049580 Bacteria 1009
532 Ga0501047_0000303 3300049581 Bacteria 56793
533 Ga0501047_0005415 3300049581 Bacteria 12004
534 Ga0501047_0070641 3300049581 Bacteria 3361
535 Ga0501047_0229034 3300049581 Bacteria 1712
536 Ga0501047_0437268 3300049581 Bacteria 1138
537 Ga0501047_0579857 3300049581 Bacteria 944
538 Ga0501048_0011857 3300049582 Bacteria 6498
539 Ga0501048_0045096 3300049582 Unclassified 3150
540 Ga0501048_0102037 3300049582 Bacteria 2024
541 Ga0501048_0107759 3300049582 Bacteria 1967
542 Ga0501048_0276736 3300049582 Bacteria 1193
543 Ga0501048_0348306 3300049582 Unclassified 1056
544 Ga0501067_0006309 3300049583 Bacteria 6576
545 Ga0501067_0008357 3300049583 Bacteria 5746
546 Ga0501067_0017602 3300049583 Bacteria 3956
547 Ga0501067_0024242 3300049583 Bacteria 3365
548 Ga0501068_0107387 3300049584 Bacteria 1733
549 Ga0501068_0118048 3300049584 Bacteria 1653
550 Ga0501068_0140947 3300049584 Unclassified 1511
551 Ga0501069_0010684 3300049585 Bacteria 4866
552 Ga0501069_0011281 3300049585 Bacteria 4739
553 Ga0501069_0053302 3300049585 Bacteria 2253
554 Ga0501070_0006843 3300049586 Bacteria 9701
555 Ga0501070_0017112 3300049586 Bacteria 6084
556 Ga0501071_0003319 3300049587 Bacteria 10052
557 Ga0501071_0007812 3300049587 Bacteria 7052
558 Ga0501071_0050405 3300049587 Bacteria 2999
559 Ga0501071_0104658 3300049587 Bacteria 2089
560 Ga0501071_0229766 3300049587 Bacteria 1397
561 Ga0501072_0019330 3300049588 Bacteria 5264
562 Ga0501072_0034075 3300049588 Bacteria 3990
563 Ga0501072_0081784 3300049588 Bacteria 2560
564 Ga0501072_0089069 3300049588 Bacteria 2449
565 Ga0501072_0403881 3300049588 Bacteria 1084
566 Ga0501072_0497279 3300049588 Unclassified 964
567 Ga0501072_0527684 3300049588 Bacteria 933
568 Ga0501073_0008760 3300049589 Bacteria 7488
569 Ga0501073_0012775 3300049589 Bacteria 6125
570 Ga0501073_0023464 3300049589 Unclassified 4429
571 Ga0501073_0027513 3300049589 Bacteria 4066
572 Ga0501073_0051198 3300049589 Bacteria 2893
573 Ga0501073_0193445 3300049589 Unclassified 1407
574 Ga0501073_0295187 3300049589 Bacteria 1118
575 Ga0501073_0351592 3300049589 Bacteria 1017
576 Ga0501073_0429388 3300049589 Bacteria 913
577 Ga0501074_0007842 3300049590 Bacteria 7732
578 Ga0501074_0044580 3300049590 Bacteria 3210
579 Ga0501074_0061714 3300049590 Unclassified 2700
580 Ga0501074_0081245 3300049590 Bacteria 2324
581 Ga0501074_0243085 3300049590 Bacteria 1280
582 Ga0501075_0004073 3300049591 Bacteria 9870
583 Ga0501075_0018025 3300049591 Bacteria 5104
584 Ga0501075_0100352 3300049591 Bacteria 2198
585 Ga0501076_0022436 3300049592 Bacteria 4851
586 Ga0501076_0089449 3300049592 Bacteria 2475
587 Ga0501076_0161889 3300049592 Bacteria 1823
588 Ga0501076_0223605 3300049592 Bacteria 1538
589 Ga0501076_0646897 3300049592 Unclassified 872
590 Ga0501076_0655738 3300049592 Unclassified 866
591 Ga0501076_1064252 3300049592 Archaea 666
592 Ga0501077_0060523 3300049593 Bacteria 2403
593 Ga0501202_082937 3300049652 Bacteria 756
594 Ga0501233_134706 3300049668 Unclassified 678
595 Ga0501079_0032099 3300049741 Bacteria 4036
596 Ga0501079_0052647 3300049741 Bacteria 3141
597 Ga0501079_0091734 3300049741 Bacteria 2354
598 Ga0501079_0131861 3300049741 Bacteria 1945
599 Ga0501079_0167522 3300049741 Bacteria 1713
