F475689
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 410 | 1386 | 434 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221679|2644447324 |
| Length | 499 |
| Sequence | GPVHSPGEKVWTTLLTTAHSLWSPLWTTTAPGPVSCSRPATMPCTRCGQKKVLEDLAIDQPPVRHPDATSREVLRLAVPAFLALVAEPAFLLADSAIVGRLGTVPLAGLGVASAALSTAAGIFIFLAYGTTASVSRRAGAGDARAAFGLGVDGVWLALVLGVASGALLLAAAPWVAGAFDASGAATAQAVTYLRVSAFGVPGMLTVLAATGVLRGLQDTRTPLAVAVAGFSLNIVLNVVFVFGLGLGIAGSALGTVVAQTLMGTALVAVVVRGGRRHGASLRAHPLRVLAAARDGVPLLVRTLALRAVLLLTTWAAASGGDVTLASYQVSATVWTFLVFALDALAIAAQALTGHALGAGDVARARALTALMLRWGVVGGAVFGAVVVLLHRVLPPLFTADAGVRASLAGALIVVGLQQPLSGYVFVLDGVLIGAGDGRWLARAALAQLVVYVPVVLAVRAGAGSASALWWGFGVFMLVRGALLGWRARGPQWAVVGASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 84 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 85 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 86 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 87 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 88 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 89 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 90 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 91 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 92 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 93 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 103 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 104 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 105 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 108 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 110 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 115 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 116 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 119 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 122 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 123 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 124 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 125 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 126 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 127 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 128 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 131 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 132 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 133 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 136 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 137 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 141 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 214 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 215 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 216 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 217 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 255 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 262 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 263 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 264 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 265 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 269 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 270 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 271 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 272 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 273 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 274 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 275 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 276 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 277 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 278 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 279 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 280 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 281 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 282 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 283 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 284 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 285 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 286 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 287 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 288 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 289 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 290 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 291 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 292 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 293 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 294 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 295 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 296 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 297 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 298 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 299 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 300 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 301 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 302 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 303 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 304 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 305 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 306 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 307 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 308 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 309 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 310 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 311 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 312 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 313 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 314 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 315 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 316 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 317 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 318 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 319 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 320 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 321 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 322 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 323 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 324 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 325 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 326 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 327 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 328 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 329 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 330 