F475702

General Info

Members Datasets Scaffolds Average Seq Length
694 274 682 311

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100002197|Ga0070680_1000021973
Length 338
Sequence MPGTRLRLVFAGTPDFAVPGLRACIEAGEVVAVYTQPDRPAGRGRKLAPSPVKQAALAAGLPVEQPESLKISETQARLRDWAPDLMVVIAYGLILPRKVLAIPRLGCWNLHASLLPRWRGAAPIQRAILAGDAETGVCLMQMEPGLDTGPVLLSESTPIRADDTGGTLHDRLADIGARVLRAGLQRVIAGESMSAMPQSGAGATYAHKLEKSEAELDFSRPAIELERKVRAFDPWPVAEADVAGERVRVWHALAVPSPESRETRRSCGSPSGPSASPMFAPASCLRSPSPGQIVAASKRGIDIVCGEGALRILKLQRAGGRVIGAADYVNARAGLRQA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
5 2734482264 Dyella sp. AD052 Isolate Unclassified
6 2738543009 Luteibacter sp. OK325 Isolate Unclassified
7 2739367700 Dyella sp. YR388 Isolate Unclassified
8 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
9 2884411467 Dyella sp. AD56 Isolate Rhizosphere
10 2919085039 Luteibacter sp. 1214 Isolate Unclassified
11 2928963466 Dyella japonica 1073 Isolate Unclassified
12 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
183 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 1.73
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 0
Rhizoplane 1.44
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 7.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000076 3300001915 Bacteria 24422
2 JGI24741J21665_1005437 3300001915 Bacteria 2662
3 JGI24740J21852_10000279 3300001979 Bacteria 21672
4 JGI24740J21852_10005082 3300001979 Bacteria 5586
5 JGI25156J39149_1002783 3300002705 Bacteria 6064
6 JGI25156J39149_1009367 3300002705 Bacteria 2388
7 JGI25162J39368_1001445 3300002737 Bacteria 12645
8 JGI25162J39368_1003044 3300002737 Bacteria 5436
9 JGI25154J39366_1004509 3300002738 Bacteria 2480
10 JGI25157J39369_1000344 3300002741 Bacteria 32837
11 JGI25157J39369_1001046 3300002741 Bacteria 12637
12 JGI25163J39215_1000588 3300002771 Bacteria 10200
13 JGI25164J39214_1000117 3300002772 Bacteria 76695
14 JGI25164J39214_1000714 3300002772 Bacteria 12645
15 JGI25164J39214_1000865 3300002772 Bacteria 10312
16 JGI25165J46597_1000235 3300003214 Bacteria 76684
17 JGI25165J46597_1001443 3300003214 Bacteria 12645
18 JGI25165J46597_1001780 3300003214 Bacteria 9280
19 Ga0055533_1001538 3300003756 Bacteria 6012
20 Ga0055527_1003026 3300003760 Bacteria 2614
21 Ga0055535_1000941 3300003761 Bacteria 19328
22 Ga0055535_1001080 3300003761 Bacteria 16755
23 Ga0055535_1001379 3300003761 Bacteria 12645
24 Ga0055542_1000245 3300003762 Bacteria 62120
25 Ga0055542_1001179 3300003762 Bacteria 14972
26 Ga0055542_1001180 3300003762 Bacteria 14953
27 Ga0055542_1001349 3300003762 Bacteria 12645
28 Ga0055529_1000314 3300003763 Bacteria 55435
29 Ga0055529_1001072 3300003763 Bacteria 12645
30 Ga0055529_1002135 3300003763 Bacteria 4157
31 Ga0070658_10002163 3300005327 Bacteria 16493
32 Ga0070683_100015187 3300005329 Bacteria 6760
33 Ga0070683_100015955 3300005329 Bacteria 6608
34 Ga0070683_100293315 3300005329 Bacteria 1547
35 Ga0070690_100029514 3300005330 Bacteria 3402
36 Ga0070670_100227448 3300005331 Bacteria 1623
37 Ga0068869_100124752 3300005334 Bacteria 1973
38 Ga0070666_10000001 3300005335 Bacteria 543080
39 Ga0070666_10052751 3300005335 Bacteria 2741
40 Ga0070680_100000946 3300005336 Bacteria 20577
41 Ga0070680_100002197 3300005336 Bacteria 14383
42 Ga0070680_100100120 3300005336 Bacteria 2405
43 Ga0070682_100014480 3300005337 Bacteria 4559
44 Ga0070682_100014970 3300005337 Bacteria 4491
45 Ga0070682_100015837 3300005337 Bacteria 4375
46 Ga0070682_100045315 3300005337 Bacteria 2726
47 Ga0068868_100016923 3300005338 Bacteria 5424
48 Ga0068868_100266644 3300005338 Bacteria 1446
49 Ga0070660_100046496 3300005339 Bacteria 3327
50 Ga0070660_100049491 3300005339 Bacteria 3231
51 Ga0070660_100163024 3300005339 Bacteria 1797
52 Ga0070661_100002526 3300005344 Bacteria 12533
53 Ga0070661_100003952 3300005344 Bacteria 10199
54 Ga0070661_100034435 3300005344 Bacteria 3672
55 Ga0070661_100096555 3300005344 Bacteria 2193
56 Ga0070692_10000307 3300005345 Bacteria 13933
57 Ga0070692_10000420 3300005345 Bacteria 12798
58 Ga0070692_10159273 3300005345 Bacteria 1292
59 Ga0070668_100064734 3300005347 Bacteria 2835
60 Ga0070675_100074093 3300005354 Bacteria 2827
61 Ga0070688_100125161 3300005365 Bacteria 1727
62 Ga0070659_100013061 3300005366 Bacteria 6176
63 Ga0070659_100028080 3300005366 Bacteria 4342
64 Ga0070667_100013367 3300005367 Bacteria 6786
65 Ga0070667_100139556 3300005367 Bacteria 2121
66 Ga0070667_100317045 3300005367 Bacteria 1406
67 Ga0070714_100000136 3300005435 Bacteria 58402
68 Ga0070711_100024811 3300005439 Bacteria 3916
69 Ga0070663_100035443 3300005455 Bacteria 3463
70 Ga0070662_100065358 3300005457 Bacteria 2666
71 Ga0070662_100175736 3300005457 Bacteria 1685
72 Ga0070681_10000552 3300005458 Bacteria 30843
73 Ga0070681_10003671 3300005458 Bacteria 14393
74 Ga0070681_10004860 3300005458 Bacteria 12890
75 Ga0070681_10007360 3300005458 Bacteria 10759
76 Ga0070681_10039513 3300005458 Bacteria 4729
77 Ga0070681_10045534 3300005458 Bacteria 4389
78 Ga0070681_10207387 3300005458 Bacteria 1876
79 Ga0068867_100308495 3300005459 Bacteria 1307
80 Ga0070685_10002434 3300005466 Bacteria 9568
81 Ga0070685_10013112 3300005466 Bacteria 4364
82 Ga0070679_100002097 3300005530 Bacteria 17962
83 Ga0070679_100003490 3300005530 Bacteria 14393
84 Ga0070679_100012167 3300005530 Bacteria 8221
85 Ga0070679_100049404 3300005530 Bacteria 4189
86 Ga0070679_100160069 3300005530 Bacteria 2226
87 Ga0070684_100008594 3300005535 Bacteria 7998
88 Ga0070684_100010992 3300005535 Bacteria 7199
89 Ga0070684_100388599 3300005535 Bacteria 1286
90 Ga0068853_100002290 3300005539 Bacteria 14303
91 Ga0068853_100015163 3300005539 Bacteria 6336
92 Ga0068853_100044837 3300005539 Bacteria 3786
93 Ga0068853_100059863 3300005539 Bacteria 3290
94 Ga0068853_100063960 3300005539 Bacteria 3188
95 Ga0068853_100073444 3300005539 Bacteria 2982
96 Ga0068853_100214666 3300005539 Bacteria 1755
97 Ga0070672_100029858 3300005543 Bacteria 4092
98 Ga0070686_100035506 3300005544 Bacteria 3080
99 Ga0070696_100034217 3300005546 Bacteria 3495
100 Ga0070696_100154920 3300005546 Bacteria 1684
101 Ga0070693_100006423 3300005547 Bacteria 5697
102 Ga0070693_100010956 3300005547 Bacteria 4556
103 Ga0070693_100019703 3300005547 Bacteria 3543
104 Ga0070693_100101715 3300005547 Bacteria 1752
105 Ga0070665_100000712 3300005548 Bacteria 44327
106 Ga0070665_100009799 3300005548 Bacteria 9687
107 Ga0070665_100026563 3300005548 Bacteria 5829
108 Ga0068855_100016860 3300005563 Bacteria 8784
109 Ga0068855_100108668 3300005563 Bacteria 3185
110 Ga0068855_100123760 3300005563 Bacteria 2958
111 Ga0068855_100254647 3300005563 Bacteria 1957
112 Ga0068855_100493937 3300005563 Bacteria 1331
113 Ga0068855_100505101 3300005563 Bacteria 1313
114 Ga0070664_100146377 3300005564 Bacteria 2083
115 Ga0068857_100068091 3300005577 Bacteria 3169
116 Ga0068854_100000026 3300005578 Bacteria 118880
117 Ga0068854_100003525 3300005578 Bacteria 9775
118 Ga0068854_100006081 3300005578 Bacteria 7656
119 Ga0068856_100003430 3300005614 Bacteria 16024
120 Ga0068856_100003717 3300005614 Bacteria 15310
121 Ga0068856_100086051 3300005614 Bacteria 3123
122 Ga0068856_100154783 3300005614 Bacteria 2302
123 Ga0068856_100258841 3300005614 Bacteria 1755
124 Ga0068852_100002438 3300005616 Bacteria 12803
125 Ga0068852_100027419 3300005616 Bacteria 4642
126 Ga0068852_100046785 3300005616 Bacteria 3687
127 Ga0068852_100077654 3300005616 Bacteria 2936
128 Ga0068852_100081911 3300005616 Bacteria 2866
129 Ga0068852_100093186 3300005616 Bacteria 2699
130 Ga0068859_100185524 3300005617 Bacteria 2164
131 Ga0068859_100194926 3300005617 Bacteria 2110
132 Ga0068864_100001937 3300005618 Bacteria 17002
133 Ga0068864_100169015 3300005618 Bacteria 1992
134 Ga0068864_100441945 3300005618 Bacteria 1242
135 Ga0068851_10003106 3300005834 Bacteria 7357
136 Ga0068851_10027637 3300005834 Bacteria 2797
137 Ga0068851_10050072 3300005834 Bacteria 2120
138 Ga0068870_10063166 3300005840 Bacteria 1997
139 Ga0068863_100113210 3300005841 Bacteria 2584
140 Ga0068863_100179577 3300005841 Bacteria 2032
141 Ga0068863_100312146 3300005841 Bacteria 1526
142 Ga0068863_100333736 3300005841 Bacteria 1474
143 Ga0068858_100003930 3300005842 Bacteria 14672
144 Ga0068858_100072506 3300005842 Bacteria 3195
145 Ga0068860_100000822 3300005843 Bacteria 34721
146 Ga0068860_100012637 3300005843 Bacteria 8308
147 Ga0097621_100052340 3300006237 Bacteria 3326
148 Ga0097621_100069711 3300006237 Bacteria 2903
149 Ga0097621_100122753 3300006237 Bacteria 2205