600 Ga0501079_0174707 3300049741 Bacteria 1675
601 Ga0501080_0010621 3300049742 Bacteria 8429
602 Ga0501080_0017260 3300049742 Bacteria 6670
603 Ga0501080_0032254 3300049742 Unclassified 4884
604 Ga0501080_0089875 3300049742 Bacteria 2853
605 Ga0501080_0259940 3300049742 Bacteria 1582
606 Ga0501081_0121208 3300049743 Bacteria 1863
607 Ga0501081_0175191 3300049743 Bacteria 1550
608 Ga0501081_0563594 3300049743 Bacteria 851
609 Ga0501083_0009649 3300049744 Bacteria 6819
610 Ga0501083_0485993 3300049744 Unclassified 803
611 Ga0501035_0011166 3300049822 Bacteria 8316
612 Ga0501035_0016663 3300049822 Bacteria 6775
613 Ga0501035_0032353 3300049822 Bacteria 4759
614 Ga0501035_0050064 3300049822 Unclassified 3744
615 Ga0501044_0010282 3300049823 Bacteria 10163
616 Ga0501044_0036158 3300049823 Bacteria 5167
617 Ga0501044_1203129 3300049823 Bacteria 625
618 Ga0501045_0028970 3300049824 Bacteria 3997
619 Ga0501045_0065973 3300049824 Bacteria 2658
620 Ga0501045_0090617 3300049824 Unclassified 2259
621 Ga0501045_0103809 3300049824 Bacteria 2105
622 Ga0501045_0300127 3300049824 Unclassified 1195
623 Ga0501045_0593825 3300049824 Unclassified 820
624 nmdc:mga03683_1231_c1 3300050489 Bacteria 7562
625 nmdc:mga00v17_10749_c1 3300050491 Bacteria 5014
626 nmdc:mga00v17_42654_c1 3300050491 Bacteria 2729
627 nmdc:mga00v17_452233_c1 3300050491 Unclassified 834
628 nmdc:mga00v17_6636_c1 3300050491 Bacteria 6145
629 nmdc:mga0yw44_105626_c1 3300050492 Bacteria 1799
630 nmdc:mga0yw44_490562_c1 3300050492 Bacteria 833
631 nmdc:mga0k408_15103_c1 3300050493 Bacteria 4267
632 nmdc:mga0k408_1949_c2 3300050493 Bacteria 5465
633 nmdc:mga0k408_2140_c1 3300050493 Bacteria 10589
634 nmdc:mga0k408_41434_c1 3300050493 Bacteria 2651
635 nmdc:mga06z11_194398_c1 3300050494 Bacteria 1176
636 nmdc:mga06z11_213704_c1 3300050494 Bacteria 1125
637 nmdc:mga06z11_31501_c1 3300050494 Bacteria 2577
638 nmdc:mga06z11_50767_c1 3300050494 Bacteria 2121
639 nmdc:mga06z11_84577_c1 3300050494 Archaea 1710
640 nmdc:mga04h51_16591_c1 3300050495 Bacteria 2140
641 nmdc:mga04h51_42950_c1 3300050495 Bacteria 1485
642 nmdc:mga04h51_51790_c1 3300050495 Bacteria 1381
643 nmdc:mga07m45_137623_c1 3300050496 Archaea 1414
644 nmdc:mga05p37_1089_c1 3300050507 Bacteria 8344
645 nmdc:mga05p37_48621_c1 3300050507 Bacteria 5216
646 nmdc:mga05p37_59404_c1 3300050507 Bacteria 4709
647 nmdc:mga0qj67_44526_c1 3300050509 Bacteria 3498
648 nmdc:mga0qj67_587393_c1 3300050509 Bacteria 892
649 nmdc:mga0qj67_959414_c1 3300050509 Unclassified 672
650 nmdc:mga06r32_284640_c1 3300050510 Bacteria 1640
651 nmdc:mga06r32_483021_c1 3300050510 Bacteria 1217
652 nmdc:mga06r32_613413_c1 3300050510 Bacteria 1058
653 nmdc:mga08y16_1048260_c1 3300050511 Unclassified 793
654 nmdc:mga08y16_117968_c1 3300050511 Bacteria 2762
655 nmdc:mga08y16_1662_c1 3300050511 Bacteria 22556
656 nmdc:mga08y16_70541_c1 3300050511 Bacteria 3642
657 nmdc:mga0n895_2500_c1 3300050512 Bacteria 14383
658 nmdc:mga0n895_357427_c1 3300050512 Bacteria 1479
659 nmdc:mga0n895_491410_c1 3300050512 Bacteria 1237
660 nmdc:mga0rr50_7602_c1 3300050513 Bacteria 6699
661 nmdc:mga0a205_82008_c1 3300050515 Bacteria 3115
662 Ga0495601_0114773 3300053077 Bacteria 1746
663 Ga0495601_0148395 3300053077 Unclassified 1530