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 331 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 332 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 333 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 334 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 335 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 336 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 337 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 338 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 339 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 340 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 341 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 342 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 343 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 344 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 345 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 346 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 347 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 348 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 349 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 350 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 351 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 352 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 353 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 354 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 355 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 356 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 357 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 358 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 359 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 360 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 361 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 362 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 363 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 364 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 365 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 366 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 367 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 368 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 369 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 370 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 371 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 372 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 373 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 374 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 375 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 376 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 377 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 378 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 379 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 380 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 381 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 382 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 383 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 384 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 385 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 386 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 387 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 388 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 389 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 390 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 391 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 392 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 393 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 394 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 395 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 396 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 397 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 398 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 399 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 400 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 401 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 402 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 403 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 404 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 405 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 406 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 407 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 408 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 409 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 410 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.37 |
| Metatranscriptomes | 0.14 |
| Isolates | 20.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.63 |
| Nodule | 0.43 |
| Rhizoplane | 5.92 |
| Rhizosphere | 72.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002388 | 3300001989 | Bacteria | 7243 |
| 2 | JGI24737J22298_10004268 | 3300001990 | Bacteria | 4992 |
| 3 | JGI24735J21928_10005654 | 3300002067 | Bacteria | 4135 |
| 4 | JGI24738J21930_10008082 | 3300002075 | Bacteria | 2402 |
| 5 | rootH1_10005518 | 3300003316 | Bacteria | 3371 |
| 6 | Ga0006562J51391_1088201 | 3300003578 | Bacteria | 1580 |
| 7 | Ga0070682_100086148 | 3300005337 | Bacteria | 2045 |
| 8 | Ga0070668_100128044 | 3300005347 | Bacteria | 2035 |
| 9 | Ga0070667_100008551 | 3300005367 | Bacteria | 8485 |
| 10 | Ga0070709_10000675 | 3300005434 | Bacteria | 19453 |
| 11 | Ga0070709_10030491 | 3300005434 | Bacteria | 3237 |
| 12 | Ga0070714_100001941 | 3300005435 | Bacteria | 15103 |
| 13 | Ga0070714_100078099 | 3300005435 | Bacteria | 2876 |
| 14 | Ga0070713_100001726 | 3300005436 | Bacteria | 14076 |
| 15 | Ga0070713_100011371 | 3300005436 | Bacteria | 6480 |
| 16 | Ga0070710_10002007 | 3300005437 | Bacteria | 9628 |
| 17 | Ga0070711_100003590 | 3300005439 | Bacteria | 9050 |
| 18 | Ga0070711_100013350 | 3300005439 | Bacteria | 5158 |
| 19 | Ga0070708_100051406 | 3300005445 | Bacteria | 3652 |
| 20 | Ga0070678_100159324 | 3300005456 | Bacteria | 1827 |
| 21 | Ga0070678_100164766 | 3300005456 | Bacteria | 1800 |
| 22 | Ga0070706_100018922 | 3300005467 | Bacteria | 6352 |
| 23 | Ga0070706_100045763 | 3300005467 | Bacteria | 4040 |
| 24 | Ga0070707_100006972 | 3300005468 | Bacteria | 10472 |
| 25 | Ga0070707_100015458 | 3300005468 | Bacteria | 7162 |
| 26 | Ga0070707_100022987 | 3300005468 | Bacteria | 5896 |
| 27 | Ga0070707_100154290 | 3300005468 | Bacteria | 2237 |
| 28 | Ga0070707_100185440 | 3300005468 | Bacteria | 2029 |
| 29 | Ga0070698_100005345 | 3300005471 | Bacteria | 14049 |