150 Ga0068871_100450501 3300006358 Bacteria 1153
151 Ga0068865_100003462 3300006881 Bacteria 9456
152 Ga0068865_100025746 3300006881 Bacteria 3874
153 Ga0068865_100050142 3300006881 Bacteria 2882
154 Ga0097620_100185528 3300006931 Bacteria 2164
155 Ga0097620_100194937 3300006931 Bacteria 2110
156 Ga0105240_10003317 3300009093 Bacteria 25157
157 Ga0105240_10035352 3300009093 Bacteria 6440
158 Ga0105240_10076161 3300009093 Bacteria 4137
159 Ga0105240_10115212 3300009093 Bacteria 3245
160 Ga0105240_10173120 3300009093 Bacteria 2555
161 Ga0105240_10289346 3300009093 Bacteria 1879
162 Ga0105245_10479507 3300009098 Bacteria 1257
163 Ga0105247_10000804 3300009101 Bacteria 23935
164 Ga0105241_10036533 3300009174 Bacteria 3697
165 Ga0105241_10212677 3300009174 Bacteria 1621
166 Ga0105241_10535294 3300009174 Bacteria 1049
167 Ga0105242_10153044 3300009176 Bacteria 2013
168 Ga0105248_10190603 3300009177 Bacteria 2310
169 Ga0105237_10000108 3300009545 Bacteria 116481
170 Ga0105237_10022010 3300009545 Bacteria 6543
171 Ga0105237_10060807 3300009545 Bacteria 3778
172 Ga0105237_10168033 3300009545 Bacteria 2193
173 Ga0105237_10224269 3300009545 Bacteria 1880
174 Ga0105237_10663088 3300009545 Bacteria 1050
175 Ga0105238_10000729 3300009551 Bacteria 34322
176 Ga0105238_10001656 3300009551 Bacteria 22366
177 Ga0105238_10023815 3300009551 Bacteria 6241
178 Ga0105238_10029898 3300009551 Bacteria 5547
179 Ga0105238_10033003 3300009551 Bacteria 5268
180 Ga0105238_10042081 3300009551 Bacteria 4626
181 Ga0105238_10059367 3300009551 Bacteria 3832
182 Ga0105238_10063300 3300009551 Bacteria 3699
183 Ga0105238_10314826 3300009551 Bacteria 1550
184 Ga0105238_10492747 3300009551 Bacteria 1226
185 Ga0105249_10011804 3300009553 Bacteria 7681
186 Ga0105239_10000830 3300010375 Bacteria 43916
187 Ga0105239_10011256 3300010375 Bacteria 9979
188 Ga0105239_10059531 3300010375 Bacteria 4192
189 Ga0105239_10082349 3300010375 Bacteria 3543
190 Ga0105239_10212423 3300010375 Bacteria 2169
191 Ga0105239_10416576 3300010375 Bacteria 1521
192 Ga0105246_10024732 3300011119 Bacteria 3906
193 Ga0157373_10002433 3300013100 Bacteria 14173
194 Ga0157373_10005601 3300013100 Bacteria 9416
195 Ga0157373_10020677 3300013100 Bacteria 4781
196 Ga0157373_10040386 3300013100 Bacteria 3339
197 Ga0157371_10005965 3300013102 Bacteria 10162
198 Ga0157371_10008699 3300013102 Bacteria 8059
199 Ga0157371_10033226 3300013102 Bacteria 3708
200 Ga0157371_10161455 3300013102 Bacteria 1601
201 Ga0157370_10001106 3300013104 Bacteria 33789
202 Ga0157370_10007218 3300013104 Bacteria 12126
203 Ga0157370_10008714 3300013104 Bacteria 10912
204 Ga0157370_10010315 3300013104 Bacteria 9854
205 Ga0157370_10115169 3300013104 Bacteria 2511
206 Ga0157370_10167396 3300013104 Bacteria 2043
207 Ga0157369_10001250 3300013105 Bacteria 31665
208 Ga0157369_10006062 3300013105 Bacteria 14025
209 Ga0157369_10022892 3300013105 Bacteria 6967
210 Ga0157369_10130393 3300013105 Bacteria 2665
211 Ga0157374_10077155 3300013296 Bacteria 3152
212 Ga0157378_10069854 3300013297 Bacteria 3152
213 Ga0157378_10268527 3300013297 Bacteria 1640
214 Ga0163162_10000310 3300013306 Bacteria 45072
215 Ga0163162_10000642 3300013306 Bacteria 32380
216 Ga0163162_10087782 3300013306 Bacteria 3189
217 Ga0163162_10224333 3300013306 Bacteria 2009
218 Ga0157372_10007610 3300013307 Bacteria 11517
219 Ga0157372_10009427 3300013307 Bacteria 10387
220 Ga0157372_10011313 3300013307 Bacteria 9489
221 Ga0157372_10021398 3300013307 Bacteria 6987
222 Ga0157372_10029270 3300013307 Bacteria 6013
223 Ga0157372_10059694 3300013307 Bacteria 4267
224 Ga0157372_10094119 3300013307 Bacteria 3411
225 Ga0157372_10813170 3300013307 Bacteria 1085
226 Ga0157375_10031352 3300013308 Bacteria 5024
227 Ga0157375_10226444 3300013308 Bacteria 2028
228 Ga0163163_10001487 3300014325 Bacteria 19846
229 Ga0163163_10056882 3300014325 Bacteria 3866
230 Ga0157379_10013005 3300014968 Bacteria 7285
231 Ga0157379_10305607 3300014968 Bacteria 1450
232 Ga0157376_10014582 3300014969 Bacteria 5905
233 Ga0157376_10037971 3300014969 Bacteria 3916
234 Ga0157376_10045836 3300014969 Bacteria 3602
235 Ga0157376_10074292 3300014969 Bacteria 2898
236 Ga0182006_1000041 3300015261 Bacteria 203413
237 Ga0182006_1000133 3300015261 Bacteria 80418
238 Ga0182007_10003846 3300015262 Bacteria 6981
239 Ga0182005_1000257 3300015265 Bacteria 33567
240 Ga0182005_1002454 3300015265 Bacteria 6617
241 Ga0183368_1002 3300015687 Bacteria 1865598
242 Ga0163161_10012913 3300017792 Bacteria 5804
243 Ga0197907_10696324 3300020069 Bacteria 2433
244 Ga0206356_10033220 3300020070 Bacteria 2954
245 Ga0206356_10907506 3300020070 Bacteria 2184
246 Ga0206356_11546151 3300020070 Bacteria 3937
247 Ga0206354_10818447 3300020081 Bacteria 3035
248 Ga0206354_10932484 3300020081 Bacteria 4408
249 Ga0206354_11021742 3300020081 Bacteria 1863
250 Ga0206353_10050604 3300020082 Bacteria 3105
251 Ga0206353_10485823 3300020082 Bacteria 3438
252 Ga0206353_10562421 3300020082 Bacteria 1369
253 Ga0206353_10579021 3300020082 Bacteria 3894
254 Ga0209760_100701 3300025207 Bacteria 5170
255 Ga0209784_100053 3300025224 Bacteria 182075
256 Ga0209566_100922 3300025225 Bacteria 13688
257 Ga0209674_100014 3300025226 Bacteria 704989
258 Ga0209672_100089 3300025228 Bacteria 120658
259 Ga0209672_111421 3300025228 Bacteria 1150
260 Ga0207427_100051 3300025231 Bacteria 218792
261 Ga0207427_100061 3300025231 Bacteria 182815
262 Ga0207427_100129 3300025231 Bacteria 94644
263 Ga0209437_100037 3300025233 Bacteria 459730
264 Ga0209437_100118 3300025233 Bacteria 207534
265 Ga0209437_100152 3300025233 Bacteria 154551
266 Ga0209437_100406 3300025233 Bacteria 39888
267 Ga0209258_100090 3300025242 Bacteria 232619
268 Ga0209258_100101 3300025242 Bacteria 210252
269 Ga0209258_100138 3300025242 Bacteria 167495
270 Ga0209258_100479 3300025242 Bacteria 42065
271 Ga0209258_101737 3300025242 Bacteria 6756
272 Ga0209646_1001427 3300025246 Bacteria 6440
273 Ga0209646_1002026 3300025246 Bacteria 4832
274 Ga0209646_1002739 3300025246 Bacteria 3744
275 Ga0209026_1000104 3300025250 Bacteria 152614
276 Ga0209026_1000294 3300025250 Bacteria 55402
277 Ga0209026_1000553 3300025250 Bacteria 25735
278 Ga0209148_1000001 3300025254 Bacteria 2545271
279 Ga0209148_1000002 3300025254 Bacteria 2399500
280 Ga0209148_1000065 3300025254 Bacteria 344489
281 Ga0209148_1000079 3300025254 Bacteria 288992
282 Ga0209759_1000165 3300025256 Bacteria 113117
283 Ga0209759_1001467 3300025256 Bacteria 13162
284 Ga0209759_1002925 3300025256 Bacteria 7154
285 Ga0209759_1009463 3300025256 Bacteria 2944
286 Ga0209233_1000002 3300025261 Bacteria 2501366
287 Ga0209233_1000046 3300025261 Bacteria 470971
288 Ga0209233_1000099 3300025261 Bacteria 293995
289 Ga0209233_1006812 3300025261 Bacteria 3656
290 Ga0209233_1008159 3300025261 Bacteria 3263
291 Ga0209455_1000016 3300025272 Bacteria 753097
292 Ga0209455_1000079 3300025272 Bacteria 268778
293 Ga0209455_1000189 3300025272 Bacteria 92877
294 Ga0209455_1003693 3300025272 Bacteria 5298
295 Ga0209051_1004768 3300025303 Bacteria 8193
296 Ga0207656_10002191 3300025321 Bacteria 6536
297 Ga0207656_10062171 3300025321 Bacteria 1640
298 Ga0207710_10014465 3300025900 Bacteria 3329
299 Ga0207680_10000139 3300025903 Bacteria 34616
300 Ga0207680_10074224 3300025903 Bacteria 2117
301 Ga0207680_10187221 3300025903 Bacteria 1403
302 Ga0207647_10000002 3300025904 Bacteria 400771
303 Ga0207647_10000175 3300025904 Bacteria 51622
304 Ga0207647_10000224 3300025904 Bacteria 46793
305 Ga0207647_10000525 3300025904 Bacteria 30595
306 Ga0207647_10002255 3300025904 Bacteria 14694
307 Ga0207647_10038965 3300025904 Bacteria 3001
308 Ga0207643_10012719 3300025908 Bacteria 4549
309 Ga0207705_10000198 3300025909 Bacteria 61005
310 Ga0207705_10001050 3300025909 Bacteria 22453
311 Ga0207705_10001085 3300025909 Bacteria 22127
312 Ga0207705_10001679 3300025909 Bacteria 17622
313 Ga0207705_10001682 3300025909 Bacteria 17606
314 Ga0207705_10005637 3300025909 Bacteria 9353
315 Ga0207705_10140855 3300025909 Bacteria 1801
316 Ga0207654_10003591 3300025911 Bacteria 7842
317 Ga0207707_10000020 3300025912 Bacteria 205480
318 Ga0207707_10000131 3300025912 Bacteria 77593
319 Ga0207707_10000136 3300025912 Bacteria 76610
320 Ga0207707_10000942 3300025912 Bacteria 28059
321 Ga0207707_10001255 3300025912 Bacteria 23780
322 Ga0207707_10001368 3300025912 Bacteria 22608
323 Ga0207707_10002269 3300025912 Bacteria 17392
324 Ga0207707_10003877 3300025912 Bacteria 13260
325 Ga0207707_10006101 3300025912 Bacteria 10539
326 Ga0207707_10032416 3300025912 Bacteria 4573