664 Ga0495601_0152173 3300053077 Bacteria 1510
665 Ga0495601_0359758 3300053077 Bacteria 946
666 Ga0495595_0185738 3300053084 Bacteria 1032
667 Ga0495619_0001596 3300053085 Bacteria 14893
668 Ga0495619_0098439 3300053085 Bacteria 1988
669 Ga0495619_0522816 3300053085 Bacteria 815
670 Ga0500641_0009800 3300053096 Bacteria 3449
671 Ga0500555_000454 3300053103 Bacteria 16963
672 Ga0500592_012023 3300053116 Bacteria 1383
673 Ga0500616_0000468 3300053153 Bacteria 52556
674 Ga0500645_000401 3300053730 Bacteria 30362
675 Ga0501084_0001716 3300054114 Bacteria 17404
676 Ga0501084_0004899 3300054114 Bacteria 10940
677 Ga0501084_0074742 3300054114 Bacteria 2838
678 Ga0501084_0133079 3300054114 Bacteria 2093
679 Ga0501084_0216901 3300054114 Unclassified 1614
680 Ga0501084_0498676 3300054114 Bacteria 1029
681 Ga0590071_002068 3300059421 Bacteria 5136
682 Ga0590074_000268 3300059423 Bacteria 7035
683 Ga0590075_000635 3300059424 Bacteria 9337
684 Ga0590075_025464 3300059424 Bacteria 1487
685 Ga0590077_002769 3300059426 Bacteria 3692
686 Ga0590077_017635 3300059426 Bacteria 1503
687 Ga0501082_0006369 3300060353 Bacteria 10245
688 Ga0501082_0019041 3300060353 Bacteria 5915
689 Ga0501082_0022595 3300060353 Bacteria 5417
690 Ga0501082_0081523 3300060353 Unclassified 2791
691 Ga0501082_0139576 3300060353 Unclassified 2103
692 Ga0501082_0265010 3300060353 Bacteria 1495
693 Ga0501082_0895836 3300060353 Unclassified 776
694 Ga0530510_0200368 3300061734 Bacteria 1482
695 Ga0530510_0232664 3300061734 Bacteria 1371
696 Ga0530510_0463474 3300061734 Bacteria 959
697 Ga0065707_10128987
698 Ga0065714_10136433
699 Ga0065715_10016403
700 Ga0070676_10005015
701 Ga0070676_10159991
702 Ga0070690_100063803
703 Ga0070670_100002072
704 Ga0070670_100005373
705 Ga0070670_100072162
706 Ga0070670_100106806
707 Ga0070677_10014330
708 Ga0068869_100019724
709 Ga0068869_100059158
710 Ga0068869_100611206
711 Ga0070666_10254202
712 Ga0070682_100645023
713 Ga0068868_100178030
714 Ga0070660_100627962
715 Ga0070689_100180034
716 Ga0070689_100874676
717 Ga0070691_10174390
718 Ga0070691_10252866
719 Ga0070687_100067274
720 Ga0070661_100450556
721 Ga0070692_10087101
722 Ga0070668_100569563
723 Ga0070669_100022646
724 Ga0070669_100059870
725 Ga0070675_100025675
726 Ga0070675_100093286
727 Ga0070675_100240118
728 Ga0070675_100288200
729 Ga0070675_100296079
730 Ga0070675_100340216
731 Ga0070675_100412782
732 Ga0070671_100060543
733 Ga0070671_100880026
734 Ga0070674_100044189
735 Ga0070674_100207499
736 Ga0070674_100358753
737 Ga0070673_100009421
738 Ga0070673_100158952
739 Ga0070688_100068109
740 Ga0070688_100258760
741 Ga0070659_100053258
742 Ga0070659_100074746
743 Ga0070667_100060468
744 Ga0070667_100108882
745 Ga0070667_100388657
746 Ga0070667_100532455
747 Ga0070667_100889247
748 Ga0070714_100901872
749 Ga0070701_10022047
750 Ga0070705_100001469
751 Ga0070705_100182572
752 Ga0070700_100017542
753 Ga0070700_100076197
754 Ga0070700_100098839
755 Ga0070694_100000327
756 Ga0070694_100323323
757 Ga0070663_100019094
758 Ga0070663_100135292
759 Ga0070663_100153837
760 Ga0070663_100713033
761 Ga0070678_100121112
762 Ga0070678_100321643
763 Ga0070678_100872269
764 Ga0070662_100055525
765 Ga0070662_100518019
766 Ga0070681_10126722