| 30 | Ga0070698_100007299 | 3300005471 | Bacteria | 11966 |
| 31 | Ga0070698_100010980 | 3300005471 | Bacteria | 9637 |
| 32 | Ga0070699_100059959 | 3300005518 | Bacteria | 3296 |
| 33 | Ga0070679_100080310 | 3300005530 | Bacteria | 3250 |
| 34 | Ga0070697_100042540 | 3300005536 | Bacteria | 3677 |
| 35 | Ga0070697_100151059 | 3300005536 | Bacteria | 1958 |
| 36 | Ga0068857_100261891 | 3300005577 | Bacteria | 1587 |
| 37 | Ga0070702_100001993 | 3300005615 | Bacteria | 8607 |
| 38 | Ga0068860_100000504 | 3300005843 | Bacteria | 48482 |
| 39 | Ga0081455_10000154 | 3300005937 | Bacteria | 82712 |
| 40 | Ga0081455_10165806 | 3300005937 | Bacteria | 1688 |
| 41 | Ga0081538_10000861 | 3300005981 | Bacteria | 32719 |
| 42 | Ga0081538_10019546 | 3300005981 | Bacteria | 5027 |
| 43 | Ga0081540_1066115 | 3300005983 | Bacteria | 1696 |
| 44 | Ga0081539_10003926 | 3300005985 | Bacteria | 17262 |
| 45 | Ga0081539_10006850 | 3300005985 | Bacteria | 10654 |
| 46 | Ga0081539_10090901 | 3300005985 | Bacteria | 1578 |
| 47 | Ga0070717_10006155 | 3300006028 | Bacteria | 8812 |
| 48 | Ga0070717_10018383 | 3300006028 | Bacteria | 5455 |
| 49 | Ga0070717_10045053 | 3300006028 | Bacteria | 3605 |
| 50 | Ga0070717_10045845 | 3300006028 | Bacteria | 3575 |
| 51 | Ga0075365_10000512 | 3300006038 | Bacteria | 14786 |
| 52 | Ga0075365_10002626 | 3300006038 | Bacteria | 8904 |
| 53 | Ga0075365_10038168 | 3300006038 | Bacteria | 3120 |
| 54 | Ga0075365_10038195 | 3300006038 | Bacteria | 3119 |
| 55 | Ga0075365_10038490 | 3300006038 | Bacteria | 3109 |
| 56 | Ga0075365_10051272 | 3300006038 | Bacteria | 2725 |
| 57 | Ga0075365_10085358 | 3300006038 | Bacteria | 2144 |
| 58 | Ga0075365_10088725 | 3300006038 | Bacteria | 2104 |
| 59 | Ga0075368_10001405 | 3300006042 | Bacteria | 7692 |
| 60 | Ga0075368_10025802 | 3300006042 | Bacteria | 2255 |
| 61 | Ga0075363_100051503 | 3300006048 | Bacteria | 2196 |
| 62 | Ga0075364_10120809 | 3300006051 | Bacteria | 1753 |
| 63 | Ga0070715_10000215 | 3300006163 | Bacteria | 13666 |
| 64 | Ga0070715_10011770 | 3300006163 | Bacteria | 3160 |
| 65 | Ga0070716_100026457 | 3300006173 | Bacteria | 3107 |
| 66 | Ga0070716_100041128 | 3300006173 | Bacteria | 2574 |
| 67 | Ga0070712_100097577 | 3300006175 | Bacteria | 2166 |
| 68 | Ga0075362_10012311 | 3300006177 | Bacteria | 3395 |
| 69 | Ga0075367_10004145 | 3300006178 | Bacteria | 7033 |
| 70 | Ga0075367_10027615 | 3300006178 | Bacteria | 3231 |
| 71 | Ga0075370_10007138 | 3300006353 | Bacteria | 5671 |
| 72 | Ga0075370_10030784 | 3300006353 | Bacteria | 2995 |
| 73 | Ga0075370_10072873 | 3300006353 | Bacteria | 1966 |
| 74 | Ga0075428_100002034 | 3300006844 | Bacteria | 21796 |
| 75 | Ga0075428_100005268 | 3300006844 | Bacteria | 14385 |
| 76 | Ga0075428_100027499 | 3300006844 | Bacteria | 6292 |
| 77 | Ga0075430_100006047 | 3300006846 | Bacteria | 10207 |
| 78 | Ga0075430_100006628 | 3300006846 | Bacteria | 9762 |
| 79 | Ga0075431_100003219 | 3300006847 | Bacteria | 15801 |
| 80 | Ga0075431_100006037 | 3300006847 | Bacteria | 12011 |
| 81 | Ga0075431_100008698 | 3300006847 | Bacteria | 10172 |
| 82 | Ga0075431_100262845 | 3300006847 | Bacteria | 1751 |
| 83 | Ga0075429_100011712 | 3300006880 | Bacteria | 7607 |
| 84 | Ga0075429_100025562 | 3300006880 | Bacteria | 5125 |
| 85 | Ga0075429_100100630 | 3300006880 | Bacteria | 2523 |
| 86 | Ga0105251_10007858 | 3300009011 | Bacteria | 6488 |
| 87 | Ga0111539_10061836 | 3300009094 | Bacteria | 4435 |
| 88 | Ga0111539_10353181 | 3300009094 | Bacteria | 1711 |
| 89 | Ga0114129_10016830 | 3300009147 | Bacteria | 10409 |
| 90 | Ga0114129_10054408 | 3300009147 | Bacteria | 5611 |
| 91 | Ga0105239_10156362 | 3300010375 | Bacteria | 2546 |
| 92 | Ga0105239_10165577 | 3300010375 | Bacteria | 2472 |
| 93 | Ga0105246_10000301 | 3300011119 | Bacteria | 26083 |
| 94 | Ga0157370_10129883 | 3300013104 | Bacteria | 2350 |
| 95 | Ga0157369_10010651 | 3300013105 | Bacteria | 10468 |
| 96 | Ga0157369_10028880 | 3300013105 | Bacteria | 6135 |
| 97 | Ga0157372_10201752 | 3300013307 | Bacteria | 2304 |
| 98 | Ga0157375_10033075 | 3300013308 | Bacteria | 4910 |
| 99 | Ga0157375_10043714 | 3300013308 | Bacteria | 4347 |
| 100 | Ga0157375_10082515 | 3300013308 | Bacteria | 3257 |
| 101 | Ga0157380_10038706 | 3300014326 | Bacteria | 3704 |
| 102 | Ga0182008_10000809 | 3300014497 | Bacteria | 21867 |
| 103 | Ga0157379_10180217 | 3300014968 | Bacteria | 1909 |
| 104 | Ga0157379_10222488 | 3300014968 | Bacteria | 1710 |
| 105 | Ga0182007_10001310 | 3300015262 | Bacteria | 13457 |
| 106 | Ga0183367_1008 | 3300015688 | Bacteria | 490626 |
| 107 | Ga0163161_10025668 | 3300017792 | Bacteria | 4172 |
| 108 | Ga0209758_1006734 | 3300025297 | Bacteria | 8093 |
| 109 | Ga0207426_1003012 | 3300025302 | Bacteria | 9782 |
| 110 | Ga0207426_1006736 | 3300025302 | Bacteria | 4923 |
| 111 | Ga0207426_1011274 | 3300025302 | Bacteria | 3415 |
| 112 | Ga0207692_10002071 | 3300025898 | Bacteria | 7664 |
| 113 | Ga0207692_10007254 | 3300025898 | Bacteria | 4533 |
| 114 | Ga0207647_10002992 | 3300025904 | Bacteria | 12717 |
| 115 | Ga0207647_10041322 | 3300025904 | Bacteria | 2900 |
| 116 | Ga0207685_10003470 | 3300025905 | Bacteria | 3841 |
| 117 | Ga0207685_10003755 | 3300025905 | Bacteria | 3747 |
| 118 | Ga0207685_10014678 | 3300025905 | Bacteria | 2458 |
| 119 | Ga0207699_10001491 | 3300025906 | Bacteria | 11123 |
| 120 | Ga0207699_10060383 | 3300025906 | Bacteria | 2276 |
| 121 | Ga0207684_10009758 | 3300025910 | Bacteria | 8466 |
| 122 | Ga0207693_10002505 | 3300025915 | Bacteria | 15969 |
| 123 | Ga0207693_10045332 | 3300025915 | Bacteria | 3455 |
| 124 | Ga0207693_10186386 | 3300025915 | Bacteria | 1633 |
| 125 | Ga0207652_10106048 | 3300025921 | Bacteria | 2487 |
| 126 | Ga0207646_10010545 | 3300025922 | Bacteria | 9019 |
| 127 | Ga0207646_10195494 | 3300025922 | Bacteria | 1827 |
| 128 | Ga0207700_10000997 | 3300025928 | Bacteria | 16322 |
| 129 | Ga0207664_10001190 | 3300025929 | Bacteria | 17302 |
| 130 | Ga0207664_10011115 | 3300025929 | Bacteria | 6378 |
| 131 | Ga0207686_10017345 | 3300025934 | Bacteria | 4056 |
| 132 | Ga0207709_10032751 | 3300025935 | Bacteria | 3046 |
| 133 | Ga0207665_10000660 | 3300025939 | Bacteria | 23254 |
| 134 | Ga0207658_10033468 | 3300025986 | Bacteria | 3667 |
| 135 | Ga0207639_10068716 | 3300026041 | Bacteria | 2762 |
| 136 | Ga0207678_10115734 | 3300026067 | Bacteria | 2287 |
| 137 | Ga0207702_10076571 | 3300026078 | Bacteria | 2892 |
| 138 | Ga0207702_10149417 | 3300026078 | Bacteria | 2124 |
| 139 | Ga0207641_10311153 | 3300026088 | Bacteria | 1491 |