327 Ga0207707_10183288 3300025912 Bacteria 1827
328 Ga0207695_10000101 3300025913 Bacteria 258504
329 Ga0207695_10000418 3300025913 Bacteria 94702
330 Ga0207695_10000751 3300025913 Bacteria 62399
331 Ga0207695_10003587 3300025913 Bacteria 21711
332 Ga0207695_10003838 3300025913 Bacteria 20806
333 Ga0207695_10004386 3300025913 Bacteria 19292
334 Ga0207695_10019450 3300025913 Bacteria 7822
335 Ga0207695_10032954 3300025913 Bacteria 5661
336 Ga0207695_10057689 3300025913 Bacteria 4033
337 Ga0207695_10059440 3300025913 Bacteria 3963
338 Ga0207671_10001039 3300025914 Bacteria 33742
339 Ga0207671_10022465 3300025914 Bacteria 4770
340 Ga0207671_10063712 3300025914 Bacteria 2740
341 Ga0207660_10000594 3300025917 Bacteria 24432
342 Ga0207660_10001035 3300025917 Bacteria 18403
343 Ga0207660_10001057 3300025917 Bacteria 18244
344 Ga0207660_10001511 3300025917 Bacteria 15659
345 Ga0207660_10052034 3300025917 Bacteria 2914
346 Ga0207660_10141499 3300025917 Bacteria 1839
347 Ga0207657_10001821 3300025919 Bacteria 22995
348 Ga0207657_10004696 3300025919 Bacteria 14420
349 Ga0207657_10006034 3300025919 Bacteria 12597
350 Ga0207657_10011359 3300025919 Bacteria 8846
351 Ga0207657_10035064 3300025919 Bacteria 4504
352 Ga0207657_10098901 3300025919 Bacteria 2424
353 Ga0207657_10100370 3300025919 Bacteria 2403
354 Ga0207657_10196769 3300025919 Bacteria 1623
355 Ga0207649_10010581 3300025920 Bacteria 5073
356 Ga0207649_10015754 3300025920 Bacteria 4249
357 Ga0207649_10020685 3300025920 Bacteria 3775
358 Ga0207649_10023168 3300025920 Bacteria 3593
359 Ga0207649_10032787 3300025920 Bacteria 3099
360 Ga0207649_10218335 3300025920 Bacteria 1357
361 Ga0207652_10000037 3300025921 Bacteria 134369
362 Ga0207652_10000226 3300025921 Bacteria 59362
363 Ga0207652_10000902 3300025921 Bacteria 28060
364 Ga0207652_10001301 3300025921 Bacteria 22199
365 Ga0207652_10002104 3300025921 Bacteria 17100
366 Ga0207652_10007880 3300025921 Bacteria 8551
367 Ga0207694_10000336 3300025924 Bacteria 44443
368 Ga0207694_10002801 3300025924 Bacteria 14074
369 Ga0207694_10003401 3300025924 Bacteria 12671
370 Ga0207694_10003716 3300025924 Bacteria 12087
371 Ga0207694_10005085 3300025924 Bacteria 10166
372 Ga0207694_10043610 3300025924 Bacteria 3462
373 Ga0207694_10090234 3300025924 Bacteria 2418
374 Ga0207659_10090706 3300025926 Bacteria 2282
375 Ga0207664_10000150 3300025929 Bacteria 56559
376 Ga0207690_10001578 3300025932 Bacteria 14250
377 Ga0207690_10005495 3300025932 Bacteria 7477
378 Ga0207690_10008354 3300025932 Bacteria 6145
379 Ga0207690_10022761 3300025932 Bacteria 3902
380 Ga0207690_10023298 3300025932 Bacteria 3862
381 Ga0207690_10025875 3300025932 Bacteria 3690
382 Ga0207690_10125735 3300025932 Bacteria 1869
383 Ga0207690_10488052 3300025932 Bacteria 995
384 Ga0207706_10010415 3300025933 Bacteria 8494
385 Ga0207706_10028042 3300025933 Bacteria 5030
386 Ga0207706_10269459 3300025933 Bacteria 1486
387 Ga0207670_10030810 3300025936 Bacteria 3429
388 Ga0207704_10228326 3300025938 Bacteria 1382
389 Ga0207691_10009722 3300025940 Bacteria 9229
390 Ga0207691_10036351 3300025940 Bacteria 4563
391 Ga0207689_10016937 3300025942 Bacteria 6166
392 Ga0207661_10005158 3300025944 Bacteria 9179
393 Ga0207661_10005219 3300025944 Bacteria 9131
394 Ga0207661_10016793 3300025944 Bacteria 5404
395 Ga0207679_10081290 3300025945 Bacteria 2477
396 Ga0207667_10000077 3300025949 Bacteria 166095
397 Ga0207667_10000739 3300025949 Bacteria 42543
398 Ga0207667_10004983 3300025949 Bacteria 16228
399 Ga0207667_10006687 3300025949 Bacteria 13940
400 Ga0207667_10010885 3300025949 Bacteria 10608
401 Ga0207667_10013352 3300025949 Bacteria 9402
402 Ga0207667_10031674 3300025949 Bacteria 5706
403 Ga0207667_10048246 3300025949 Bacteria 4504
404 Ga0207667_10143865 3300025949 Bacteria 2455
405 Ga0207667_10437060 3300025949 Bacteria 1330
406 Ga0207712_10000105 3300025961 Bacteria 95153
407 Ga0207640_10000032 3300025981 Bacteria 116582
408 Ga0207640_10000479 3300025981 Bacteria 24364
409 Ga0207640_10001610 3300025981 Bacteria 12117
410 Ga0207640_10001639 3300025981 Bacteria 11992
411 Ga0207640_10002761 3300025981 Bacteria 9396
412 Ga0207640_10055275 3300025981 Bacteria 2600
413 Ga0207640_10297027 3300025981 Bacteria 1276
414 Ga0207658_10025041 3300025986 Bacteria 4176
415 Ga0207703_10004097 3300026035 Bacteria 12028
416 Ga0207703_10026189 3300026035 Bacteria 4589
417 Ga0207639_10001251 3300026041 Bacteria 17212
418 Ga0207639_10004488 3300026041 Bacteria 9416
419 Ga0207639_10004560 3300026041 Bacteria 9331
420 Ga0207639_10005917 3300026041 Bacteria 8289
421 Ga0207639_10009206 3300026041 Bacteria 6808
422 Ga0207639_10036014 3300026041 Bacteria 3664
423 Ga0207639_10041665 3300026041 Bacteria 3437
424 Ga0207639_10086821 3300026041 Bacteria 2492
425 Ga0207639_10137212 3300026041 Bacteria 2033
426 Ga0207678_10001007 3300026067 Bacteria 25669
427 Ga0207678_10001852 3300026067 Bacteria 19350
428 Ga0207678_10003314 3300026067 Bacteria 14521
429 Ga0207678_10005388 3300026067 Bacteria 11460
430 Ga0207678_10008801 3300026067 Bacteria 8882
431 Ga0207678_10068948 3300026067 Bacteria 3033
432 Ga0207678_10078439 3300026067 Bacteria 2829
433 Ga0207702_10001658 3300026078 Bacteria 21995
434 Ga0207702_10007180 3300026078 Bacteria 9533
435 Ga0207702_10077386 3300026078 Bacteria 2877
436 Ga0207702_10544218 3300026078 Bacteria 1135
437 Ga0207641_10012492 3300026088 Bacteria 6960
438 Ga0207641_10020195 3300026088 Bacteria 5469
439 Ga0207641_10070822 3300026088 Bacteria 2997
440 Ga0207641_10076479 3300026088 Bacteria 2894
441 Ga0207648_10022355 3300026089 Bacteria 5682
442 Ga0207648_10287639 3300026089 Bacteria 1471
443 Ga0207676_10291396 3300026095 Bacteria 1486
444 Ga0207674_10004053 3300026116 Bacteria 17767
445 Ga0207674_10006924 3300026116 Bacteria 13282
446 Ga0207674_10014510 3300026116 Bacteria 8700
447 Ga0207674_10040168 3300026116 Bacteria 4849
448 Ga0207674_10076033 3300026116 Bacteria 3367
449 Ga0207674_10165082 3300026116 Bacteria 2168
450 Ga0207683_10009137 3300026121 Bacteria 8448
451 Ga0207698_10001009 3300026142 Bacteria 16385
452 Ga0207698_10004040 3300026142 Bacteria 8909
453 Ga0207698_10008897 3300026142 Bacteria 6366
454 Ga0207698_10011336 3300026142 Bacteria 5773
455 Ga0207698_10017935 3300026142 Bacteria 4812
456 Ga0268266_10000008 3300028379 Bacteria 1161875
457 Ga0268266_10000011 3300028379 Bacteria 757403
458 Ga0268266_10082893 3300028379 Bacteria 2798
459 Ga0307508_10027843 3300031616 Bacteria 5114
460 Ga0316576_10035079 3300031727 Bacteria 3579
461 Ga0316578_10166865 3300031728 Bacteria 1327
462 Ga0307516_10052276 3300031730 Bacteria 3999
463 Ga0307405_10139831 3300031731 Bacteria 1686
464 Ga0307412_10003896 3300031911 Bacteria 8306
465 Ga0316593_10103114 3300032168 Bacteria 1014
466 Ga0307510_10004110 3300033180 Bacteria 17078
467 Ga0373944_0013530 3300035089 Bacteria 2265
468 Ga0373943_0203309 3300035170 Bacteria 1097
469 Ga0316574_0050891 3300035398 Bacteria 2580
470 Ga0316574_0116889 3300035398 Bacteria 1711
471 Ga0373924_0134581 3300035410 Bacteria 1076
472 Ga0373933_0010679 3300035724 Bacteria 5036
473 Ga0373937_0016801 3300036401 Bacteria 6505
474 Ga0316584_0047429 3300036712 Bacteria 3209
475 Ga0395899_0023623 3300037312 Bacteria 4654
476 Ga0395899_0036443 3300037312 Bacteria 3689
477 Ga0395899_0053699 3300037312 Bacteria 2982
478 Ga0395900_0003805 3300037418 Bacteria 16142
479 Ga0395900_0004421 3300037418 Bacteria 14904
480 Ga0395900_0124201 3300037418 Bacteria 2647
481 Ga0395900_0140270 3300037418 Bacteria 2475
482 Ga0395900_0504475 3300037418 Bacteria 1160
483 Ga0395898_0000013 3300037466 Bacteria 458788
484 Ga0395898_0006262 3300037466 Bacteria 12730
485 Ga0395901_0022120 3300038443 Bacteria 6514
486 Ga0395901_0050913 3300038443 Bacteria 4303
487 Ga0395901_0098919 3300038443 Bacteria 3058
488 Ga0395901_0160042 3300038443 Bacteria 2365
489 Ga0395901_0209158 3300038443 Bacteria 2043
490 Ga0400483_022784 3300039062 Bacteria 6265
491 Ga0400483_062577 3300039062 Bacteria 66463
492 Ga0400483_150507 3300039062 Bacteria 2303
493 Ga0400483_276618 3300039062 Bacteria 37892
494 Ga0400489_37299 3300039093 Bacteria 63307
495 Ga0439436_0000004 3300041404 Bacteria 175137
496 Ga0439465_0001501 3300041413 Bacteria 7564
497 Ga0439432_020495 3300042006 Bacteria 2197
498 Ga0466969_0037206 3300044656 Bacteria 2456
499 Ga0466966_0011070 3300044684 Bacteria 5987
500 Ga0466966_0017959 3300044684 Bacteria 4670
501 Ga0466961_0004762 3300044693 Bacteria 8540
502 Ga0466964_0005140 3300044706 Bacteria 4847