767 Ga0068867_100007585
768 Ga0068867_100038097
769 Ga0070685_10094714
770 Ga0070706_100182956
771 Ga0070707_100542555
772 Ga0070707_100902539
773 Ga0070679_100070178
774 Ga0070672_100076824
775 Ga0070672_100172812
776 Ga0070672_100424590
777 Ga0070672_100756944
778 Ga0070686_100238225
779 Ga0070693_100012619
780 Ga0070704_100032910
781 Ga0070664_100162180
782 Ga0070664_100173158
783 Ga0070664_100246831
784 Ga0070664_100606921
785 Ga0068857_100014083
786 Ga0068854_100211274
787 Ga0070702_100761864
788 Ga0068852_100052613
789 Ga0068852_100243159
790 Ga0068852_100572893
791 Ga0068859_100165727
792 Ga0068859_100263128
793 Ga0068859_100611303
794 Ga0068864_100107137
795 Ga0068864_100347445
796 Ga0068864_100409730
797 Ga0068864_101165197
798 Ga0068866_10060235
799 Ga0068861_100880371
800 Ga0068851_10027144
801 Ga0068851_10115240
802 Ga0068870_10053107
803 Ga0068870_10093925
804 Ga0068863_100090250
805 Ga0068863_100240805
806 Ga0068863_100473547
807 Ga0068863_100753313
808 Ga0068858_100029935
809 Ga0068858_100163459
810 Ga0068858_100969486
811 Ga0068860_100066193
812 Ga0068860_100112767
813 Ga0068860_100134111
814 Ga0068860_100140831
815 Ga0068860_100154085
816 Ga0068860_100563845
817 Ga0068862_100020225
818 Ga0068862_100282872
819 Ga0068862_100483143
820 Ga0068862_100545324
821 Ga0075368_10002944
822 Ga0075368_10011629
823 Ga0075368_10014382
824 Ga0075363_100029579
825 Ga0075363_100131685
826 Ga0075364_10010271
827 Ga0075364_10027341
828 Ga0075364_10052957
829 Ga0070712_100229962
830 Ga0075362_10005887
831 Ga0075367_10014402
832 Ga0075367_10042143
833 Ga0075367_10050116
834 Ga0075366_10038885
835 Ga0075366_10068108
836 Ga0097621_100130420
837 Ga0097621_100191392
838 Ga0097621_100557016
839 Ga0097621_101178106
840 Ga0075370_10038398
841 Ga0068871_100004824
842 Ga0068871_100148491
843 Ga0068871_100198783
844 Ga0068871_100246593
845 Ga0075428_100418988
846 Ga0075430_100004074
847 Ga0075430_100048049
848 Ga0075431_100028563
849 Ga0075431_100336762
850 Ga0075433_10138990
851 Ga0075433_10413301
852 Ga0075434_100000141
853 Ga0075434_100375681
854 Ga0075434_100875008
855 Ga0068865_100072465
856 Ga0068865_100096215
857 Ga0068865_100231251
858 Ga0068865_100510042
859 Ga0097620_100093377
860 Ga0097620_100165727
861 Ga0097620_100263127
862 Ga0097620_100611306
863 Ga0075435_100020550
864 Ga0075435_100311932
865 Ga0111539_10000847
866 Ga0111539_10020401
867 Ga0111539_10157812
868 Ga0111539_10232577
869 Ga0111539_10528811
870 Ga0105245_10136032
871 Ga0105247_10706835
872 Ga0114129_10001134
873 Ga0114129_10035276
874 Ga0114129_10042135
875 Ga0105243_10098627
876 Ga0105242_10019250
877 Ga0105242_10257557
878 Ga0105242_10689379
879 Ga0105242_10863055
880 Ga0105248_10063503
881 Ga0105248_10267539
882 Ga0105248_10403212
883 Ga0105238_11400141
884 Ga0105249_10685546
885 Ga0105249_10800295
886 Ga0105249_11296774
887 Ga0105249_11356427
888 Ga0105239_10216918
889 Ga0157378_11043059
890 Ga0163162_10165623
891 Ga0163162_10181629
892 Ga0157372_10336901
893 Ga0157375_10987865
894 Ga0163163_10000023
895 Ga0157380_10065646
896 Ga0157380_10096214
897 Ga0157380_10140586
898 Ga0157380_10346397
899 Ga0157380_10820426
900 Ga0157380_10868450
901 Ga0157377_10444700
902 Ga0157377_10571009
903 Ga0207697_10059374