| 140 | Ga0207674_10047401 | 3300026116 | Bacteria | 4406 |
| 141 | Ga0268266_10329998 | 3300028379 | Bacteria | 1430 |
| 142 | Ga0268264_10000547 | 3300028381 | Bacteria | 47223 |
| 143 | Ga0307517_10010298 | 3300028786 | Bacteria | 13101 |
| 144 | Ga0307515_10006675 | 3300028794 | Bacteria | 22994 |
| 145 | Ga0307515_10046074 | 3300028794 | Bacteria | 6678 |
| 146 | Ga0307511_10043387 | 3300030521 | Bacteria | 3760 |
| 147 | Ga0307511_10068813 | 3300030521 | Bacteria | 2610 |
| 148 | Ga0307513_10000175 | 3300031456 | Bacteria | 92151 |
| 149 | Ga0307513_10001562 | 3300031456 | Bacteria | 32853 |
| 150 | Ga0307513_10156947 | 3300031456 | Bacteria | 2174 |
| 151 | Ga0307513_10201543 | 3300031456 | Bacteria | 1830 |
| 152 | Ga0307509_10087596 | 3300031507 | Bacteria | 3198 |
| 153 | Ga0307509_10106105 | 3300031507 | Bacteria | 2829 |
| 154 | Ga0307508_10008367 | 3300031616 | Bacteria | 9560 |
| 155 | Ga0307508_10012953 | 3300031616 | Bacteria | 7625 |
| 156 | Ga0307508_10059204 | 3300031616 | Bacteria | 3388 |
| 157 | Ga0307508_10109245 | 3300031616 | Bacteria | 2365 |
| 158 | Ga0307514_10112692 | 3300031649 | Bacteria | 1922 |
| 159 | Ga0316579_10000286 | 3300031691 | Bacteria | 15468 |
| 160 | Ga0316579_10003583 | 3300031691 | Bacteria | 6089 |
| 161 | Ga0316579_10045826 | 3300031691 | Bacteria | 2039 |
| 162 | Ga0316576_10163785 | 3300031727 | Bacteria | 1677 |
| 163 | Ga0316578_10000296 | 3300031728 | Bacteria | 15182 |
| 164 | Ga0307516_10005023 | 3300031730 | Bacteria | 16020 |
| 165 | Ga0307516_10064631 | 3300031730 | Bacteria | 3537 |
| 166 | Ga0307405_10038046 | 3300031731 | Bacteria | 2897 |
| 167 | Ga0316577_10015686 | 3300031733 | Bacteria | 4168 |
| 168 | Ga0307413_10114794 | 3300031824 | Bacteria | 1811 |
| 169 | Ga0307413_10163368 | 3300031824 | Bacteria | 1567 |
| 170 | Ga0307410_10010328 | 3300031852 | Bacteria | 5281 |
| 171 | Ga0307406_10041838 | 3300031901 | Bacteria | 2858 |
| 172 | Ga0307412_10007532 | 3300031911 | Bacteria | 6181 |
| 173 | Ga0307412_10038108 | 3300031911 | Bacteria | 3093 |
| 174 | Ga0307409_100045382 | 3300031995 | Bacteria | 3317 |
| 175 | Ga0307416_100076047 | 3300032002 | Bacteria | 2812 |
| 176 | Ga0307411_10018701 | 3300032005 | Bacteria | 3983 |
| 177 | Ga0307415_100047581 | 3300032126 | Bacteria | 2887 |
| 178 | Ga0316580_10018422 | 3300032139 | Bacteria | 2147 |
| 179 | Ga0307507_10079012 | 3300033179 | Bacteria | 2911 |
| 180 | Ga0307507_10175151 | 3300033179 | Bacteria | 1548 |
| 181 | Ga0307510_10090565 | 3300033180 | Bacteria | 2904 |
| 182 | Ga0307510_10160408 | 3300033180 | Bacteria | 1846 |
| 183 | Ga0373936_0014393 | 3300035113 | Bacteria | 3023 |
| 184 | Ga0316574_0001345 | 3300035398 | Bacteria | 11551 |
| 185 | Ga0316582_0006539 | 3300036647 | Bacteria | 6131 |
| 186 | Ga0316582_0154481 | 3300036647 | Bacteria | 1552 |
| 187 | Ga0316584_0001023 | 3300036712 | Bacteria | 16179 |
| 188 | Ga0316584_0013441 | 3300036712 | Bacteria | 5793 |
| 189 | Ga0316584_0100433 | 3300036712 | Bacteria | 2166 |
| 190 | Ga0395900_0044148 | 3300037418 | Bacteria | 4594 |
| 191 | Ga0395900_0136289 | 3300037418 | Bacteria | 2515 |
| 192 | Ga0395898_0018351 | 3300037466 | Bacteria | 7134 |
| 193 | Ga0395898_0040738 | 3300037466 | Bacteria | 4591 |
| 194 | Ga0395898_0085221 | 3300037466 | Bacteria | 3045 |
| 195 | Ga0395901_0010043 | 3300038443 | Bacteria | 9599 |
| 196 | Ga0395901_0238916 | 3300038443 | Bacteria | 1895 |
| 197 | Ga0395901_0364158 | 3300038443 | Bacteria | 1490 |
| 198 | Ga0395901_0395366 | 3300038443 | Bacteria | 1421 |
| 199 | Ga0439436_0001203 | 3300041404 | Bacteria | 7367 |
| 200 | Ga0439436_0002809 | 3300041404 | Bacteria | 5275 |
| 201 | Ga0439439_0002245 | 3300041406 | Bacteria | 4067 |
| 202 | Ga0451791_1406329 | 3300041451 | Bacteria | 3613 |
| 203 | Ga0451793_0205636 | 3300041452 | Bacteria | 7759 |
| 204 | Ga0451833_0143314 | 3300041491 | Bacteria | 2337 |
| 205 | Ga0451833_1442922 | 3300041491 | Bacteria | 1786 |
| 206 | Ga0451837_1058626 | 3300041494 | Bacteria | 3748 |
| 207 | Ga0451853_0754630 | 3300041512 | Bacteria | 9276 |
| 208 | Ga0451853_1416036 | 3300041512 | Bacteria | 10955 |
| 209 | Ga0451853_2303190 | 3300041512 | Bacteria | 2164 |
| 210 | Ga0439433_0003641 | 3300041999 | Bacteria | 3313 |
| 211 | Ga0439433_0018765 | 3300041999 | Bacteria | 1540 |
| 212 | Ga0439442_011497 | 3300042002 | Bacteria | 1803 |
| 213 | Ga0439449_0010872 | 3300042007 | Bacteria | 3434 |
| 214 | Ga0439457_000052 | 3300042014 | Bacteria | 24278 |
| 215 | Ga0439457_002335 | 3300042014 | Bacteria | 5446 |
| 216 | Ga0450896_001440 | 3300042133 | Bacteria | 2929 |
| 217 | Ga0450907_003281 | 3300042146 | Bacteria | 2912 |
| 218 | Ga0439458_0002720 | 3300042157 | Bacteria | 4269 |
| 219 | Ga0439434_0014214 | 3300042435 | Bacteria | 2368 |
| 220 | Ga0466969_0002369 | 3300044656 | Bacteria | 10068 |
| 221 | Ga0466969_0002452 | 3300044656 | Bacteria | 9893 |
| 222 | Ga0466969_0005241 | 3300044656 | Bacteria | 6904 |
| 223 | Ga0466969_0018674 | 3300044656 | Bacteria | 3611 |
| 224 | Ga0466972_0003319 | 3300044658 | Bacteria | 7982 |
| 225 | Ga0466972_0004438 | 3300044658 | Bacteria | 7020 |
| 226 | Ga0466965_0039253 | 3300044683 | Bacteria | 2327 |
| 227 | Ga0466965_0050664 | 3300044683 | Bacteria | 2059 |
| 228 | Ga0466966_0006809 | 3300044684 | Bacteria | 7571 |
| 229 | Ga0466966_0008350 | 3300044684 | Bacteria | 6858 |
| 230 | Ga0466966_0012689 | 3300044684 | Bacteria | 5584 |
| 231 | Ga0466966_0016942 | 3300044684 | Bacteria | 4816 |
| 232 | Ga0466961_0005077 | 3300044693 | Bacteria | 8281 |
| 233 | Ga0466961_0100988 | 3300044693 | Bacteria | 1817 |
| 234 | Ga0466963_0000753 | 3300044694 | Bacteria | 15986 |
| 235 | Ga0466963_0007911 | 3300044694 | Bacteria | 6365 |
| 236 | Ga0466963_0039086 | 3300044694 | Bacteria | 3106 |
| 237 | Ga0466964_0018125 | 3300044706 | Bacteria | 2700 |
| 238 | Ga0466971_0004497 | 3300044719 | Bacteria | 6027 |
| 239 | Ga0466968_0023255 | 3300044735 | Bacteria | 2523 |
| 240 | Ga0466970_0008541 | 3300044765 | Bacteria | 5157 |
| 241 | Ga0466970_0012045 | 3300044765 | Bacteria | 4417 |
| 242 | Ga0466970_0081680 | 3300044765 | Bacteria | 1748 |
| 243 | Ga0466970_0082195 | 3300044765 | Bacteria | 1742 |
| 244 | Ga0466957_0000165 | 3300044842 | Bacteria | 29339 |
| 245 | Ga0466960_0001275 | 3300044901 | Bacteria | 9124 |
| 246 | Ga0466960_0006570 | 3300044901 | Bacteria | 4671 |
| 247 | Ga0466960_0012735 | 3300044901 | Bacteria | 3557 |
| 248 | Ga0466960_0053877 | 3300044901 | Bacteria | 1951 |
| 249 | Ga0466959_0006874 | 3300045049 | Bacteria | 7936 |
| 250 | Ga0466959_0016752 | 3300045049 | Bacteria | 5362 |