503 Ga0466971_0001794 3300044719 Bacteria 9109
504 Ga0466968_0000061 3300044735 Bacteria 31791
505 Ga0466970_0000496 3300044765 Bacteria 19359
506 Ga0466970_0003435 3300044765 Bacteria 7711
507 Ga0466960_0045412 3300044901 Bacteria 2098
508 Ga0466959_0021971 3300045049 Bacteria 4712
509 Ga0466959_0059609 3300045049 Bacteria 2779
510 Ga0466958_0012695 3300045836 Bacteria 4777
511 Ga0495617_000085 3300046452 Bacteria 67837
512 Ga0495617_001170 3300046452 Bacteria 11853
513 Ga0495629_0038732 3300046459 Bacteria 3357
514 Ga0495638_0000236 3300046460 Bacteria 75732
515 Ga0495638_0000754 3300046460 Bacteria 34482
516 Ga0495638_0001087 3300046460 Bacteria 26471
517 Ga0495650_0000191 3300046471 Bacteria 132016
518 Ga0495650_0012428 3300046471 Bacteria 4582
519 Ga0495584_0000457 3300046491 Bacteria 28087
520 Ga0495585_0003589 3300046492 Bacteria 10405
521 Ga0495607_0000131 3300046501 Bacteria 80259
522 Ga0495583_0012629 3300046506 Bacteria 4764
523 Ga0495606_0000016 3300046507 Bacteria 284865
524 Ga0495606_0001253 3300046507 Bacteria 35422
525 Ga0495606_0001443 3300046507 Bacteria 31874
526 Ga0495610_0003274 3300046512 Bacteria 12764
527 Ga0495616_0000401 3300046513 Bacteria 33353
528 Ga0495616_0002110 3300046513 Bacteria 13330
529 Ga0495620_0000365 3300046515 Bacteria 31131
530 Ga0495632_0000531 3300046519 Bacteria 36042
531 Ga0495632_0004712 3300046519 Bacteria 9206
532 Ga0495632_0018148 3300046519 Bacteria 3867
533 Ga0495632_0108904 3300046519 Bacteria 1301
534 Ga0495637_0005557 3300046520 Bacteria 6401
535 Ga0495609_0009588 3300046538 Bacteria 4681
536 Ga0495645_0142533 3300046543 Bacteria 1671
537 Ga0495668_0001761 3300046616 Bacteria 19820
538 Ga0495611_0000002 3300046648 Bacteria 705677
539 Ga0495625_0000002 3300046660 Bacteria 813323
540 Ga0495625_0044528 3300046660 Bacteria 3213
541 Ga0495658_0006050 3300046683 Bacteria 5944
542 Ga0495670_0000227 3300046691 Bacteria 25531
543 Ga0495670_0000599 3300046691 Bacteria 17194
544 Ga0495670_0018576 3300046691 Bacteria 3423
545 Ga0495671_0001204 3300046692 Bacteria 17706
546 Ga0495649_0000450 3300046694 Bacteria 35527
547 Ga0495649_0002369 3300046694 Bacteria 13331
548 Ga0495589_0000190 3300046794 Bacteria 54374
549 Ga0495660_0000437 3300046810 Bacteria 34919
550 Ga0495660_0000447 3300046810 Bacteria 34412
551 Ga0495683_0001059 3300047323 Bacteria 19067
552 Ga0495679_000003 3300047446 Bacteria 787868
553 Ga0495673_0000004 3300047469 Bacteria 1354526
554 Ga0495673_0002144 3300047469 Bacteria 14333
555 Ga0495686_0000426 3300047472 Bacteria 66285
556 Ga0495686_0001228 3300047472 Bacteria 29296
557 Ga0496102_0068661 3300048905 Bacteria 3253
558 Ga0496104_0022187 3300048907 Bacteria 5832
559 Ga0496105_0002152 3300048908 Bacteria 14259
560 Ga0496106_0000168 3300048909 Bacteria 47597
561 Ga0496106_0364809 3300048909 Bacteria 1160
562 Ga0496113_0393183 3300048916 Bacteria 1113
563 Ga0496115_0000095 3300048918 Bacteria 82835
564 Ga0496115_0000729 3300048918 Bacteria 24348
565 Ga0496115_0024156 3300048918 Bacteria 4722
566 Ga0496115_0174095 3300048918 Bacteria 1779
567 Ga0496118_0003990 3300048921 Bacteria 17983
568 Ga0496119_0000966 3300048922 Bacteria 36886
569 Ga0496119_0039081 3300048922 Bacteria 3054
570 Ga0496120_0000409 3300048923 Bacteria 68984
571 Ga0496120_0001143 3300048923 Bacteria 34091
572 Ga0496121_0006433 3300048924 Bacteria 14585
573 Ga0496121_0008592 3300048924 Bacteria 11958
574 Ga0496121_0054584 3300048924 Bacteria 3336
575 Ga0496121_0129877 3300048924 Bacteria 1888
576 Ga0496123_0019361 3300048926 Bacteria 5368
577 Ga0496125_0023406 3300048928 Bacteria 5702
578 Ga0496125_0033120 3300048928 Bacteria 4579
579 Ga0496126_0022583 3300048929 Bacteria 6117
580 Ga0496126_0088204 3300048929 Bacteria 2733
581 Ga0496126_0088245 3300048929 Bacteria 2732
582 Ga0496126_0111159 3300048929 Bacteria 2386
583 Ga0496126_0121945 3300048929 Bacteria 2260
584 Ga0496126_0251981 3300048929 Bacteria 1471
585 Ga0495678_000019 3300049459 Bacteria 269723
586 Ga0495678_041224 3300049459 Bacteria 1849
587 Ga0495682_0007017 3300049460 Bacteria 4514
588 Ga0495682_0009237 3300049460 Bacteria 3856
589 Ga0501031_0030712 3300049568 Bacteria 3505
590 Ga0501031_0102052 3300049568 Bacteria 1872
591 Ga0501032_0023180 3300049569 Bacteria 4295
592 Ga0501032_0059078 3300049569 Bacteria 2574
593 Ga0501033_0013311 3300049570 Bacteria 6268
594 Ga0501033_0051516 3300049570 Bacteria 3051
595 Ga0501033_0067769 3300049570 Bacteria 2625
596 Ga0501033_0148602 3300049570 Bacteria 1691
597 Ga0501034_0000192 3300049571 Bacteria 115486
598 Ga0501034_0133380 3300049571 Bacteria 2466
599 Ga0501034_0179948 3300049571 Bacteria 2079
600 Ga0501036_0014906 3300049572 Bacteria 6485
601 Ga0501036_0050469 3300049572 Bacteria 3523
602 Ga0501036_0311277 3300049572 Bacteria 1316
603 Ga0501037_0033294 3300049573 Bacteria 3807
604 Ga0501037_0059645 3300049573 Bacteria 2783
605 Ga0501037_0212898 3300049573 Bacteria 1362
606 Ga0501038_0100136 3300049574 Bacteria 2415
607 Ga0501038_0156167 3300049574 Bacteria 1857
608 Ga0501043_0021893 3300049579 Bacteria 5013
609 Ga0501043_0028026 3300049579 Bacteria 4420
610 Ga0501043_0076697 3300049579 Bacteria 2626
611 Ga0501043_0090005 3300049579 Bacteria 2412
612 Ga0501043_0102993 3300049579 Bacteria 2243
613 Ga0501046_0017220 3300049580 Bacteria 6038
614 Ga0501046_0022689 3300049580 Bacteria 5169
615 Ga0501046_0117653 3300049580 Bacteria 2024
616 Ga0501046_0207844 3300049580 Bacteria 1454
617 Ga0501046_0286264 3300049580 Bacteria 1206
618 Ga0501047_0001922 3300049581 Bacteria 19965
619 Ga0501047_0006510 3300049581 Bacteria 10994
620 Ga0501047_0022027 3300049581 Bacteria 6120
621 Ga0501047_0024890 3300049581 Bacteria 5748
622 Ga0501047_0033102 3300049581 Bacteria 4990
623 Ga0501047_0166643 3300049581 Bacteria 2073
624 Ga0501047_0408958 3300049581 Bacteria 1189
625 Ga0501048_0019797 3300049582 Bacteria 4935
626 Ga0501048_0149062 3300049582 Bacteria 1654
627 Ga0501069_0009946 3300049585 Bacteria 5029
628 Ga0501069_0016129 3300049585 Bacteria 4008
629 Ga0501070_0000146 3300049586 Bacteria 65391
630 Ga0501070_0002845 3300049586 Bacteria 15102
631 Ga0501070_0014993 3300049586 Bacteria 6521
632 Ga0501070_0015050 3300049586 Bacteria 6510
633 Ga0501070_0021836 3300049586 Bacteria 5363
634 Ga0501070_0032970 3300049586 Bacteria 4332
635 Ga0501070_0162074 3300049586 Bacteria 1843
636 Ga0501070_0232154 3300049586 Bacteria 1511
637 Ga0501071_0009504 3300049587 Bacteria 6480
638 Ga0501073_0003754 3300049589 Bacteria 11416
639 Ga0501073_0017456 3300049589 Bacteria 5198
640 Ga0501074_0000885 3300049590 Bacteria 19134
641 Ga0501074_0003630 3300049590 Bacteria 10956
642 Ga0501074_0025187 3300049590 Bacteria 4322
643 Ga0501074_0038209 3300049590 Bacteria 3479
644 Ga0501076_0389984 3300049592 Bacteria 1145
645 Ga0501077_0081389 3300049593 Bacteria 2051
646 Ga0501079_0106154 3300049741 Bacteria 2179
647 Ga0501079_0202514 3300049741 Bacteria 1550
648 Ga0501080_0003851 3300049742 Bacteria 13256
649 Ga0501080_0008369 3300049742 Bacteria 9368
650 Ga0501080_0027011 3300049742 Bacteria 5337
651 Ga0501080_0067297 3300049742 Bacteria 3331
652 Ga0501080_0170188 3300049742 Bacteria 2009
653 Ga0501083_0116240 3300049744 Bacteria 1756
654 Ga0501035_0003194 3300049822 Bacteria 15714
655 Ga0501035_0006993 3300049822 Bacteria 10538
656 Ga0501035_0007555 3300049822 Bacteria 10156
657 Ga0501035_0011460 3300049822 Bacteria 8221
658 Ga0501035_0020740 3300049822 Bacteria 6039
659 Ga0501035_0022696 3300049822 Bacteria 5764
660 Ga0501035_0039145 3300049822 Bacteria 4291
661 Ga0501035_0177315 3300049822 Bacteria 1838
662 Ga0501035_0238564 3300049822 Bacteria 1547
663 Ga0501035_0427597 3300049822 Bacteria 1099
664 Ga0501044_0027845 3300049823 Bacteria 5966
665 Ga0501044_0053889 3300049823 Bacteria 4136
666 Ga0501044_0076810 3300049823 Bacteria 3388
667 Ga0501044_0136080 3300049823 Bacteria 2448
668 Ga0501044_0165656 3300049823 Bacteria 2184
669 Ga0501044_0266144 3300049823 Bacteria 1651
670 Ga0500643_000101 3300053087 Bacteria 88318
671 Ga0500646_0003484 3300053090 Bacteria 4032
672 Ga0500566_0126233 3300053094 Bacteria 1374
673 Ga0500555_001045 3300053103 Bacteria 9341
674 Ga0500614_013421 3300053123 Bacteria 1800
675 Ga0500652_106012 3300053131 Bacteria 1175
676 Ga0500568_0000645 3300053139 Bacteria 25189
677 Ga0500620_029835 3300053155 Bacteria 1716
678 Ga0501084_0279466 3300054114 Bacteria 1410
679 Ga0501082_0000402 3300060353 Bacteria 38316
680 Ga0501082_0019471 3300060353 Bacteria 5851
681 Ga0466962_0004934 3300061719 Bacteria 6416
682 Ga0466962_0005447 3300061719 Bacteria 6116