904 Ga0207682_10051347
905 Ga0207682_10069002
906 Ga0207682_10113788
907 Ga0207642_10173390
908 Ga0207688_10384601
909 Ga0207680_10539728
910 Ga0207647_10067681
911 Ga0207645_10004782
912 Ga0207645_10018534
913 Ga0207643_10037642
914 Ga0207643_10322660
915 Ga0207693_10206475
916 Ga0207660_10471246
917 Ga0207662_10020398
918 Ga0207657_10064295
919 Ga0207657_10439754
920 Ga0207649_10327898
921 Ga0207652_10017874
922 Ga0207646_10762771
923 Ga0207681_10319455
924 Ga0207681_10403584
925 Ga0207650_10014512
926 Ga0207650_10167414
927 Ga0207650_10312267
928 Ga0207659_10006525
929 Ga0207659_10106032
930 Ga0207659_10350915
931 Ga0207659_10369135
932 Ga0207659_10418259
933 Ga0207659_10513998
934 Ga0207659_10514675
935 Ga0207644_10017181
936 Ga0207644_10025008
937 Ga0207690_10098234
938 Ga0207690_10495965
939 Ga0207706_10068253
940 Ga0207706_10660221
941 Ga0207686_10005030
942 Ga0207709_10018126
943 Ga0207670_10151965
944 Ga0207670_10619660
945 Ga0207669_10083785
946 Ga0207669_10214537
947 Ga0207669_10340340
948 Ga0207669_10377587
949 Ga0207704_10060558
950 Ga0207704_10113960
951 Ga0207704_10463165
952 Ga0207691_10041925
953 Ga0207691_10092503
954 Ga0207711_10030745
955 Ga0207689_10004074
956 Ga0207689_10050423
957 Ga0207689_10055295
958 Ga0207689_10346593
959 Ga0207679_10127280
960 Ga0207651_10007077
961 Ga0207651_10073417
962 Ga0207712_10189591
963 Ga0207658_10213221
964 Ga0207658_10361118
965 Ga0207658_10711543
966 Ga0207658_10736501
967 Ga0207677_10122338
968 Ga0207677_10196465
969 Ga0207703_10013707
970 Ga0207639_10630173
971 Ga0207678_10012340
972 Ga0207678_10026929
973 Ga0207678_10115722
974 Ga0207678_10332538
975 Ga0207708_10008831
976 Ga0207708_10017040
977 Ga0207708_10089830
978 Ga0207641_10080946
979 Ga0207641_10622128
980 Ga0207641_10659386
981 Ga0207648_10000864
982 Ga0207648_10101267
983 Ga0207676_10037918
984 Ga0207676_10340664
985 Ga0207676_10393176
986 Ga0207674_10054353
987 Ga0207674_10485355
988 Ga0207675_100002891
989 Ga0207675_100217227
990 Ga0207675_100725858
991 Ga0207675_100865989
992 Ga0207683_10194963
993 Ga0207683_10253507
994 Ga0207698_10283099
995 Ga0207698_10421915
996 Ga0207698_10483171
997 Ga0209813_10043169
998 Ga0207428_10013427
999 Ga0207428_10076067
1000 Ga0207428_10123166
1001 Ga0268265_10050519
1002 Ga0268265_10073335
1003 Ga0268264_10039246
1004 Ga0268264_10054193
1005 Ga0268264_10066373
1006 Ga0268264_10380180
1007 Ga0268264_10389744
1008 Ga0307408_100038211
1009 Ga0307408_100093733
1010 Ga0307408_100181262
1011 Ga0307408_100258813
1012 Ga0307408_100824043
1013 Ga0307405_10324241
1014 Ga0307405_10739934
1015 Ga0307413_10112943
1016 Ga0307413_10135285
1017 Ga0307413_10178896
1018 Ga0307410_10009023
1019 Ga0307406_10048275
1020 Ga0307406_10063466
1021 Ga0307406_10358390
1022 Ga0307407_10069282
1023 Ga0307407_10249957
1024 Ga0307412_10079412
1025 Ga0307412_10279506
1026 Ga0307412_10362810
1027 Ga0307409_100097992
1028 Ga0307409_100335858
1029 Ga0307409_100353377
1030 Ga0307409_100663152
1031 Ga0307416_100035661
1032 Ga0307416_100057277
1033 Ga0307416_100077740
1034 Ga0307416_100205439
1035 Ga0307416_100383707
1036 Ga0307416_100606526
1037 Ga0307416_100886899
1038 Ga0307416_101757369
1039 Ga0307414_10015598
1040 Ga0307414_10125800
1041 Ga0307411_10007102