| 251 | Ga0466959_0027946 | 3300045049 | Bacteria | 4183 |
| 252 | Ga0466958_0000098 | 3300045836 | Bacteria | 27382 |
| 253 | Ga0466967_0006167 | 3300045976 | Bacteria | 8442 |
| 254 | Ga0466967_0033099 | 3300045976 | Bacteria | 4374 |
| 255 | Ga0466967_0037284 | 3300045976 | Bacteria | 4159 |
| 256 | Ga0466967_0248352 | 3300045976 | Bacteria | 1699 |
| 257 | Ga0495592_0005778 | 3300046454 | Bacteria | 9163 |
| 258 | Ga0495603_0004116 | 3300046455 | Bacteria | 8663 |
| 259 | Ga0495603_0030505 | 3300046455 | Bacteria | 3246 |
| 260 | Ga0495603_0039657 | 3300046455 | Bacteria | 2820 |
| 261 | Ga0495603_0041543 | 3300046455 | Bacteria | 2749 |
| 262 | Ga0495629_0004750 | 3300046459 | Bacteria | 10179 |
| 263 | Ga0495629_0005303 | 3300046459 | Bacteria | 9637 |
| 264 | Ga0495629_0034097 | 3300046459 | Bacteria | 3598 |
| 265 | Ga0495629_0040023 | 3300046459 | Bacteria | 3297 |
| 266 | Ga0495629_0041692 | 3300046459 | Bacteria | 3229 |
| 267 | Ga0495629_0081575 | 3300046459 | Bacteria | 2257 |
| 268 | Ga0495629_0132331 | 3300046459 | Bacteria | 1737 |
| 269 | Ga0495651_0005250 | 3300046462 | Bacteria | 9874 |
| 270 | Ga0495651_0009752 | 3300046462 | Bacteria | 7385 |
| 271 | Ga0495653_0043581 | 3300046463 | Bacteria | 3488 |
| 272 | Ga0495580_0002444 | 3300046472 | Bacteria | 16239 |
| 273 | Ga0495605_0028157 | 3300046474 | Bacteria | 2902 |
| 274 | Ga0495662_0001039 | 3300046476 | Bacteria | 13621 |
| 275 | Ga0495662_0052450 | 3300046476 | Bacteria | 1969 |
| 276 | Ga0495662_0057908 | 3300046476 | Bacteria | 1871 |
| 277 | Ga0495664_0001036 | 3300046477 | Bacteria | 14362 |
| 278 | Ga0495585_0019748 | 3300046492 | Bacteria | 3882 |
| 279 | Ga0495594_0000431 | 3300046499 | Bacteria | 21108 |
| 280 | Ga0495583_0031329 | 3300046506 | Bacteria | 2579 |
| 281 | Ga0495606_0022079 | 3300046507 | Bacteria | 4648 |
| 282 | Ga0495608_0008080 | 3300046511 | Bacteria | 7395 |
| 283 | Ga0495608_0022878 | 3300046511 | Bacteria | 4288 |
| 284 | Ga0495618_0054771 | 3300046514 | Bacteria | 2525 |
| 285 | Ga0495620_0039489 | 3300046515 | Bacteria | 2084 |
| 286 | Ga0495620_0043445 | 3300046515 | Bacteria | 1957 |
| 287 | Ga0495628_0007220 | 3300046516 | Bacteria | 9619 |
| 288 | Ga0495628_0102418 | 3300046516 | Bacteria | 2209 |
| 289 | Ga0495628_0116549 | 3300046516 | Bacteria | 2051 |
| 290 | Ga0495643_0012404 | 3300046522 | Bacteria | 5141 |
| 291 | Ga0495644_0071724 | 3300046523 | Bacteria | 1302 |
| 292 | Ga0495648_0045970 | 3300046524 | Bacteria | 2710 |
| 293 | Ga0495648_0068080 | 3300046524 | Bacteria | 2079 |
| 294 | Ga0495666_0011364 | 3300046526 | Bacteria | 4442 |
| 295 | Ga0495640_0039932 | 3300046533 | Bacteria | 3289 |
| 296 | Ga0495640_0065158 | 3300046533 | Bacteria | 2461 |
| 297 | Ga0495640_0113755 | 3300046533 | Bacteria | 1765 |
| 298 | Ga0495586_0020579 | 3300046535 | Bacteria | 3513 |
| 299 | Ga0495586_0058122 | 3300046535 | Bacteria | 2100 |
| 300 | Ga0495587_0003636 | 3300046536 | Bacteria | 10264 |
| 301 | Ga0495609_0005469 | 3300046538 | Bacteria | 6660 |
| 302 | Ga0495597_0064171 | 3300046542 | Bacteria | 1595 |
| 303 | Ga0495645_0022410 | 3300046543 | Bacteria | 4570 |
| 304 | Ga0495645_0032112 | 3300046543 | Bacteria | 3829 |
| 305 | Ga0495645_0034991 | 3300046543 | Bacteria | 3662 |
| 306 | Ga0495645_0051174 | 3300046543 | Bacteria | 3006 |
| 307 | Ga0495633_0018919 | 3300046558 | Bacteria | 3487 |
| 308 | Ga0495668_0024990 | 3300046616 | Bacteria | 3395 |
| 309 | Ga0495668_0103271 | 3300046616 | Bacteria | 1559 |
| 310 | Ga0495634_0049588 | 3300046642 | Bacteria | 2822 |
| 311 | Ga0495611_0043560 | 3300046648 | Bacteria | 2006 |
| 312 | Ga0495611_0107991 | 3300046648 | Bacteria | 1294 |
| 313 | Ga0495625_0015369 | 3300046660 | Bacteria | 6065 |
| 314 | Ga0495625_0109307 | 3300046660 | Bacteria | 1891 |
| 315 | Ga0495635_0088206 | 3300046663 | Bacteria | 2122 |
| 316 | Ga0495661_0027102 | 3300046665 | Bacteria | 3681 |
| 317 | Ga0495588_0006044 | 3300046674 | Bacteria | 5431 |
| 318 | Ga0495588_0011493 | 3300046674 | Bacteria | 4157 |
| 319 | Ga0495588_0028760 | 3300046674 | Bacteria | 2784 |
| 320 | Ga0495588_0039848 | 3300046674 | Bacteria | 2394 |
| 321 | Ga0495657_0001822 | 3300046675 | Bacteria | 18224 |
| 322 | Ga0495657_0003523 | 3300046675 | Bacteria | 12761 |
| 323 | Ga0495657_0022374 | 3300046675 | Bacteria | 4529 |
| 324 | Ga0495657_0064656 | 3300046675 | Bacteria | 2408 |
| 325 | Ga0495646_0002307 | 3300046680 | Bacteria | 11674 |
| 326 | Ga0495613_0001140 | 3300046689 | Bacteria | 20239 |
| 327 | Ga0495613_0003810 | 3300046689 | Bacteria | 11302 |
| 328 | Ga0495613_0005753 | 3300046689 | Bacteria | 9286 |
| 329 | Ga0495613_0011933 | 3300046689 | Bacteria | 6458 |
| 330 | Ga0495613_0020323 | 3300046689 | Bacteria | 4950 |
| 331 | Ga0495613_0119670 | 3300046689 | Bacteria | 1891 |
| 332 | Ga0495613_0129003 | 3300046689 | Bacteria | 1811 |
| 333 | Ga0495624_0070985 | 3300046690 | Bacteria | 2167 |
| 334 | Ga0495624_0079913 | 3300046690 | Bacteria | 2027 |
| 335 | Ga0495670_0026856 | 3300046691 | Bacteria | 2850 |
| 336 | Ga0495671_0012751 | 3300046692 | Bacteria | 4580 |
| 337 | Ga0495649_0007740 | 3300046694 | Bacteria | 6521 |
| 338 | Ga0495649_0030071 | 3300046694 | Bacteria | 3000 |
| 339 | Ga0495589_0029972 | 3300046794 | Bacteria | 2741 |
| 340 | Ga0495589_0045833 | 3300046794 | Bacteria | 2171 |
| 341 | Ga0495600_0028610 | 3300046809 | Bacteria | 3605 |
| 342 | Ga0495600_0043238 | 3300046809 | Bacteria | 2937 |
| 343 | Ga0495581_0002446 | 3300047315 | Bacteria | 10500 |
| 344 | Ga0495581_0009234 | 3300047315 | Bacteria | 5704 |
| 345 | Ga0495604_0000570 | 3300047317 | Bacteria | 32433 |
| 346 | Ga0495636_0010565 | 3300047318 | Bacteria | 3647 |
| 347 | Ga0495636_0017890 | 3300047318 | Bacteria | 2840 |
| 348 | Ga0495676_0002124 | 3300047321 | Bacteria | 17506 |
| 349 | Ga0495676_0024116 | 3300047321 | Bacteria | 5270 |
| 350 | Ga0495676_0039694 | 3300047321 | Bacteria | 3894 |
| 351 | Ga0495676_0063681 | 3300047321 | Bacteria | 2872 |
| 352 | Ga0495680_0006173 | 3300047322 | Bacteria | 11175 |
| 353 | Ga0495687_011642 | 3300047443 | Bacteria | 4712 |
| 354 | Ga0495687_012263 | 3300047443 | Bacteria | 4540 |
| 355 | Ga0495675_0005337 | 3300047444 | Bacteria | 7830 |
| 356 | Ga0495675_0011384 | 3300047444 | Bacteria | 5584 |
| 357 | Ga0495675_0104326 | 3300047444 | Bacteria | 1772 |
| 358 | Ga0495685_008643 | 3300047447 | Bacteria | 3388 |
| 359 | Ga0495685_012465 | 3300047447 | Bacteria | 2880 |
| 360 | Ga0495685_016071 | 3300047447 | Bacteria | 2557 |
| 361 | Ga0495685_031689 | 3300047447 | Bacteria | 1816 |
| 362 | Ga0495685_032525 | 3300047447 | Bacteria | 1792 |