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0212898 Ga0501037_0212898_538_1317 248
2 3300049580 Ga0501046_0207844 Ga0501046_0207844_587_1423 267
3 3300048929 Ga0496126_0022583 Ga0496126_0022583_3811_4650 279
4 3300035170 Ga0373943_0203309 Ga0373943_0203309_216_1076 283
5 3300039062 Ga0400483_062577 Ga0400483_062577_18297_19199 283
6 3300039062 Ga0400483_276618 Ga0400483_276618_2178_3080 283
7 3300010375 Ga0105239_10011256 Ga0105239_100112569 284
8 3300049574 Ga0501038_0100136 Ga0501038_0100136_1327_2265 284
9 3300025924 Ga0207694_10000336 Ga0207694_1000033630 285
10 3300028379 Ga0268266_10000011 Ga0268266_10000011154 285
11 3300005344 Ga0070661_100096555 Ga0070661_1000965552 286
12 3300005539 Ga0068853_100063960 Ga0068853_1000639604 286
13 3300015261 Ga0182006_1000133 Ga0182006_100013325 286
14 3300015265 Ga0182005_1002454 Ga0182005_10024543 286
15 3300025920 Ga0207649_10218335 Ga0207649_102183352 286
16 3300031731 Ga0307405_10139831 Ga0307405_101398312 286
17 3300031911 Ga0307412_10003896 Ga0307412_100038963 286
18 3300041404 Ga0439436_0000004 Ga0439436_0000004_19505_20449 286
19 3300041413 Ga0439465_0001501 Ga0439465_0001501_4194_5138 286
20 3300046512 Ga0495610_0003274 Ga0495610_0003274_11186_12130 286
21 3300046691 Ga0495670_0000599 Ga0495670_0000599_4867_5811 286
22 3300046694 Ga0495649_0002369 Ga0495649_0002369_4011_4955 286
23 3300039062 Ga0400483_022784 Ga0400483_022784_4531_5502 287
24 3300046660 Ga0495625_0000002 Ga0495625_0000002_480523_481452 287
25 3300046810 Ga0495660_0000447 Ga0495660_0000447_10326_11255 287
26 3300046507 Ga0495606_0001443 Ga0495606_0001443_20335_21264 289
27 3300048924 Ga0496121_0054584 Ga0496121_0054584_99_1028 289
28 3300005339 Ga0070660_100163024 Ga0070660_1001630242 290
29 3300005458 Ga0070681_10039513 Ga0070681_100395133 290
30 3300005530 Ga0070679_100049404 Ga0070679_1000494042 290
31 3300005546 Ga0070696_100154920 Ga0070696_1001549202 290
32 3300005547 Ga0070693_100101715 Ga0070693_1001017152 290
33 3300005577 Ga0068857_100068091 Ga0068857_1000680913 290
34 3300013100 Ga0157373_10040386 Ga0157373_100403863 290
35 3300025912 Ga0207707_10032416 Ga0207707_100324163 290
36 3300025919 Ga0207657_10100370 Ga0207657_101003702 290
37 3300025932 Ga0207690_10005495 Ga0207690_100054955 290
38 3300026116 Ga0207674_10076033 Ga0207674_100760332 290
39 iso_pu_bacteria 2537561836 2538834375 290
40 3300009101 Ga0105247_10000804 Ga0105247_100008048 291
41 3300015261 Ga0182006_1000041 Ga0182006_100004128 291
42 3300015262 Ga0182007_10003846 Ga0182007_100038462 291
43 3300017792 Ga0163161_10012913 Ga0163161_100129133 291
44 3300025900 Ga0207710_10014465 Ga0207710_100144652 291
45 3300046616 Ga0495668_0001761 Ga0495668_0001761_13228_14166 291
46 3300046810 Ga0495660_0000437 Ga0495660_0000437_23582_24520 291
47 3300047469 Ga0495673_0000004 Ga0495673_0000004_1264972_1265910 291
48 3300048924 Ga0496121_0006433 Ga0496121_0006433_3255_4193 291
49 3300039062 Ga0400483_150507 Ga0400483_150507_120_1091 292
50 3300025936 Ga0207670_10030810 Ga0207670_100308102 293
51 3300049571 Ga0501034_0000192 Ga0501034_0000192_19095_20015 296
52 3300005335 Ga0070666_10052751 Ga0070666_100527513 297
53 3300005435 Ga0070714_100000136 Ga0070714_10000013614 297
54 3300009174 Ga0105241_10212677 Ga0105241_102126772 297
55 3300009553 Ga0105249_10011804 Ga0105249_100118044 297
56 3300025903 Ga0207680_10187221 Ga0207680_101872212 297
57 3300025929 Ga0207664_10000150 Ga0207664_1000015035 297
58 3300025961 Ga0207712_10000105 Ga0207712_100001059 297
59 3300037312 Ga0395899_0036443 Ga0395899_0036443_1982_2911 297
60 3300037418 Ga0395900_0004421 Ga0395900_0004421_1806_2735 297
61 3300037466 Ga0395898_0006262 Ga0395898_0006262_877_1806 297
62 3300038443 Ga0395901_0050913 Ga0395901_0050913_1393_2322 297
63 3300049572 Ga0501036_0050469 Ga0501036_0050469_374_1306 297
64 3300049579 Ga0501043_0102993 Ga0501043_0102993_1129_2061 297
65 3300049581 Ga0501047_0001922 Ga0501047_0001922_13717_14649 297
66 3300049741 Ga0501079_0202514 Ga0501079_0202514_339_1271 297
67 3300005366 Ga0070659_100028080 Ga0070659_1000280805 298
68 3300005530 Ga0070679_100160069 Ga0070679_1001600692 298
69 3300005539 Ga0068853_100073444 Ga0068853_1000734442 298
70 3300013307 Ga0157372_10029270 Ga0157372_100292702 298
71 3300025932 Ga0207690_10488052 Ga0207690_104880521 298
72 3300026041 Ga0207639_10137212 Ga0207639_101372122 298
73 3300037312 Ga0395899_0053699 Ga0395899_0053699_1274_2203 298
74 3300025933 Ga0207706_10269459 Ga0207706_102694592 299
75 3300048929 Ga0496126_0251981 Ga0496126_0251981_237_1166 299
76 iso_pu_bacteria 2739367700 2739733249 301
77 iso_pu_bacteria 2884411467 2884415657 301
78 iso_pu_bacteria 2928963466 2928966982 301
79 3300014325 Ga0163163_10056882 Ga0163163_100568822 303
80 3300025986 Ga0207658_10025041 Ga0207658_100250413 304
81 3300031727 Ga0316576_10035079 Ga0316576_100350792 304
82 3300035398 Ga0316574_0050891 Ga0316574_0050891_529_1452 304
83 3300036712 Ga0316584_0047429 Ga0316584_0047429_691_1614 304
84 3300046471 Ga0495650_0012428 Ga0495650_0012428_595_1518 304
85 3300046491 Ga0495584_0000457 Ga0495584_0000457_12040_12963 304
86 3300046492 Ga0495585_0003589 Ga0495585_0003589_9038_9961 304
87 3300046507 Ga0495606_0001253 Ga0495606_0001253_23305_24228 304
88 3300046513 Ga0495616_0000401 Ga0495616_0000401_22112_23035 304
89 3300046519 Ga0495632_0004712 Ga0495632_0004712_7627_8550 304
90 3300046691 Ga0495670_0000227 Ga0495670_0000227_3395_4318 304
91 3300047323 Ga0495683_0001059 Ga0495683_0001059_1790_2713 304
92 3300048924 Ga0496121_0008592 Ga0496121_0008592_10294_11217 304
93 3300003762 Ga0055542_1000245 Ga0055542_100024548 305
94 3300005466 Ga0070685_10013112 Ga0070685_100131124 305
95 3300009174 Ga0105241_10036533 Ga0105241_100365333 305
96 3300009551 Ga0105238_10033003 Ga0105238_100330032 305
97 3300009551 Ga0105238_10042081 Ga0105238_100420813 305
98 3300009551 Ga0105238_10492747 Ga0105238_104927471 305
99 3300013104 Ga0157370_10007218 Ga0157370_1000721810 305
100 3300014969 Ga0157376_10045836 Ga0157376_100458363 305
101 3300015265 Ga0182005_1000257 Ga0182005_100025710 305
102 3300025225 Ga0209566_100922 Ga0209566_1009227 305
103 3300025228 Ga0209672_111421 Ga0209672_1114211 305
104 3300025233 Ga0209437_100406 Ga0209437_10040621 305
105 3300025242 Ga0209258_100479 Ga0209258_10047915 305
106 3300025242 Ga0209258_101737 Ga0209258_1017373 305
107 3300025254 Ga0209148_1000002 Ga0209148_1000002221 305
108 3300025256 Ga0209759_1009463 Ga0209759_10094633 305
109 3300025261 Ga0209233_1008159 Ga0209233_10081592 305
110 3300025911 Ga0207654_10003591 Ga0207654_100035913 305
111 3300031728 Ga0316578_10166865 Ga0316578_101668651 305
112 3300032168 Ga0316593_10103114 Ga0316593_101031141 305
113 3300035398 Ga0316574_0116889 Ga0316574_0116889_25_954 305
114 3300046460 Ga0495638_0001087 Ga0495638_0001087_4017_4937 305
115 3300046507 Ga0495606_0000016 Ga0495606_0000016_60873_61793 305
116 3300046660 Ga0495625_0044528 Ga0495625_0044528_1814_2734 305
117 3300046694 Ga0495649_0000450 Ga0495649_0000450_28424_29344 305
118 3300048909 Ga0496106_0364809 Ga0496106_0364809_39_959 305
119 3300048918 Ga0496115_0000729 Ga0496115_0000729_15332_16252 305
120 3300048918 Ga0496115_0024156 Ga0496115_0024156_3240_4160 305
121 3300048918 Ga0496115_0174095 Ga0496115_0174095_63_983 305
122 3300048929 Ga0496126_0111159 Ga0496126_0111159_1170_2090 305
123 3300049459 Ga0495678_041224 Ga0495678_041224_20_940 305
124 3300049460 Ga0495682_0007017 Ga0495682_0007017_3311_4231 305
125 iso_pu_bacteria 2718218334 2721025481 305
126 iso_pu_bacteria 2738543009 2739225997 305
127 3300001979 JGI24740J21852_10000279 JGI24740J21852_1000027918 306
128 3300002705 JGI25156J39149_1002783 JGI25156J39149_10027833 306
129 3300002737 JGI25162J39368_1003044 JGI25162J39368_10030443 306
130 3300002738 JGI25154J39366_1004509 JGI25154J39366_10045092 306
131 3300002741 JGI25157J39369_1000344 JGI25157J39369_100034426 306
132 3300002772 JGI25164J39214_1000117 JGI25164J39214_100011735 306
133 3300003214 JGI25165J46597_1000235 JGI25165J46597_100023534 306
134 3300003760 Ga0055527_1003026 Ga0055527_10030262 306
135 3300003761 Ga0055535_1001080 Ga0055535_100108014 306
136 3300003762 Ga0055542_1001179 Ga0055542_100117914 306
137 3300003763 Ga0055529_1000314 Ga0055529_100031414 306
138 3300003763 Ga0055529_1002135 Ga0055529_10021354 306
139 3300005329 Ga0070683_100015187 Ga0070683_1000151875 306
140 3300005329 Ga0070683_100015955 Ga0070683_1000159554 306
141 3300005336 Ga0070680_100100120 Ga0070680_1001001204 306
142 3300005337 Ga0070682_100045315 Ga0070682_1000453154 306
143 3300005339 Ga0070660_100049491 Ga0070660_1000494912 306
144 3300005344 Ga0070661_100003952 Ga0070661_1000039528 306
145 3300005344 Ga0070661_100034435 Ga0070661_1000344352 306
146 3300005345 Ga0070692_10000420 Ga0070692_1000042010 306
147 3300005535 Ga0070684_100008594 Ga0070684_1000085946 306
148 3300005535 Ga0070684_100010992 Ga0070684_1000109925 306
149 3300005539 Ga0068853_100059863 Ga0068853_1000598632 306
150 3300005546 Ga0070696_100034217 Ga0070696_1000342172 306
151 3300005547 Ga0070693_100019703 Ga0070693_1000197032 306
152 3300005563 Ga0068855_100108668 Ga0068855_1001086683 306
153 3300005563 Ga0068855_100123760 Ga0068855_1001237602 306
154 3300005564 Ga0070664_100146377 Ga0070664_1001463772 306
155 3300005614 Ga0068856_100003430 Ga0068856_1000034307 306
156 3300005616 Ga0068852_100002438 Ga0068852_1000024383 306
157 3300005616 Ga0068852_100046785 Ga0068852_1000467854 306
158 3300009174 Ga0105241_10535294 Ga0105241_105352941 306
159 3300009545 Ga0105237_10000108 Ga0105237_100001087 306
160 3300009545 Ga0105237_10060807 Ga0105237_100608071 306
161 3300009545 Ga0105237_10224269 Ga0105237_102242693 306
162 3300009551 Ga0105238_10063300 Ga0105238_100633002 306
163 3300010375 Ga0105239_10000830 Ga0105239_1000083031 306
164 3300010375 Ga0105239_10082349 Ga0105239_100823494 306
165 3300013100 Ga0157373_10005601 Ga0157373_100056015 306
166 3300013102 Ga0157371_10005965 Ga0157371_100059656 306
167 3300013102 Ga0157371_10033226 Ga0157371_100332263 306
168 3300013104 Ga0157370_10167396 Ga0157370_101673961 306
169 3300013105 Ga0157369_10022892 Ga0157369_100228923 306
170 3300013307 Ga0157372_10009427 Ga0157372_100094276 306
171 3300013307 Ga0157372_10059694 Ga0157372_100596943 306
172 3300020070 Ga0206356_10033220 Ga0206356_100332202 306
173 3300020081 Ga0206354_10818447 Ga0206354_108184472 306
174 3300020082 Ga0206353_10485823 Ga0206353_104858233 306
175 3300020082 Ga0206353_10579021 Ga0206353_105790213 306
176 3300025228 Ga0209672_100089 Ga0209672_10008924 306
177 3300025231 Ga0207427_100051 Ga0207427_10005187 306
178 3300025233 Ga0209437_100152 Ga0209437_10015234 306
179 3300025242 Ga0209258_100101 Ga0209258_10010139 306
180 3300025246 Ga0209646_1002026 Ga0209646_10020262 306