1042 Ga0307411_10008576
1043 Ga0307411_10017063
1044 Ga0307411_10875436
1045 Ga0307415_100007022
1046 Ga0307415_100087031
1047 Ga0373948_0051843
1048 Ga0373944_0213586
1049 Ga0373952_0062110
1050 Ga0373923_0091090
1051 Ga0373923_0201707
1052 Ga0373936_0112615
1053 Ga0373945_0194780
1054 Ga0373953_0100395
1055 Ga0373954_0073974
1056 Ga0373957_0011007
1057 Ga0373960_0004861
1058 Ga0373943_0014296
1059 Ga0373946_0018849
1060 Ga0373955_0034695
1061 Ga0373955_0047750
1062 Ga0373955_0139605
1063 Ga0373924_0013214
1064 Ga0373924_0132450
1065 Ga0373935_0024448
1066 Ga0373935_0137994
1067 Ga0373933_0008204
1068 Ga0373947_0041552
1069 Ga0373947_0097845
1070 Ga0373937_0000128
1071 Ga0373937_0000513
1072 Ga0373937_0150228
1073 Ga0373925_0003323
1074 Ga0373925_0030418
1075 Ga0395905_0197996
1076 Ga0451802_1175522
1077 Ga0451853_2618196
1078 Ga0439433_0026499
1079 Ga0450894_004033
1080 Ga0450895_005218
1081 Ga0439446_0044812
1082 Ga0450908_008297
1083 Ga0439435_0073268
1084 Ga0439464_0052995
1085 Ga0439460_0004112
1086 Ga0439460_0014246
1087 Ga0450918_046219
1088 Ga0451577_0091381
1089 Ga0451577_0157571
1090 Ga0453684_0154757
1091 Ga0451576_0106012
1092 Ga0466967_0837338
1093 Ga0495629_0149182
1094 Ga0495629_0555733
1095 Ga0495651_0011249
1096 Ga0495651_0174083
1097 Ga0495582_0112895
1098 Ga0495584_0304818
1099 Ga0495584_0315767
1100 Ga0495608_0212450
1101 Ga0495618_0113946
1102 Ga0495628_0106701
1103 Ga0495628_0237712
1104 Ga0495628_0310888
1105 Ga0495628_0432377
1106 Ga0495630_0082301
1107 Ga0495630_0576358
1108 Ga0495663_0013521
1109 Ga0495642_0001306
1110 Ga0495652_0264135
1111 Ga0495665_0279027
1112 Ga0495640_0208308
1113 Ga0495587_0260963
1114 Ga0495598_0006984
1115 Ga0495598_0153623
1116 Ga0495621_0027438
1117 Ga0495621_0052072
1118 Ga0495645_0040697
1119 Ga0495645_0050526
1120 Ga0495645_0565962
1121 Ga0495633_0284403
1122 Ga0495667_0017384
1123 Ga0495634_0103074
1124 Ga0495635_0104615
1125 Ga0495635_0114860
1126 Ga0495659_0005484
1127 Ga0495659_0023956
1128 Ga0495659_0092849
1129 Ga0495659_0102817
1130 Ga0495599_0050731
1131 Ga0495599_0137319
1132 Ga0495599_0178318
1133 Ga0495599_0478585
1134 Ga0495658_0020317
1135 Ga0495658_0226898
1136 Ga0495658_0391478
1137 Ga0495669_0043653
1138 Ga0495613_0006330
1139 Ga0495600_0024115
1140 Ga0495600_0082722
1141 Ga0495600_0225991
1142 Ga0495604_0013980
1143 Ga0495636_0047790
1144 Ga0495674_0061365
1145 Ga0495674_0157467
1146 Ga0495672_0024477
1147 Ga0495676_0045669
1148 Ga0495680_0291761
1149 Ga0495680_0824182
1150 Ga0495675_0346096
1151 Ga0495677_0131470
1152 Ga0495684_0000781
1153 Ga0495684_0155389
1154 Ga0495684_0294869
1155 Ga0495684_0595329
1156 Ga0495614_0205930
1157 Ga0496102_0319910
1158 Ga0496104_0699422
1159 Ga0496106_0150947
1160 Ga0496106_0292593
1161 Ga0496107_0690623
1162 Ga0496108_0909558
1163 Ga0496109_0254817
1164 Ga0496109_1236854
1165 Ga0496112_0105139
1166 Ga0496113_0174148
1167 Ga0496113_0430222
1168 Ga0496114_0193022
1169 Ga0501031_0026648
1170 Ga0501031_0131488
1171 Ga0501032_0007066
1172 Ga0501032_0013309
1173 Ga0501032_0323828
1174 Ga0501032_0496182
1175 Ga0501033_0001074
1176 Ga0501033_0011155
1177 Ga0501034_0027311
1178 Ga0501034_0029124
1179 Ga0501034_0029209
1180 Ga0501034_0038383
1181 Ga0501034_0044058
1182 Ga0501034_0094480