| 363 | Ga0495685_035452 | 3300047447 | Bacteria | 1714 |
| 364 | Ga0495681_0003534 | 3300047470 | Bacteria | 10869 |
| 365 | Ga0495684_0144766 | 3300047471 | Bacteria | 1780 |
| 366 | Ga0495686_0107323 | 3300047472 | Bacteria | 1678 |
| 367 | Ga0495593_0001398 | 3300047673 | Bacteria | 14116 |
| 368 | Ga0495593_0010809 | 3300047673 | Bacteria | 5262 |
| 369 | Ga0495593_0103339 | 3300047673 | Bacteria | 1460 |
| 370 | Ga0495602_0202830 | 3300048088 | Bacteria | 1512 |
| 371 | Ga0495614_0001262 | 3300048089 | Bacteria | 10873 |
| 372 | Ga0495614_0001455 | 3300048089 | Bacteria | 10234 |
| 373 | Ga0495614_0079185 | 3300048089 | Bacteria | 1422 |
| 374 | Ga0495626_0012119 | 3300048091 | Bacteria | 4533 |
| 375 | Ga0496100_0150770 | 3300048903 | Bacteria | 1658 |
| 376 | Ga0496100_0166702 | 3300048903 | Bacteria | 1583 |
| 377 | Ga0496101_0057138 | 3300048904 | Bacteria | 2822 |
| 378 | Ga0496102_0011636 | 3300048905 | Bacteria | 7594 |
| 379 | Ga0496102_0014468 | 3300048905 | Bacteria | 6856 |
| 380 | Ga0496102_0032073 | 3300048905 | Bacteria | 4718 |
| 381 | Ga0496102_0102248 | 3300048905 | Bacteria | 2664 |
| 382 | Ga0496103_0020422 | 3300048906 | Bacteria | 3978 |
| 383 | Ga0496104_0006307 | 3300048907 | Bacteria | 10430 |
| 384 | Ga0496104_0052956 | 3300048907 | Bacteria | 3834 |
| 385 | Ga0496104_0132808 | 3300048907 | Bacteria | 2391 |
| 386 | Ga0496105_0076211 | 3300048908 | Bacteria | 2769 |
| 387 | Ga0496106_0168709 | 3300048909 | Bacteria | 1734 |
| 388 | Ga0496108_0036895 | 3300048911 | Bacteria | 4069 |
| 389 | Ga0496108_0046614 | 3300048911 | Bacteria | 3621 |
| 390 | Ga0496108_0096175 | 3300048911 | Bacteria | 2522 |
| 391 | Ga0496108_0201686 | 3300048911 | Bacteria | 1726 |
| 392 | Ga0496109_0001632 | 3300048912 | Bacteria | 18743 |
| 393 | Ga0496109_0023868 | 3300048912 | Bacteria | 5430 |
| 394 | Ga0496109_0184497 | 3300048912 | Bacteria | 1960 |
| 395 | Ga0496109_0263232 | 3300048912 | Bacteria | 1624 |
| 396 | Ga0496110_0000651 | 3300048913 | Bacteria | 23688 |
| 397 | Ga0496110_0115879 | 3300048913 | Bacteria | 2412 |
| 398 | Ga0496111_0000163 | 3300048914 | Bacteria | 30013 |
| 399 | Ga0496112_0063204 | 3300048915 | Bacteria | 3651 |
| 400 | Ga0496112_0064240 | 3300048915 | Bacteria | 3622 |
| 401 | Ga0496113_0005546 | 3300048916 | Bacteria | 7883 |
| 402 | Ga0496114_0002234 | 3300048917 | Bacteria | 14757 |
| 403 | Ga0496114_0005759 | 3300048917 | Bacteria | 9729 |
| 404 | Ga0496114_0018921 | 3300048917 | Bacteria | 5578 |
| 405 | Ga0496114_0039074 | 3300048917 | Bacteria | 3927 |
| 406 | Ga0496114_0041155 | 3300048917 | Bacteria | 3829 |
| 407 | Ga0496114_0135708 | 3300048917 | Bacteria | 2127 |
| 408 | Ga0496114_0139281 | 3300048917 | Bacteria | 2100 |
| 409 | Ga0496114_0152621 | 3300048917 | Bacteria | 2004 |
| 410 | Ga0496114_0243767 | 3300048917 | Bacteria | 1581 |
| 411 | Ga0496115_0077813 | 3300048918 | Bacteria | 2698 |
| 412 | Ga0496115_0176461 | 3300048918 | Bacteria | 1767 |
| 413 | Ga0496126_0077704 | 3300048929 | Bacteria | 2942 |
| 414 | Ga0496126_0115627 | 3300048929 | Bacteria | 2332 |
| 415 | Ga0501031_0000156 | 3300049568 | Bacteria | 38816 |
| 416 | Ga0501031_0007531 | 3300049568 | Bacteria | 7092 |
| 417 | Ga0501031_0009350 | 3300049568 | Bacteria | 6372 |
| 418 | Ga0501031_0014297 | 3300049568 | Bacteria | 5162 |
| 419 | Ga0501031_0148467 | 3300049568 | Bacteria | 1532 |
| 420 | Ga0501032_0001239 | 3300049569 | Bacteria | 20482 |
| 421 | Ga0501032_0025536 | 3300049569 | Bacteria | 4072 |
| 422 | Ga0501032_0137800 | 3300049569 | Bacteria | 1608 |
| 423 | Ga0501033_0002504 | 3300049570 | Bacteria | 15567 |
| 424 | Ga0501033_0010769 | 3300049570 | Bacteria | 7012 |
| 425 | Ga0501033_0035903 | 3300049570 | Bacteria | 3715 |
| 426 | Ga0501033_0047540 | 3300049570 | Bacteria | 3190 |
| 427 | Ga0501033_0060116 | 3300049570 | Bacteria | 2804 |
| 428 | Ga0501034_0020900 | 3300049571 | Bacteria | 6682 |
| 429 | Ga0501034_0040056 | 3300049571 | Bacteria | 4744 |
| 430 | Ga0501034_0151943 | 3300049571 | Bacteria | 2291 |
| 431 | Ga0501036_0001565 | 3300049572 | Bacteria | 17677 |
| 432 | Ga0501036_0006697 | 3300049572 | Bacteria | 9365 |
| 433 | Ga0501036_0014835 | 3300049572 | Bacteria | 6499 |
| 434 | Ga0501036_0027966 | 3300049572 | Bacteria | 4767 |
| 435 | Ga0501036_0089965 | 3300049572 | Bacteria | 2593 |
| 436 | Ga0501037_0001404 | 3300049573 | Bacteria | 17665 |
| 437 | Ga0501037_0007220 | 3300049573 | Bacteria | 8118 |
| 438 | Ga0501037_0022824 | 3300049573 | Bacteria | 4626 |
| 439 | Ga0501037_0040004 | 3300049573 | Bacteria | 3450 |
| 440 | Ga0501037_0056013 | 3300049573 | Bacteria | 2881 |
| 441 | Ga0501038_0000759 | 3300049574 | Bacteria | 28718 |
| 442 | Ga0501038_0005500 | 3300049574 | Bacteria | 11760 |
| 443 | Ga0501038_0033630 | 3300049574 | Bacteria | 4515 |
| 444 | Ga0501038_0040129 | 3300049574 | Bacteria | 4091 |
| 445 | Ga0501038_0066724 | 3300049574 | Bacteria | 3063 |
| 446 | Ga0501038_0220572 | 3300049574 | Bacteria | 1513 |
| 447 | Ga0501039_0007615 | 3300049575 | Bacteria | 8272 |
| 448 | Ga0501039_0018712 | 3300049575 | Bacteria | 5316 |
| 449 | Ga0501039_0030825 | 3300049575 | Bacteria | 4135 |
| 450 | Ga0501039_0035639 | 3300049575 | Bacteria | 3840 |
| 451 | Ga0501039_0040960 | 3300049575 | Bacteria | 3576 |
| 452 | Ga0501039_0080671 | 3300049575 | Bacteria | 2532 |
| 453 | Ga0501040_0102619 | 3300049576 | Bacteria | 1996 |
| 454 | Ga0501041_0002636 | 3300049577 | Bacteria | 10229 |
| 455 | Ga0501041_0048720 | 3300049577 | Bacteria | 2581 |
| 456 | Ga0501042_0001495 | 3300049578 | Bacteria | 13805 |
| 457 | Ga0501042_0039624 | 3300049578 | Bacteria | 3349 |
| 458 | Ga0501043_0000624 | 3300049579 | Bacteria | 31242 |
| 459 | Ga0501043_0016151 | 3300049579 | Bacteria | 5854 |
| 460 | Ga0501043_0069284 | 3300049579 | Bacteria | 2770 |
| 461 | Ga0501043_0078026 | 3300049579 | Bacteria | 2602 |
| 462 | Ga0501043_0096957 | 3300049579 | Bacteria | 2318 |
| 463 | Ga0501046_0000631 | 3300049580 | Bacteria | 34597 |
| 464 | Ga0501046_0000920 | 3300049580 | Bacteria | 28874 |
| 465 | Ga0501046_0007616 | 3300049580 | Bacteria | 9499 |
| 466 | Ga0501046_0031704 | 3300049580 | Bacteria | 4282 |
| 467 | Ga0501046_0055119 | 3300049580 | Bacteria | 3126 |
| 468 | Ga0501046_0133426 | 3300049580 | Bacteria | 1882 |
| 469 | Ga0501047_0034015 | 3300049581 | Bacteria | 4920 |
| 470 | Ga0501047_0076786 | 3300049581 | Bacteria | 3214 |
| 471 | Ga0501048_0002943 | 3300049582 | Bacteria | 13019 |
| 472 | Ga0501048_0006530 | 3300049582 | Bacteria | 8865 |
| 473 | Ga0501048_0012120 | 3300049582 | Bacteria | 6424 |