181 3300025246 Ga0209646_1002739 Ga0209646_10027392 306
182 3300025250 Ga0209026_1000294 Ga0209026_100029440 306
183 3300025250 Ga0209026_1000553 Ga0209026_10005539 306
184 3300025254 Ga0209148_1000079 Ga0209148_1000079147 306
185 3300025256 Ga0209759_1000165 Ga0209759_10001653 306
186 3300025256 Ga0209759_1002925 Ga0209759_10029253 306
187 3300025261 Ga0209233_1000099 Ga0209233_1000099151 306
188 3300025272 Ga0209455_1000016 Ga0209455_1000016148 306
189 3300025272 Ga0209455_1000189 Ga0209455_100018955 306
190 3300025904 Ga0207647_10000525 Ga0207647_1000052520 306
191 3300025904 Ga0207647_10038965 Ga0207647_100389654 306
192 3300025909 Ga0207705_10001050 Ga0207705_1000105018 306
193 3300025909 Ga0207705_10005637 Ga0207705_100056373 306
194 3300025912 Ga0207707_10000136 Ga0207707_1000013650 306
195 3300025912 Ga0207707_10001368 Ga0207707_1000136810 306
196 3300025912 Ga0207707_10006101 Ga0207707_100061016 306
197 3300025913 Ga0207695_10000101 Ga0207695_100001012 306
198 3300025913 Ga0207695_10000751 Ga0207695_100007517 306
199 3300025913 Ga0207695_10003838 Ga0207695_1000383815 306
200 3300025913 Ga0207695_10004386 Ga0207695_1000438617 306
201 3300025914 Ga0207671_10001039 Ga0207671_100010397 306
202 3300025917 Ga0207660_10052034 Ga0207660_100520343 306
203 3300025919 Ga0207657_10004696 Ga0207657_100046964 306
204 3300025919 Ga0207657_10006034 Ga0207657_100060343 306
205 3300025920 Ga0207649_10010581 Ga0207649_100105815 306
206 3300025920 Ga0207649_10023168 Ga0207649_100231682 306
207 3300025921 Ga0207652_10001301 Ga0207652_100013019 306
208 3300025921 Ga0207652_10007880 Ga0207652_100078804 306
209 3300025924 Ga0207694_10090234 Ga0207694_100902342 306
210 3300025944 Ga0207661_10005158 Ga0207661_100051583 306
211 3300025944 Ga0207661_10005219 Ga0207661_100052196 306
212 3300025949 Ga0207667_10010885 Ga0207667_100108859 306
213 3300025949 Ga0207667_10013352 Ga0207667_100133523 306
214 3300025949 Ga0207667_10048246 Ga0207667_100482463 306
215 3300025981 Ga0207640_10000479 Ga0207640_1000047912 306
216 3300025981 Ga0207640_10001610 Ga0207640_1000161010 306
217 3300026041 Ga0207639_10005917 Ga0207639_100059173 306
218 3300026041 Ga0207639_10036014 Ga0207639_100360144 306
219 3300026067 Ga0207678_10001852 Ga0207678_100018527 306
220 3300026067 Ga0207678_10003314 Ga0207678_100033144 306
221 3300026067 Ga0207678_10005388 Ga0207678_100053883 306
222 3300026078 Ga0207702_10001658 Ga0207702_100016585 306
223 3300026116 Ga0207674_10006924 Ga0207674_1000692411 306
224 3300026116 Ga0207674_10014510 Ga0207674_100145104 306
225 3300026116 Ga0207674_10165082 Ga0207674_101650822 306
226 3300026142 Ga0207698_10004040 Ga0207698_100040406 306
227 3300037312 Ga0395899_0023623 Ga0395899_0023623_2825_3751 306
228 3300037466 Ga0395898_0000013 Ga0395898_0000013_11716_12642 306
229 3300038443 Ga0395901_0160042 Ga0395901_0160042_1338_2264 306
230 3300038443 Ga0395901_0209158 Ga0395901_0209158_55_984 306
231 3300042006 Ga0439432_020495 Ga0439432_020495_332_1255 306
232 3300044684 Ga0466966_0017959 Ga0466966_0017959_2779_3711 306
233 3300044693 Ga0466961_0004762 Ga0466961_0004762_4401_5327 306
234 3300045049 Ga0466959_0059609 Ga0466959_0059609_1561_2493 306
235 3300045836 Ga0466958_0012695 Ga0466958_0012695_1843_2775 306
236 3300046452 Ga0495617_000085 Ga0495617_000085_43640_44569 306
237 3300046452 Ga0495617_001170 Ga0495617_001170_10290_11219 306
238 3300046460 Ga0495638_0000754 Ga0495638_0000754_10326_11255 306
239 3300046501 Ga0495607_0000131 Ga0495607_0000131_69009_69938 306
240 3300046506 Ga0495583_0012629 Ga0495583_0012629_2519_3448 306
241 3300046513 Ga0495616_0002110 Ga0495616_0002110_10358_11287 306
242 3300046515 Ga0495620_0000365 Ga0495620_0000365_10298_11227 306
243 3300046520 Ga0495637_0005557 Ga0495637_0005557_3543_4472 306
244 3300046538 Ga0495609_0009588 Ga0495609_0009588_3062_3991 306
245 3300046648 Ga0495611_0000002 Ga0495611_0000002_476038_476967 306
246 3300046691 Ga0495670_0018576 Ga0495670_0018576_1867_2796 306
247 3300046692 Ga0495671_0001204 Ga0495671_0001204_9685_10614 306
248 3300046794 Ga0495589_0000190 Ga0495589_0000190_16661_17590 306
249 3300047446 Ga0495679_000003 Ga0495679_000003_318951_319880 306
250 3300047469 Ga0495673_0002144 Ga0495673_0002144_10325_11254 306
251 3300048905 Ga0496102_0068661 Ga0496102_0068661_1870_2796 306
252 3300048907 Ga0496104_0022187 Ga0496104_0022187_4565_5491 306
253 3300048908 Ga0496105_0002152 Ga0496105_0002152_3054_3980 306
254 3300048916 Ga0496113_0393183 Ga0496113_0393183_14_937 306
255 3300048921 Ga0496118_0003990 Ga0496118_0003990_16373_17299 306
256 3300048922 Ga0496119_0000966 Ga0496119_0000966_10356_11282 306
257 3300048922 Ga0496119_0039081 Ga0496119_0039081_663_1589 306
258 3300048923 Ga0496120_0000409 Ga0496120_0000409_57732_58658 306
259 3300048923 Ga0496120_0001143 Ga0496120_0001143_20804_21730 306
260 3300048924 Ga0496121_0129877 Ga0496121_0129877_850_1776 306
261 3300049459 Ga0495678_000019 Ga0495678_000019_36783_37712 306
262 3300049460 Ga0495682_0009237 Ga0495682_0009237_2060_2989 306
263 3300049568 Ga0501031_0030712 Ga0501031_0030712_658_1587 306
264 3300049569 Ga0501032_0023180 Ga0501032_0023180_2975_3904 306
265 3300049570 Ga0501033_0148602 Ga0501033_0148602_469_1398 306
266 3300049571 Ga0501034_0133380 Ga0501034_0133380_1022_1951 306
267 3300049571 Ga0501034_0179948 Ga0501034_0179948_908_1837 306
268 3300049572 Ga0501036_0014906 Ga0501036_0014906_4175_5104 306
269 3300049579 Ga0501043_0021893 Ga0501043_0021893_2238_3167 306
270 3300049580 Ga0501046_0117653 Ga0501046_0117653_950_1879 306
271 3300049581 Ga0501047_0033102 Ga0501047_0033102_655_1584 306
272 3300049822 Ga0501035_0007555 Ga0501035_0007555_3845_4777 306
273 3300049823 Ga0501044_0266144 Ga0501044_0266144_229_1161 306
274 3300053087 Ga0500643_000101 Ga0500643_000101_28845_29774 306
275 3300053103 Ga0500555_001045 Ga0500555_001045_552_1481 306
276 3300053131 Ga0500652_106012 Ga0500652_106012_187_1116 306
277 3300061719 Ga0466962_0005447 Ga0466962_0005447_524_1456 306
278 iso_pu_bacteria 2734482264 2735834545 306
279 3300002705 JGI25156J39149_1009367 JGI25156J39149_10093671 307
280 3300002737 JGI25162J39368_1001445 JGI25162J39368_10014457 307
281 3300002741 JGI25157J39369_1001046 JGI25157J39369_10010467 307
282 3300002771 JGI25163J39215_1000588 JGI25163J39215_10005885 307
283 3300002772 JGI25164J39214_1000714 JGI25164J39214_10007147 307
284 3300003214 JGI25165J46597_1001443 JGI25165J46597_10014437 307
285 3300003756 Ga0055533_1001538 Ga0055533_10015384 307
286 3300003761 Ga0055535_1000941 Ga0055535_10009415 307
287 3300003761 Ga0055535_1001379 Ga0055535_10013797 307
288 3300003762 Ga0055542_1001180 Ga0055542_100118013 307
289 3300003762 Ga0055542_1001349 Ga0055542_10013497 307
290 3300003763 Ga0055529_1001072 Ga0055529_10010727 307
291 3300005327 Ga0070658_10002163 Ga0070658_100021639 307
292 3300005331 Ga0070670_100227448 Ga0070670_1002274482 307
293 3300005335 Ga0070666_10000001 Ga0070666_10000001132 307
294 3300005367 Ga0070667_100013367 Ga0070667_1000133673 307
295 3300005539 Ga0068853_100214666 Ga0068853_1002146662 307
296 3300005616 Ga0068852_100077654 Ga0068852_1000776543 307
297 3300005617 Ga0068859_100185524 Ga0068859_1001855242 307
298 3300005618 Ga0068864_100001937 Ga0068864_1000019376 307
299 3300005842 Ga0068858_100072506 Ga0068858_1000725063 307
300 3300005843 Ga0068860_100000822 Ga0068860_10000082224 307
301 3300005843 Ga0068860_100012637 Ga0068860_1000126373 307
302 3300006931 Ga0097620_100185528 Ga0097620_1001855282 307
303 3300009177 Ga0105248_10190603 Ga0105248_101906032 307
304 3300011119 Ga0105246_10024732 Ga0105246_100247322 307
305 3300013306 Ga0163162_10000310 Ga0163162_1000031042 307
306 3300014325 Ga0163163_10001487 Ga0163163_1000148715 307
307 3300014968 Ga0157379_10013005 Ga0157379_100130052 307
308 3300015687 Ga0183368_1002 Ga0183368_10021403 307
309 3300025207 Ga0209760_100701 Ga0209760_1007012 307
310 3300025224 Ga0209784_100053 Ga0209784_10005339 307
311 3300025226 Ga0209674_100014 Ga0209674_10001455 307
312 3300025231 Ga0207427_100061 Ga0207427_100061118 307
313 3300025233 Ga0209437_100037 Ga0209437_100037277 307
314 3300025242 Ga0209258_100090 Ga0209258_10009077 307
315 3300025242 Ga0209258_100138 Ga0209258_10013854 307
316 3300025246 Ga0209646_1001427 Ga0209646_10014273 307
317 3300025250 Ga0209026_1000104 Ga0209026_1000104119 307
318 3300025254 Ga0209148_1000001 Ga0209148_1000001233 307
319 3300025254 Ga0209148_1000065 Ga0209148_100006577 307
320 3300025256 Ga0209759_1001467 Ga0209759_10014673 307
321 3300025261 Ga0209233_1000002 Ga0209233_10000021998 307
322 3300025272 Ga0209455_1000079 Ga0209455_1000079118 307
323 3300025272 Ga0209455_1003693 Ga0209455_10036932 307
324 3300025909 Ga0207705_10001085 Ga0207705_100010853 307
325 3300026035 Ga0207703_10026189 Ga0207703_100261894 307
326 3300026088 Ga0207641_10012492 Ga0207641_100124923 307
327 3300044765 Ga0466970_0000496 Ga0466970_0000496_9233_10228 307
328 3300046471 Ga0495650_0000191 Ga0495650_0000191_35558_36514 307
329 3300046519 Ga0495632_0108904 Ga0495632_0108904_135_1091 307
330 3300048928 Ga0496125_0023406 Ga0496125_0023406_3737_4693 307
331 3300048929 Ga0496126_0088245 Ga0496126_0088245_1254_2210 307
332 3300053090 Ga0500646_0003484 Ga0500646_0003484_1660_2616 307
333 iso_pu_bacteria 2884338543 2884338827 307
334 3300005337 Ga0070682_100014480 Ga0070682_1000144802 308
335 3300005337 Ga0070682_100014970 Ga0070682_1000149703 308
336 3300005339 Ga0070660_100046496 Ga0070660_1000464963 308
337 3300005345 Ga0070692_10159273 Ga0070692_101592732 308
338 3300005366 Ga0070659_100013061 Ga0070659_1000130612 308
339 3300005457 Ga0070662_100065358 Ga0070662_1000653582 308
340 3300005458 Ga0070681_10004860 Ga0070681_1000486010 308
341 3300005539 Ga0068853_100002290 Ga0068853_1000022907 308
342 3300005539 Ga0068853_100044837 Ga0068853_1000448372 308
343 3300005563 Ga0068855_100016860 Ga0068855_1000168605 308
344 3300005578 Ga0068854_100000026 Ga0068854_10000002688 308
345 3300009093 Ga0105240_10115212 Ga0105240_101152122 308
346 3300009551 Ga0105238_10001656 Ga0105238_100016569 308
347 3300013100 Ga0157373_10002433 Ga0157373_100024337 308
348 3300013102 Ga0157371_10008699 Ga0157371_100086995 308
349 3300013105 Ga0157369_10001250 Ga0157369_1000125022 308
350 3300013306 Ga0163162_10224333 Ga0163162_102243332 308
351 3300013307 Ga0157372_10021398 Ga0157372_100213985 308
352 3300025261 Ga0209233_1006812 Ga0209233_10068123 308
353 3300025303 Ga0209051_1004768 Ga0209051_10047685 308
354 3300025904 Ga0207647_10000002 Ga0207647_1000000280 308
355 3300025904 Ga0207647_10002255 Ga0207647_100022555 308
356 3300025909 Ga0207705_10001679 Ga0207705_100016794 308
357 3300025912 Ga0207707_10003877 Ga0207707_100038772 308
358 3300025913 Ga0207695_10057689 Ga0207695_100576893 308
359 3300025919 Ga0207657_10035064 Ga0207657_100350644 308