1183 Ga0501034_0179776
1184 Ga0501034_0186837
1185 Ga0501034_0236222
1186 Ga0501036_0001495
1187 Ga0501036_0006163
1188 Ga0501036_0006706
1189 Ga0501036_0081578
1190 Ga0501036_0114497
1191 Ga0501036_0132414
1192 Ga0501036_0723931
1193 Ga0501037_0012583
1194 Ga0501037_0030835
1195 Ga0501037_0130071
1196 Ga0501037_0175302
1197 Ga0501038_0005089
1198 Ga0501038_0008175
1199 Ga0501038_0009449
1200 Ga0501038_0020951
1201 Ga0501038_0041777
1202 Ga0501038_0130576
1203 Ga0501038_0232168
1204 Ga0501038_0351416
1205 Ga0501038_0778903
1206 Ga0501039_0001928
1207 Ga0501039_0020781
1208 Ga0501039_0074850
1209 Ga0501039_0133725
1210 Ga0501039_0180623
1211 Ga0501040_0012087
1212 Ga0501040_0042589
1213 Ga0501040_0068840
1214 Ga0501040_0208183
1215 Ga0501040_0678718
1216 Ga0501041_0020436
1217 Ga0501041_0566908
1218 Ga0501042_0092114
1219 Ga0501042_0118039
1220 Ga0501043_0001097
1221 Ga0501043_0009167
1222 Ga0501043_0014798
1223 Ga0501043_0054930
1224 Ga0501046_0006591
1225 Ga0501046_0011143
1226 Ga0501046_0164606
1227 Ga0501046_0388224
1228 Ga0501047_0000303
1229 Ga0501047_0005415
1230 Ga0501047_0070641
1231 Ga0501047_0229034
1232 Ga0501047_0437268
1233 Ga0501047_0579857
1234 Ga0501048_0011857
1235 Ga0501048_0045096
1236 Ga0501048_0102037
1237 Ga0501048_0107759
1238 Ga0501048_0276736
1239 Ga0501048_0348306
1240 Ga0501067_0006309
1241 Ga0501067_0008357
1242 Ga0501067_0017602
1243 Ga0501067_0024242
1244 Ga0501068_0107387
1245 Ga0501068_0118048
1246 Ga0501068_0140947
1247 Ga0501069_0010684
1248 Ga0501069_0011281
1249 Ga0501069_0053302
1250 Ga0501070_0006843
1251 Ga0501070_0017112
1252 Ga0501071_0003319
1253 Ga0501071_0007812
1254 Ga0501071_0050405
1255 Ga0501071_0104658
1256 Ga0501071_0229766
1257 Ga0501072_0019330
1258 Ga0501072_0034075
1259 Ga0501072_0081784
1260 Ga0501072_0089069
1261 Ga0501072_0403881
1262 Ga0501072_0497279
1263 Ga0501072_0527684
1264 Ga0501073_0008760
1265 Ga0501073_0012775
1266 Ga0501073_0023464
1267 Ga0501073_0027513
1268 Ga0501073_0051198
1269 Ga0501073_0193445
1270 Ga0501073_0295187
1271 Ga0501073_0351592
1272 Ga0501073_0429388
1273 Ga0501074_0007842
1274 Ga0501074_0044580
1275 Ga0501074_0061714
1276 Ga0501074_0081245
1277 Ga0501074_0243085
1278 Ga0501075_0004073
1279 Ga0501075_0018025
1280 Ga0501075_0100352
1281 Ga0501076_0022436
1282 Ga0501076_0089449
1283 Ga0501076_0161889
1284 Ga0501076_0223605
1285 Ga0501076_0646897
1286 Ga0501076_0655738
1287 Ga0501076_1064252
1288 Ga0501077_0060523
1289 Ga0501202_082937
1290 Ga0501233_134706
1291 Ga0501079_0032099
1292 Ga0501079_0052647
1293 Ga0501079_0091734
1294 Ga0501079_0131861
1295 Ga0501079_0167522
1296 Ga0501079_0174707
1297 Ga0501080_0010621
1298 Ga0501080_0017260
1299 Ga0501080_0032254
1300 Ga0501080_0089875
1301 Ga0501080_0259940
1302 Ga0501081_0121208
1303 Ga0501081_0175191
1304 Ga0501081_0563594
1305 Ga0501083_0009649
1306 Ga0501083_0485993
1307 Ga0501035_0011166
1308 Ga0501035_0016663
1309 Ga0501035_0032353
1310 Ga0501035_0050064
1311 Ga0501044_0010282
1312 Ga0501044_0036158
1313 Ga0501044_1203129
1314 Ga0501045_0028970
1315 Ga0501045_0065973
1316 Ga0501045_0090617
1317 Ga0501045_0103809
1318 Ga0501045_0300127
1319 Ga0501045_0593825
1320 nmdc:mga03683_1231_c1
1321 nmdc:mga00v17_10749_c1
1322 nmdc:mga00v17_42654_c1