| 474 | Ga0501048_0085034 | 3300049582 | Bacteria | 2231 |
| 475 | Ga0501067_0018587 | 3300049583 | Bacteria | 3847 |
| 476 | Ga0501068_0006582 | 3300049584 | Bacteria | 6410 |
| 477 | Ga0501069_0011639 | 3300049585 | Bacteria | 4664 |
| 478 | Ga0501069_0052190 | 3300049585 | Bacteria | 2277 |
| 479 | Ga0501070_0009017 | 3300049586 | Bacteria | 8440 |
| 480 | Ga0501070_0010359 | 3300049586 | Bacteria | 7880 |
| 481 | Ga0501070_0028564 | 3300049586 | Bacteria | 4678 |
| 482 | Ga0501071_0036560 | 3300049587 | Bacteria | 3503 |
| 483 | Ga0501071_0056139 | 3300049587 | Bacteria | 2844 |
| 484 | Ga0501072_0001887 | 3300049588 | Bacteria | 15611 |
| 485 | Ga0501072_0041382 | 3300049588 | Bacteria | 3619 |
| 486 | Ga0501072_0074093 | 3300049588 | Bacteria | 2692 |
| 487 | Ga0501072_0084608 | 3300049588 | Bacteria | 2515 |
| 488 | Ga0501072_0193991 | 3300049588 | Bacteria | 1620 |
| 489 | Ga0501073_0000422 | 3300049589 | Bacteria | 28939 |
| 490 | Ga0501073_0035097 | 3300049589 | Bacteria | 3565 |
| 491 | Ga0501074_0000674 | 3300049590 | Bacteria | 21318 |
| 492 | Ga0501074_0007013 | 3300049590 | Bacteria | 8134 |
| 493 | Ga0501074_0059395 | 3300049590 | Bacteria | 2755 |
| 494 | Ga0501075_0024325 | 3300049591 | Bacteria | 4439 |
| 495 | Ga0501076_0005878 | 3300049592 | Bacteria | 8850 |
| 496 | Ga0501079_0101469 | 3300049741 | Bacteria | 2231 |
| 497 | Ga0501080_0025172 | 3300049742 | Bacteria | 5523 |
| 498 | Ga0501080_0109627 | 3300049742 | Bacteria | 2559 |
| 499 | Ga0501081_0011385 | 3300049743 | Bacteria | 5822 |
| 500 | Ga0501081_0080793 | 3300049743 | Bacteria | 2276 |
| 501 | Ga0501083_0009150 | 3300049744 | Bacteria | 6997 |
| 502 | Ga0501035_0027681 | 3300049822 | Bacteria | 5181 |
| 503 | Ga0501035_0100940 | 3300049822 | Bacteria | 2533 |
| 504 | Ga0501035_0202727 | 3300049822 | Bacteria | 1700 |
| 505 | Ga0501044_0003731 | 3300049823 | Bacteria | 17108 |
| 506 | Ga0501044_0013107 | 3300049823 | Bacteria | 8975 |
| 507 | Ga0501044_0038403 | 3300049823 | Bacteria | 5000 |
| 508 | Ga0501044_0045128 | 3300049823 | Bacteria | 4569 |
| 509 | Ga0501044_0061479 | 3300049823 | Bacteria | 3842 |
| 510 | Ga0501044_0062611 | 3300049823 | Bacteria | 3802 |
| 511 | Ga0501044_0075689 | 3300049823 | Bacteria | 3417 |
| 512 | Ga0501044_0076210 | 3300049823 | Bacteria | 3405 |
| 513 | Ga0501044_0243157 | 3300049823 | Bacteria | 1743 |
| 514 | Ga0501044_0322330 | 3300049823 | Bacteria | 1469 |
| 515 | Ga0501045_0024744 | 3300049824 | Bacteria | 4312 |
| 516 | Ga0501045_0057388 | 3300049824 | Bacteria | 2849 |
| 517 | nmdc:mga00v17_30928_c1 | 3300050491 | Bacteria | 3153 |
| 518 | nmdc:mga00v17_8044_c1 | 3300050491 | Bacteria | 5659 |
| 519 | nmdc:mga00v17_94361_c2 | 3300050491 | Bacteria | 1464 |
| 520 | nmdc:mga0yw44_165044_c1 | 3300050492 | Bacteria | 1451 |
| 521 | nmdc:mga0yw44_19236_c1 | 3300050492 | Bacteria | 3761 |
| 522 | nmdc:mga0yw44_41809_c1 | 3300050492 | Bacteria | 2730 |
| 523 | nmdc:mga0yw44_72443_c1 | 3300050492 | Bacteria | 2141 |
| 524 | nmdc:mga0yw44_889_c1 | 3300050492 | Bacteria | 11260 |
| 525 | nmdc:mga06z11_7115_c1 | 3300050494 | Bacteria | 4592 |
| 526 | nmdc:mga04h51_2660_c1 | 3300050495 | Bacteria | 4256 |
| 527 | nmdc:mga07m45_20395_c1 | 3300050496 | Bacteria | 3600 |
| 528 | nmdc:mga07m45_40255_c1 | 3300050496 | Bacteria | 2615 |
| 529 | nmdc:mga05p37_14632_c1 | 3300050507 | Bacteria | 9426 |
| 530 | nmdc:mga05p37_6897_c1 | 3300050507 | Bacteria | 13390 |
| 531 | nmdc:mga09592_2052_c1 | 3300050508 | Bacteria | 16244 |
| 532 | nmdc:mga09592_3497_c1 | 3300050508 | Bacteria | 12680 |
| 533 | nmdc:mga0qj67_21466_c1 | 3300050509 | Bacteria | 4953 |
| 534 | nmdc:mga0qj67_9107_c1 | 3300050509 | Bacteria | 7366 |
| 535 | nmdc:mga06r32_2152_c1 | 3300050510 | Bacteria | 17619 |
| 536 | nmdc:mga06r32_657_c1 | 3300050510 | Bacteria | 30190 |
| 537 | Ga0495619_0014384 | 3300053085 | Bacteria | 4997 |
| 538 | Ga0495619_0023279 | 3300053085 | Bacteria | 3970 |
| 539 | Ga0500556_0000498 | 3300053104 | Bacteria | 27278 |
| 540 | Ga0500572_018800 | 3300053111 | Bacteria | 1795 |
| 541 | Ga0500593_000073 | 3300053117 | Bacteria | 37609 |
| 542 | Ga0500616_0002468 | 3300053153 | Bacteria | 15343 |
| 543 | Ga0500634_0050445 | 3300053161 | Bacteria | 2241 |
| 544 | Ga0501084_0002400 | 3300054114 | Bacteria | 15070 |
| 545 | Ga0501084_0049460 | 3300054114 | Bacteria | 3519 |
| 546 | Ga0501084_0054959 | 3300054114 | Bacteria | 3331 |
| 547 | Ga0501082_0028110 | 3300060353 | Bacteria | 4846 |
| 548 | Ga0501082_0209351 | 3300060353 | Bacteria | 1697 |
| 549 | Ga0466962_0000132 | 3300061719 | Bacteria | 30670 |
| 550 | Ga0466962_0007121 | 3300061719 | Bacteria | 5357 |
| 551 | Ga0530510_0119076 | 3300061734 | Bacteria | 1937 |
| 552 | 2644447324 | 2643221679 | Bacteria | 3839507 |
| 553 | 2515853467 | 2515154155 | Bacteria | 7985436 |
| 554 | 2547406085 | 2547132111 | Bacteria | 8013147 |
| 555 | 2554257524 | 2554235005 | Bacteria | 6457341 |
| 556 | 2585298466 | 2582581312 | Bacteria | 7308206 |
| 557 | 2585305769 | 2582581313 | Bacteria | 10042643 |
| 558 | 2585314553 | 2582581314 | Bacteria | 11452267 |
| 559 | 2616700356 | 2616644814 | Bacteria | 11555299 |
| 560 | 2616702148 | 2616644814 | Bacteria | 11555299 |
| 561 | 2616904202 | 2616644941 | Bacteria | 8510691 |
| 562 | 2643763141 | 2643221548 | Bacteria | 8053412 |
| 563 | 2643827091 | 2643221561 | Bacteria | 4984412 |
| 564 | 2643852023 | 2643221567 | Bacteria | 4163945 |
| 565 | 2643891100 | 2643221576 | Bacteria | 5214352 |
| 566 | 2643900154 | 2643221578 | Bacteria | 9213798 |
| 567 | 2643947908 | 2643221587 | Bacteria | 7586415 |
| 568 | 2643960156 | 2643221590 | Bacteria | 5214697 |
| 569 | 2644018196 | 2643221601 | Bacteria | 7493239 |
| 570 | 2644035105 | 2643221604 | Bacteria | 5014917 |
| 571 | 2644084480 | 2643221613 | Bacteria | 4622396 |
| 572 | 2644092350 | 2643221615 | Bacteria | 5487866 |
| 573 | 2644101219 | 2643221617 | Bacteria | 5139111 |
| 574 | 2644119375 | 2643221620 | Bacteria | 5134593 |
| 575 | 2644136544 | 2643221624 | Bacteria | 4384879 |
| 576 | 2644174234 | 2643221631 | Bacteria | 8168043 |
| 577 | 2644322153 | 2643221657 | Bacteria | 5490246 |
| 578 | 2644390654 | 2643221670 | Bacteria | 6497041 |
| 579 | 2644405622 | 2643221673 | Bacteria | 9196637 |
| 580 | 2644433774 | 2643221677 | Bacteria | 7584031 |
| 581 | 2644443085 | 2643221678 | Bacteria | 9540101 |
| 582 | 2644463989 | 2643221682 | Bacteria | 6743283 |
| 583 | 2644504288 | 2643221690 | Bacteria | 4654705 |
| 584 | 2644524185 | 2643221694 | Bacteria | 4392972 |
| 585 | 2644534444 | 2643221696 | Bacteria | 5431823 |
| 586 | 2644627103 | 2643221714 | Bacteria | 9015452 |