360 3300025919 Ga0207657_10098901 Ga0207657_100989012 308
361 3300025920 Ga0207649_10032787 Ga0207649_100327872 308
362 3300025932 Ga0207690_10008354 Ga0207690_100083542 308
363 3300025932 Ga0207690_10022761 Ga0207690_100227613 308
364 3300025932 Ga0207690_10025875 Ga0207690_100258753 308
365 3300025932 Ga0207690_10125735 Ga0207690_101257352 308
366 3300025933 Ga0207706_10028042 Ga0207706_100280422 308
367 3300025949 Ga0207667_10000077 Ga0207667_1000007753 308
368 3300025949 Ga0207667_10000739 Ga0207667_1000073920 308
369 3300025949 Ga0207667_10006687 Ga0207667_100066875 308
370 3300025981 Ga0207640_10000032 Ga0207640_1000003295 308
371 3300026041 Ga0207639_10009206 Ga0207639_100092063 308
372 3300026041 Ga0207639_10086821 Ga0207639_100868213 308
373 3300026116 Ga0207674_10040168 Ga0207674_100401684 308
374 3300031730 Ga0307516_10052276 Ga0307516_100522762 308
375 3300037418 Ga0395900_0504475 Ga0395900_0504475_102_1043 308
376 3300039093 Ga0400489_37299 Ga0400489_37299_48749_49699 308
377 3300044656 Ga0466969_0037206 Ga0466969_0037206_347_1288 308
378 3300044684 Ga0466966_0011070 Ga0466966_0011070_1395_2336 308
379 3300044706 Ga0466964_0005140 Ga0466964_0005140_2662_3603 308
380 3300044719 Ga0466971_0001794 Ga0466971_0001794_602_1543 308
381 3300044735 Ga0466968_0000061 Ga0466968_0000061_10448_11392 308
382 3300044765 Ga0466970_0003435 Ga0466970_0003435_5507_6448 308
383 3300044901 Ga0466960_0045412 Ga0466960_0045412_1008_1949 308
384 3300046460 Ga0495638_0000236 Ga0495638_0000236_44122_45060 308
385 3300046519 Ga0495632_0000531 Ga0495632_0000531_23177_24121 308
386 3300046519 Ga0495632_0018148 Ga0495632_0018148_59_997 308
387 3300047472 Ga0495686_0000426 Ga0495686_0000426_22699_23643 308
388 3300047472 Ga0495686_0001228 Ga0495686_0001228_10348_11286 308
389 3300048909 Ga0496106_0000168 Ga0496106_0000168_24127_25065 308
390 3300048918 Ga0496115_0000095 Ga0496115_0000095_63357_64337 308
391 3300048926 Ga0496123_0019361 Ga0496123_0019361_1271_2215 308
392 3300048928 Ga0496125_0033120 Ga0496125_0033120_2150_3094 308
393 3300048929 Ga0496126_0121945 Ga0496126_0121945_382_1326 308
394 3300049580 Ga0501046_0022689 Ga0501046_0022689_279_1211 308
395 3300049581 Ga0501047_0022027 Ga0501047_0022027_206_1138 308
396 3300049586 Ga0501070_0000146 Ga0501070_0000146_56573_57514 308
397 3300049586 Ga0501070_0014993 Ga0501070_0014993_4757_5689 308
398 3300049586 Ga0501070_0032970 Ga0501070_0032970_2036_2965 308
399 3300049586 Ga0501070_0162074 Ga0501070_0162074_382_1311 308
400 3300049590 Ga0501074_0038209 Ga0501074_0038209_610_1542 308
401 3300049742 Ga0501080_0008369 Ga0501080_0008369_2063_2995 308
402 3300049822 Ga0501035_0006993 Ga0501035_0006993_9033_9974 308
403 3300060353 Ga0501082_0019471 Ga0501082_0019471_4153_5085 308
404 3300061719 Ga0466962_0004934 Ga0466962_0004934_4771_5712 308
405 iso_pu_bacteria 2643221562 2643828764 308
406 iso_pu_bacteria 2687453130 2687584838 308
407 iso_pu_bacteria 2919085039 2919086482 308
408 iso_pu_bacteria 2939611941 2939613475 308
409 3300002772 JGI25164J39214_1000865 JGI25164J39214_10008653 309
410 3300003214 JGI25165J46597_1001780 JGI25165J46597_10017802 309
411 3300005439 Ga0070711_100024811 Ga0070711_1000248112 309
412 3300005458 Ga0070681_10000552 Ga0070681_1000055211 309
413 3300005547 Ga0070693_100010956 Ga0070693_1000109562 309
414 3300005548 Ga0070665_100026563 Ga0070665_1000265634 309
415 3300005563 Ga0068855_100505101 Ga0068855_1005051012 309
416 3300005614 Ga0068856_100003717 Ga0068856_1000037176 309
417 3300005616 Ga0068852_100027419 Ga0068852_1000274192 309
418 3300005616 Ga0068852_100093186 Ga0068852_1000931863 309
419 3300005617 Ga0068859_100194926 Ga0068859_1001949262 309
420 3300005618 Ga0068864_100169015 Ga0068864_1001690152 309
421 3300005834 Ga0068851_10050072 Ga0068851_100500722 309
422 3300005841 Ga0068863_100333736 Ga0068863_1003337362 309
423 3300006237 Ga0097621_100052340 Ga0097621_1000523403 309
424 3300006358 Ga0068871_100450501 Ga0068871_1004505012 309
425 3300006881 Ga0068865_100003462 Ga0068865_1000034623 309
426 3300006881 Ga0068865_100025746 Ga0068865_1000257461 309
427 3300006931 Ga0097620_100194937 Ga0097620_1001949373 309
428 3300009551 Ga0105238_10023815 Ga0105238_100238154 309
429 3300009551 Ga0105238_10059367 Ga0105238_100593672 309
430 3300009551 Ga0105238_10314826 Ga0105238_103148262 309
431 3300010375 Ga0105239_10212423 Ga0105239_102124231 309
432 3300013104 Ga0157370_10008714 Ga0157370_100087146 309
433 3300013297 Ga0157378_10268527 Ga0157378_102685272 309
434 3300013306 Ga0163162_10000642 Ga0163162_1000064214 309
435 3300014968 Ga0157379_10305607 Ga0157379_103056072 309
436 3300014969 Ga0157376_10037971 Ga0157376_100379714 309
437 3300025231 Ga0207427_100129 Ga0207427_10012949 309
438 3300025233 Ga0209437_100118 Ga0209437_100118145 309
439 3300025261 Ga0209233_1000046 Ga0209233_1000046149 309
440 3300025903 Ga0207680_10074224 Ga0207680_100742241 309
441 3300025912 Ga0207707_10000131 Ga0207707_1000013171 309
442 3300025912 Ga0207707_10183288 Ga0207707_101832882 309
443 3300025924 Ga0207694_10003716 Ga0207694_100037164 309
444 3300025924 Ga0207694_10005085 Ga0207694_100050859 309
445 3300025924 Ga0207694_10043610 Ga0207694_100436102 309
446 3300025981 Ga0207640_10055275 Ga0207640_100552752 309
447 3300025981 Ga0207640_10297027 Ga0207640_102970271 309
448 3300026041 Ga0207639_10041665 Ga0207639_100416654 309
449 3300026078 Ga0207702_10544218 Ga0207702_105442181 309
450 3300026088 Ga0207641_10020195 Ga0207641_100201954 309
451 3300026142 Ga0207698_10008897 Ga0207698_100088975 309
452 3300028379 Ga0268266_10082893 Ga0268266_100828932 309
453 3300033180 Ga0307510_10004110 Ga0307510_100041109 309
454 3300035089 Ga0373944_0013530 Ga0373944_0013530_169_1110 309
455 3300035410 Ga0373924_0134581 Ga0373924_0134581_110_1051 309
456 3300035724 Ga0373933_0010679 Ga0373933_0010679_1765_2706 309
457 3300036401 Ga0373937_0016801 Ga0373937_0016801_442_1383 309
458 3300045049 Ga0466959_0021971 Ga0466959_0021971_3626_4612 309
459 3300046459 Ga0495629_0038732 Ga0495629_0038732_1864_2805 309
460 3300046543 Ga0495645_0142533 Ga0495645_0142533_570_1511 309
461 3300046683 Ga0495658_0006050 Ga0495658_0006050_2931_3872 309
462 3300049570 Ga0501033_0013311 Ga0501033_0013311_4838_5779 309
463 3300049570 Ga0501033_0067769 Ga0501033_0067769_150_1094 309
464 3300049572 Ga0501036_0311277 Ga0501036_0311277_262_1227 309
465 3300049573 Ga0501037_0059645 Ga0501037_0059645_810_1748 309
466 3300049574 Ga0501038_0156167 Ga0501038_0156167_339_1304 309
467 3300049579 Ga0501043_0028026 Ga0501043_0028026_3187_4152 309
468 3300049579 Ga0501043_0076697 Ga0501043_0076697_586_1530 309
469 3300049579 Ga0501043_0090005 Ga0501043_0090005_381_1337 309
470 3300049580 Ga0501046_0017220 Ga0501046_0017220_2769_3734 309
471 3300049580 Ga0501046_0286264 Ga0501046_0286264_100_1044 309
472 3300049581 Ga0501047_0166643 Ga0501047_0166643_596_1534 309
473 3300049582 Ga0501048_0019797 Ga0501048_0019797_3188_4138 309
474 3300049582 Ga0501048_0149062 Ga0501048_0149062_428_1393 309
475 3300049742 Ga0501080_0170188 Ga0501080_0170188_888_1826 309
476 3300049744 Ga0501083_0116240 Ga0501083_0116240_237_1187 309
477 3300049822 Ga0501035_0020740 Ga0501035_0020740_3269_4213 309
478 3300049822 Ga0501035_0177315 Ga0501035_0177315_690_1634 309
479 3300049822 Ga0501035_0238564 Ga0501035_0238564_319_1269 309
480 3300049822 Ga0501035_0427597 Ga0501035_0427597_40_978 309
481 3300049823 Ga0501044_0076810 Ga0501044_0076810_1510_2466 309
482 3300049823 Ga0501044_0136080 Ga0501044_0136080_991_1929 309
483 3300049823 Ga0501044_0165656 Ga0501044_0165656_532_1497 309
484 3300053094 Ga0500566_0126233 Ga0500566_0126233_305_1246 309
485 3300053123 Ga0500614_013421 Ga0500614_013421_270_1211 309
486 3300053139 Ga0500568_0000645 Ga0500568_0000645_23548_24486 309
487 3300053155 Ga0500620_029835 Ga0500620_029835_31_969 309
488 3300054114 Ga0501084_0279466 Ga0501084_0279466_338_1288 309
489 3300060353 Ga0501082_0000402 Ga0501082_0000402_28989_29939 309
490 3300005338 Ga0068868_100016923 Ga0068868_1000169232 310
491 3300005367 Ga0070667_100139556 Ga0070667_1001395562 310
492 3300005367 Ga0070667_100317045 Ga0070667_1003170452 310
493 3300005457 Ga0070662_100175736 Ga0070662_1001757362 310
494 3300005459 Ga0068867_100308495 Ga0068867_1003084952 310
495 3300005548 Ga0070665_100000712 Ga0070665_10000071233 310
496 3300005563 Ga0068855_100254647 Ga0068855_1002546472 310
497 3300005578 Ga0068854_100003525 Ga0068854_1000035256 310
498 3300005614 Ga0068856_100154783 Ga0068856_1001547832 310
499 3300005616 Ga0068852_100081911 Ga0068852_1000819112 310
500 3300005834 Ga0068851_10003106 Ga0068851_100031062 310
501 3300005841 Ga0068863_100179577 Ga0068863_1001795772 310
502 3300005842 Ga0068858_100003930 Ga0068858_1000039309 310
503 3300006237 Ga0097621_100122753 Ga0097621_1001227531 310
504 3300006881 Ga0068865_100050142 Ga0068865_1000501422 310
505 3300009093 Ga0105240_10035352 Ga0105240_100353525 310
506 3300009098 Ga0105245_10479507 Ga0105245_104795071 310
507 3300010375 Ga0105239_10059531 Ga0105239_100595312 310
508 3300010375 Ga0105239_10416576 Ga0105239_104165762 310
509 3300013296 Ga0157374_10077155 Ga0157374_100771553 310
510 3300013297 Ga0157378_10069854 Ga0157378_100698541 310
511 3300013307 Ga0157372_10813170 Ga0157372_108131701 310
512 3300025321 Ga0207656_10002191 Ga0207656_100021913 310
513 3300025903 Ga0207680_10000139 Ga0207680_100001393 310
514 3300025904 Ga0207647_10000175 Ga0207647_1000017536 310
515 3300025913 Ga0207695_10019450 Ga0207695_100194505 310
516 3300025913 Ga0207695_10032954 Ga0207695_100329542 310
517 3300025914 Ga0207671_10022465 Ga0207671_100224654 310
518 3300025924 Ga0207694_10002801 Ga0207694_100028015 310
519 3300025933 Ga0207706_10010415 Ga0207706_100104157 310
520 3300025938 Ga0207704_10228326 Ga0207704_102283262 310
521 3300025949 Ga0207667_10437060 Ga0207667_104370602 310
522 3300025981 Ga0207640_10001639 Ga0207640_100016394 310
523 3300026035 Ga0207703_10004097 Ga0207703_100040977 310
524 3300026041 Ga0207639_10001251 Ga0207639_100012513 310
525 3300026067 Ga0207678_10068948 Ga0207678_100689483 310
526 3300026088 Ga0207641_10076479 Ga0207641_100764793 310
527 3300026142 Ga0207698_10011336 Ga0207698_100113364 310
528 3300028379 Ga0268266_10000008 Ga0268266_1000000851 310
529 3300031616 Ga0307508_10027843 Ga0307508_100278433 310
530 3300049569 Ga0501032_0059078 Ga0501032_0059078_246_1187 310
531 3300049570 Ga0501033_0051516 Ga0501033_0051516_2079_3020 310
532 3300049581 Ga0501047_0408958 Ga0501047_0408958_105_1046 310
533 3300049585 Ga0501069_0016129 Ga0501069_0016129_762_1703 310
534 3300049586 Ga0501070_0021836 Ga0501070_0021836_2786_3727 310
535 3300049589 Ga0501073_0017456 Ga0501073_0017456_725_1666 310
536 3300049742 Ga0501080_0067297 Ga0501080_0067297_1652_2593 310