1323 nmdc:mga00v17_452233_c1
1324 nmdc:mga00v17_6636_c1
1325 nmdc:mga0yw44_105626_c1
1326 nmdc:mga0yw44_490562_c1
1327 nmdc:mga0k408_15103_c1
1328 nmdc:mga0k408_1949_c2
1329 nmdc:mga0k408_2140_c1
1330 nmdc:mga0k408_41434_c1
1331 nmdc:mga06z11_194398_c1
1332 nmdc:mga06z11_213704_c1
1333 nmdc:mga06z11_31501_c1
1334 nmdc:mga06z11_50767_c1
1335 nmdc:mga06z11_84577_c1
1336 nmdc:mga04h51_16591_c1
1337 nmdc:mga04h51_42950_c1
1338 nmdc:mga04h51_51790_c1
1339 nmdc:mga07m45_137623_c1
1340 nmdc:mga05p37_1089_c1
1341 nmdc:mga05p37_48621_c1
1342 nmdc:mga05p37_59404_c1
1343 nmdc:mga0qj67_44526_c1
1344 nmdc:mga0qj67_587393_c1
1345 nmdc:mga0qj67_959414_c1
1346 nmdc:mga06r32_284640_c1
1347 nmdc:mga06r32_483021_c1
1348 nmdc:mga06r32_613413_c1
1349 nmdc:mga08y16_1048260_c1
1350 nmdc:mga08y16_117968_c1
1351 nmdc:mga08y16_1662_c1
1352 nmdc:mga08y16_70541_c1
1353 nmdc:mga0n895_2500_c1
1354 nmdc:mga0n895_357427_c1
1355 nmdc:mga0n895_491410_c1
1356 nmdc:mga0rr50_7602_c1
1357 nmdc:mga0a205_82008_c1
1358 Ga0495601_0114773
1359 Ga0495601_0148395
1360 Ga0495601_0152173
1361 Ga0495601_0359758
1362 Ga0495595_0185738
1363 Ga0495619_0001596
1364 Ga0495619_0098439
1365 Ga0495619_0522816
1366 Ga0500641_0009800
1367 Ga0500555_000454
1368 Ga0500592_012023
1369 Ga0500616_0000468
1370 Ga0500645_000401
1371 Ga0501084_0001716
1372 Ga0501084_0004899
1373 Ga0501084_0074742
1374 Ga0501084_0133079
1375 Ga0501084_0216901
1376 Ga0501084_0498676
1377 Ga0590071_002068
1378 Ga0590074_000268
1379 Ga0590075_000635
1380 Ga0590075_025464
1381 Ga0590077_002769
1382 Ga0590077_017635
1383 Ga0501082_0006369
1384 Ga0501082_0019041
1385 Ga0501082_0022595
1386 Ga0501082_0081523
1387 Ga0501082_0139576
1388 Ga0501082_0265010
1389 Ga0501082_0895836
1390 Ga0530510_0200368
1391 Ga0530510_0232664
1392 Ga0530510_0463474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

73

226

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rv4-assembly1.cif.gz_A 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8208 7 183
4rv4-assembly1.cif.gz_B 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8155 4 183
4rv4-assembly2.cif.gz_C-2 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8089 2 183
3m3h-assembly1.cif.gz_A-2 1.75 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' 0.7979 2 183
3dez-assembly1.cif.gz_B crystal structure of orotate phosphoribosyltransferase from streptococcus mutans 0.7957 6 183
ID Description Score Start End Superfamily
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8349 12 204 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8155 4 183 3.40.50.2020
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8153 12 204 3.40.50.2020
af_O61790_6_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7775 10 182 3.40.50.2020
af_Q4DBC5_255_457_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7774 10 182 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1F2SG32-F1-model_v4 Uncharacterized protein 0.9827 1 206
AF-A0A1F5NQG5-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9621 4 206
AF-A0A1F5NQG5-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9438 4 206
AF-A0A7Y4WT29-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9425 20 206
AF-A0A7Y4WT29-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9329 20 206

Map