537 3300049822 Ga0501035_0039145 Ga0501035_0039145_2545_3486 310
538 3300005336 Ga0070680_100000946 Ga0070680_10000094614 311
539 3300005458 Ga0070681_10007360 Ga0070681_100073608 311
540 3300005530 Ga0070679_100012167 Ga0070679_1000121673 311
541 3300005535 Ga0070684_100388599 Ga0070684_1003885992 311
542 3300005841 Ga0068863_100113210 Ga0068863_1001132102 311
543 3300009093 Ga0105240_10289346 Ga0105240_102893462 311
544 3300013100 Ga0157373_10020677 Ga0157373_100206772 311
545 3300013102 Ga0157371_10161455 Ga0157371_101614552 311
546 3300013104 Ga0157370_10001106 Ga0157370_1000110614 311
547 3300013105 Ga0157369_10130393 Ga0157369_101303932 311
548 3300013307 Ga0157372_10011313 Ga0157372_100113134 311
549 3300020070 Ga0206356_10907506 Ga0206356_109075062 311
550 3300025912 Ga0207707_10000020 Ga0207707_10000020111 311
551 3300025917 Ga0207660_10001057 Ga0207660_100010574 311
552 3300025919 Ga0207657_10196769 Ga0207657_101967692 311
553 3300025921 Ga0207652_10000037 Ga0207652_1000003715 311
554 3300025949 Ga0207667_10143865 Ga0207667_101438653 311
555 3300049586 Ga0501070_0232154 Ga0501070_0232154_226_1170 311
556 3300049590 Ga0501074_0025187 Ga0501074_0025187_82_1026 311
557 3300049822 Ga0501035_0011460 Ga0501035_0011460_6571_7515 311
558 3300049823 Ga0501044_0027845 Ga0501044_0027845_543_1487 311
559 3300005336 Ga0070680_100002197 Ga0070680_1000021973 312
560 3300005354 Ga0070675_100074093 Ga0070675_1000740932 312
561 3300005455 Ga0070663_100035443 Ga0070663_1000354433 312
562 3300005458 Ga0070681_10003671 Ga0070681_100036713 312
563 3300005458 Ga0070681_10207387 Ga0070681_102073872 312
564 3300005466 Ga0070685_10002434 Ga0070685_100024347 312
565 3300005530 Ga0070679_100003490 Ga0070679_1000034903 312
566 3300005548 Ga0070665_100009799 Ga0070665_1000097993 312
567 3300005563 Ga0068855_100493937 Ga0068855_1004939372 312
568 3300005840 Ga0068870_10063166 Ga0068870_100631662 312
569 3300005841 Ga0068863_100312146 Ga0068863_1003121461 312
570 3300006237 Ga0097621_100069711 Ga0097621_1000697112 312
571 3300009093 Ga0105240_10003317 Ga0105240_1000331718 312
572 3300009176 Ga0105242_10153044 Ga0105242_101530442 312
573 3300009545 Ga0105237_10022010 Ga0105237_100220105 312
574 3300009551 Ga0105238_10000729 Ga0105238_1000072918 312
575 3300013306 Ga0163162_10087782 Ga0163162_100877823 312
576 3300013307 Ga0157372_10094119 Ga0157372_100941193 312
577 3300013308 Ga0157375_10226444 Ga0157375_102264442 312
578 3300014969 Ga0157376_10074292 Ga0157376_100742922 312
579 3300025908 Ga0207643_10012719 Ga0207643_100127194 312
580 3300025912 Ga0207707_10000942 Ga0207707_1000094213 312
581 3300025913 Ga0207695_10000418 Ga0207695_1000041859 312
582 3300025914 Ga0207671_10063712 Ga0207671_100637122 312
583 3300025917 Ga0207660_10001035 Ga0207660_100010355 312
584 3300025921 Ga0207652_10000902 Ga0207652_1000090213 312
585 3300025924 Ga0207694_10003401 Ga0207694_100034017 312
586 3300025926 Ga0207659_10090706 Ga0207659_100907062 312
587 3300025940 Ga0207691_10009722 Ga0207691_100097225 312
588 3300025942 Ga0207689_10016937 Ga0207689_100169375 312
589 3300026067 Ga0207678_10078439 Ga0207678_100784392 312
590 3300026088 Ga0207641_10070822 Ga0207641_100708222 312
591 3300026089 Ga0207648_10287639 Ga0207648_102876392 312
592 3300026121 Ga0207683_10009137 Ga0207683_100091375 312
593 3300037418 Ga0395900_0003805 Ga0395900_0003805_2836_3786 312
594 3300048929 Ga0496126_0088204 Ga0496126_0088204_1115_2068 312
595 3300049568 Ga0501031_0102052 Ga0501031_0102052_95_1042 312
596 3300001915 JGI24741J21665_1000076 JGI24741J21665_10000769 313
597 3300001915 JGI24741J21665_1005437 JGI24741J21665_10054372 313
598 3300001979 JGI24740J21852_10005082 JGI24740J21852_100050824 313
599 3300005329 Ga0070683_100293315 Ga0070683_1002933152 313
600 3300005330 Ga0070690_100029514 Ga0070690_1000295142 313
601 3300005334 Ga0068869_100124752 Ga0068869_1001247521 313
602 3300005337 Ga0070682_100015837 Ga0070682_1000158374 313
603 3300005338 Ga0068868_100266644 Ga0068868_1002666442 313
604 3300005344 Ga0070661_100002526 Ga0070661_1000025266 313
605 3300005345 Ga0070692_10000307 Ga0070692_100003077 313
606 3300005347 Ga0070668_100064734 Ga0070668_1000647343 313
607 3300005365 Ga0070688_100125161 Ga0070688_1001251612 313
608 3300005458 Ga0070681_10045534 Ga0070681_100455342 313
609 3300005530 Ga0070679_100002097 Ga0070679_10000209710 313
610 3300005539 Ga0068853_100015163 Ga0068853_1000151634 313
611 3300005543 Ga0070672_100029858 Ga0070672_1000298584 313
612 3300005544 Ga0070686_100035506 Ga0070686_1000355061 313
613 3300005547 Ga0070693_100006423 Ga0070693_1000064235 313
614 3300005578 Ga0068854_100006081 Ga0068854_1000060812 313
615 3300005614 Ga0068856_100086051 Ga0068856_1000860513 313
616 3300005614 Ga0068856_100258841 Ga0068856_1002588412 313
617 3300005618 Ga0068864_100441945 Ga0068864_1004419452 313
618 3300005834 Ga0068851_10027637 Ga0068851_100276373 313
619 3300009093 Ga0105240_10076161 Ga0105240_100761613 313
620 3300009093 Ga0105240_10173120 Ga0105240_101731202 313
621 3300009545 Ga0105237_10168033 Ga0105237_101680332 313
622 3300009545 Ga0105237_10663088 Ga0105237_106630881 313
623 3300009551 Ga0105238_10029898 Ga0105238_100298983 313
624 3300013104 Ga0157370_10010315 Ga0157370_100103153 313
625 3300013104 Ga0157370_10115169 Ga0157370_101151693 313
626 3300013105 Ga0157369_10006062 Ga0157369_100060629 313
627 3300013307 Ga0157372_10007610 Ga0157372_100076107 313
628 3300013308 Ga0157375_10031352 Ga0157375_100313525 313
629 3300014969 Ga0157376_10014582 Ga0157376_100145825 313
630 3300020069 Ga0197907_10696324 Ga0197907_106963242 313
631 3300020070 Ga0206356_11546151 Ga0206356_115461513 313
632 3300020081 Ga0206354_10932484 Ga0206354_109324843 313
633 3300020081 Ga0206354_11021742 Ga0206354_110217422 313
634 3300020082 Ga0206353_10050604 Ga0206353_100506043 313
635 3300020082 Ga0206353_10562421 Ga0206353_105624211 313
636 3300025321 Ga0207656_10062171 Ga0207656_100621712 313
637 3300025904 Ga0207647_10000224 Ga0207647_100002242 313
638 3300025909 Ga0207705_10000198 Ga0207705_1000019836 313
639 3300025909 Ga0207705_10001682 Ga0207705_1000168213 313
640 3300025909 Ga0207705_10140855 Ga0207705_101408552 313
641 3300025912 Ga0207707_10001255 Ga0207707_1000125511 313
642 3300025912 Ga0207707_10002269 Ga0207707_1000226913 313
643 3300025913 Ga0207695_10003587 Ga0207695_1000358712 313
644 3300025913 Ga0207695_10059440 Ga0207695_100594402 313
645 3300025917 Ga0207660_10000594 Ga0207660_1000059416 313
646 3300025917 Ga0207660_10001511 Ga0207660_1000151113 313
647 3300025917 Ga0207660_10141499 Ga0207660_101414992 313
648 3300025919 Ga0207657_10001821 Ga0207657_1000182114 313
649 3300025919 Ga0207657_10011359 Ga0207657_100113595 313
650 3300025920 Ga0207649_10015754 Ga0207649_100157543 313
651 3300025920 Ga0207649_10020685 Ga0207649_100206852 313
652 3300025921 Ga0207652_10000226 Ga0207652_1000022616 313
653 3300025921 Ga0207652_10002104 Ga0207652_1000210413 313
654 3300025932 Ga0207690_10001578 Ga0207690_100015782 313
655 3300025932 Ga0207690_10023298 Ga0207690_100232984 313
656 3300025940 Ga0207691_10036351 Ga0207691_100363513 313
657 3300025944 Ga0207661_10016793 Ga0207661_100167932 313
658 3300025945 Ga0207679_10081290 Ga0207679_100812903 313
659 3300025949 Ga0207667_10004983 Ga0207667_100049832 313
660 3300025949 Ga0207667_10031674 Ga0207667_100316743 313
661 3300025981 Ga0207640_10002761 Ga0207640_100027613 313
662 3300026041 Ga0207639_10004488 Ga0207639_100044883 313
663 3300026041 Ga0207639_10004560 Ga0207639_100045605 313
664 3300026067 Ga0207678_10001007 Ga0207678_1000100715 313
665 3300026067 Ga0207678_10008801 Ga0207678_100088015 313
666 3300026078 Ga0207702_10007180 Ga0207702_100071803 313
667 3300026078 Ga0207702_10077386 Ga0207702_100773863 313
668 3300026089 Ga0207648_10022355 Ga0207648_100223555 313
669 3300026095 Ga0207676_10291396 Ga0207676_102913962 313
670 3300026116 Ga0207674_10004053 Ga0207674_100040533 313
671 3300026142 Ga0207698_10001009 Ga0207698_100010098 313
672 3300026142 Ga0207698_10017935 Ga0207698_100179353 313
673 3300037418 Ga0395900_0124201 Ga0395900_0124201_1639_2580 313
674 3300037418 Ga0395900_0140270 Ga0395900_0140270_1246_2187 313
675 3300038443 Ga0395901_0022120 Ga0395901_0022120_976_1917 313
676 3300038443 Ga0395901_0098919 Ga0395901_0098919_126_1067 313
677 3300049573 Ga0501037_0033294 Ga0501037_0033294_757_1707 313
678 3300049581 Ga0501047_0006510 Ga0501047_0006510_7661_8611 313
679 3300049581 Ga0501047_0024890 Ga0501047_0024890_2168_3115 313
680 3300049585 Ga0501069_0009946 Ga0501069_0009946_3743_4693 313
681 3300049586 Ga0501070_0002845 Ga0501070_0002845_3183_4130 313
682 3300049586 Ga0501070_0015050 Ga0501070_0015050_4032_4982 313
683 3300049587 Ga0501071_0009504 Ga0501071_0009504_2047_2994 313
684 3300049589 Ga0501073_0003754 Ga0501073_0003754_3021_3968 313
685 3300049590 Ga0501074_0000885 Ga0501074_0000885_7675_8622 313
686 3300049590 Ga0501074_0003630 Ga0501074_0003630_1571_2521 313
687 3300049592 Ga0501076_0389984 Ga0501076_0389984_127_1074 313
688 3300049593 Ga0501077_0081389 Ga0501077_0081389_1004_1945 313
689 3300049741 Ga0501079_0106154 Ga0501079_0106154_940_1890 313
690 3300049742 Ga0501080_0003851 Ga0501080_0003851_3121_4071 313
691 3300049742 Ga0501080_0027011 Ga0501080_0027011_2222_3169 313
692 3300049822 Ga0501035_0003194 Ga0501035_0003194_1973_2923 313
693 3300049822 Ga0501035_0022696 Ga0501035_0022696_2311_3258 313
694 3300049823 Ga0501044_0053889 Ga0501044_0053889_1126_2073 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

208

333

0.97

PF00551

Formyl_trans_N

Formyl transferase

6

184

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9662 4 309
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.9553 4 309
3r8x-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine 0.9549 4 309
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9537 1 309
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9419 2 309
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9637 4 208 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9539 4 208 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9479 4 208 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9372 1 208 3.40.50.170
3tqqA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9361 210 309 3.10.25.10
ID Description Score Start End GO Terms
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9801 4 126 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9786 4 208 GO:0004479
GO:0005829
AF-A0A382L434-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9758 26 204 GO:0004479
GO:0005829
AF-A0A7C5PBG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9739 46 306 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9738 4 208 GO:0004479
GO:0005829

Feature Viewer

pLDDT pTM Quality
93.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map