| 587 | 2644667097 | 2643221721 | Bacteria | 4486924 |
| 588 | 2644668284 | 2643221722 | Bacteria | 4247614 |
| 589 | 2676476242 | 2675903058 | Bacteria | 6822861 |
| 590 | 2729909446 | 2728369276 | Bacteria | 5610032 |
| 591 | 2731906329 | 2731639228 | Bacteria | 4187555 |
| 592 | 2738694421 | 2738541272 | Bacteria | 6848551 |
| 593 | 2738868856 | 2738541305 | Bacteria | 4910150 |
| 594 | 2739323897 | 2738543027 | Bacteria | 6409078 |
| 595 | 2739606812 | 2739367654 | Bacteria | 6049412 |
| 596 | 2760305300 | 2758568522 | Bacteria | 5953541 |
| 597 | 2760620892 | 2758568621 | Bacteria | 5967089 |
| 598 | 2774395494 | 2773857762 | Bacteria | 5971770 |
| 599 | 2784589026 | 2784132148 | Bacteria | 8627943 |
| 600 | 2785342821 | 2784746763 | Bacteria | 9783172 |
| 601 | 2785369982 | 2784746768 | Bacteria | 10036182 |
| 602 | 2804846350 | 2802429296 | Bacteria | 7227771 |
| 603 | 2808842476 | 2808606359 | Bacteria | 9866990 |
| 604 | 2808872181 | 2808606365 | Bacteria | 4301966 |
| 605 | 2808920982 | 2808606375 | Bacteria | 9466072 |
| 606 | 2809025677 | 2808606394 | Bacteria | 6248540 |
| 607 | 2809193671 | 2808606439 | Bacteria | 5952208 |
| 608 | 2809232629 | 2808606448 | Bacteria | 8656184 |
| 609 | 2810365967 | 2808606700 | Bacteria | 3482157 |
| 610 | 2811845747 | 2808606982 | Bacteria | 7791042 |
| 611 | 2812330266 | 2811994874 | Bacteria | 5367947 |
| 612 | 2812348400 | 2811994878 | Bacteria | 5992952 |
| 613 | 2812357625 | 2811994879 | Bacteria | 9313447 |
| 614 | 2812363224 | 2811994880 | Bacteria | 4147780 |
| 615 | 2812480145 | 2811994917 | Bacteria | 7761064 |
| 616 | 2816422170 | 2816332119 | Bacteria | 8120218 |
| 617 | 2819697309 | 2818991463 | Bacteria | 7948711 |
| 618 | 2819741603 | 2818991472 | Bacteria | 10089953 |
| 619 | 2827634073 | 2827628540 | Bacteria | 6858585 |
| 620 | 2835190844 | 2835188231 | Bacteria | 3476928 |
| 621 | 2837271804 | 2837268691 | Bacteria | 7850704 |
| 622 | 2839987377 | 2839986021 | Bacteria | 3685650 |
| 623 | 2852637297 | 2852635781 | Bacteria | 8251373 |
| 624 | 2856742563 | 2856741275 | Bacteria | 8096094 |
| 625 | 2857486169 | 2857481737 | Bacteria | 4761446 |
| 626 | 2862178944 | 2862178590 | Bacteria | 8583590 |
| 627 | 2862286080 | 2862281513 | Bacteria | 9621493 |
| 628 | 2862291389 | 2862290372 | Bacteria | 7471434 |
| 629 | 2862390462 | 2862382967 | Bacteria | 10317375 |
| 630 | 2862578835 | 2862574272 | Bacteria | 10567477 |
| 631 | 2863412710 | 2863404153 | Bacteria | 9672205 |
| 632 | 2867372470 | 2867369537 | Bacteria | 6501581 |
| 633 | 2867436428 | 2867428634 | Bacteria | 9590268 |
| 634 | 2867480430 | 2867475112 | Bacteria | 6909112 |
| 635 | 2868089949 | 2868088558 | Bacteria | 7609351 |
| 636 | 2873155323 | 2873151551 | Bacteria | 8625867 |
| 637 | 2875395176 | 2875391855 | Bacteria | 7600475 |
| 638 | 2877680645 | 2877676314 | Bacteria | 9512378 |
| 639 | 2883822341 | 2883821847 | Bacteria | 5121194 |
| 640 | 2884997538 | 2884994152 | Bacteria | 4492978 |
| 641 | 2887445199 | 2887443736 | Bacteria | 4426037 |
| 642 | 2891404150 | 2891395885 | Bacteria | 9251614 |
| 643 | 2891557232 | 2891554331 | Bacteria | 8812224 |
| 644 | 2891565058 | 2891562705 | Bacteria | 8039471 |
| 645 | 2891973865 | 2891968417 | Bacteria | 5821697 |
| 646 | 2905929976 | 2905926851 | Bacteria | 4423176 |
| 647 | 2912719360 | 2912715099 | Bacteria | 9460473 |
| 648 | 2912731426 | 2912723979 | Bacteria | 8557534 |
| 649 | 2918505148 | 2918501144 | Bacteria | 8668083 |
| 650 | 2919448574 | 2919446982 | Bacteria | 3994487 |
| 651 | 2919471860 | 2919468124 | Bacteria | 9133025 |
| 652 | 2932434060 | 2932431166 | Bacteria | 4215299 |
| 653 | 2935893626 | 2935890801 | Bacteria | 4593001 |
| 654 | 2946006374 | 2946003308 | Bacteria | 3857229 |
| 655 | 2946049479 | 2946045630 | Bacteria | 8527308 |
| 656 | 2946068231 | 2946064051 | Bacteria | 8957905 |
| 657 | 2946076366 | 2946072368 | Bacteria | 8999607 |
| 658 | 2947228692 | 2947224130 | Bacteria | 9938529 |
| 659 | 2954715776 | 2954711539 | Bacteria | 10867210 |
| 660 | 2954725713 | 2954721474 | Bacteria | 10456478 |
| 661 | 2954736087 | 2954731030 | Bacteria | 10243860 |
| 662 | 2954744667 | 2954740390 | Bacteria | 10229294 |
| 663 | 2954754947 | 2954749733 | Bacteria | 10366972 |
| 664 | 2966602107 | 2966598605 | Bacteria | 7676064 |
| 665 | 2966924527 | 2966921586 | Bacteria | 3092803 |
| 666 | 2990061623 | 2990059506 | Bacteria | 9321252 |
| 667 | 2995468739 | 2995463766 | Bacteria | 8577691 |
| 668 | 2997459035 | 2997451912 | Bacteria | 8492419 |
| 669 | 2997604669 | 2997600082 | Bacteria | 9896405 |
| 670 | 3001889909 | 3001889506 | Bacteria | 2975194 |
| 671 | 3006399589 | 3006393351 | Bacteria | 6615579 |
| 672 | 3006425746 | 3006425503 | Bacteria | 6491253 |
| 673 | 3006488476 | 3006486233 | Bacteria | 8157040 |
| 674 | 3006499407 | 3006493962 | Bacteria | 8825450 |
| 675 | 8004022992 | 8004021418 | Bacteria | 4313954 |
| 676 | 8004027201 | 8004025490 | Bacteria | 4327753 |
| 677 | 8008566818 | 8008558824 | Bacteria | 10610750 |
| 678 | 8023630516 | 8023623736 | Bacteria | 8593882 |
| 679 | 8025419892 | 8025413630 | Bacteria | 7014048 |
| 680 | 8025484246 | 8025478263 | Bacteria | 8209203 |
| 681 | 8025534435 | 8025530807 | Bacteria | 8495698 |
| 682 | 8047897583 | 8047893842 | Bacteria | 11723082 |
| 683 | 8048129619 | 8048127548 | Bacteria | 11053136 |
| 684 | 8048361287 | 8048356638 | Bacteria | 11044339 |
| 685 | 8048374570 | 8048369669 | Bacteria | 11666822 |
| 686 | 8048383652 | 8048379754 | Bacteria | 11877923 |
| 687 | 8048411529 | 8048406513 | Bacteria | 8936924 |
| 688 | 8054167443 | 8054160619 | Bacteria | 7783213 |
| 689 | 8056062490 | 8056060235 | Bacteria | 7259403 |
| 690 | 8056450059 | 8056447290 | Bacteria | 7680491 |
| 691 | 8056580224 | 8056579771 | Bacteria | 5840325 |
| 692 | 8056671979 | 8056667051 | Bacteria | 6953971 |
| 693 | 8056838043 | 8056829672 | Bacteria | 9045328 |
| 694 | JGI24739J22299_10002388 | |||
| 695 | JGI24737J22298_10004268 | |||
| 696 | JGI24735J21928_10005654 | |||
| 697 | JGI24738J21930_10008082 | |||
| 698 | rootH1_10005518 | |||
| 699 | Ga0006562J51391_1088201 | |||
| 700 | Ga0070682_100086148 | |||
| 701 | Ga0070668_100128044 | |||
| 702 | Ga0070667_100008551 | |||
| 703 | Ga0070709_10000675 | |||
| 704 | Ga0070709_10030491 | |||
| 705 | Ga0070714_100001941 | |||
| 706 | Ga0070714_100078099 | |||
| 707 | Ga0070713_100001726 | |||
| 708 | Ga0070713_100011371 | |||
| 709 | Ga0070710_10002007 | |||
| 710 | Ga0070711_100003590 | |||
| 711 | Ga0070711_100013350 | |||
| 712 | Ga0070708_100051406 | |||
| 713 | Ga0070678_100159324 | |||
| 714 | Ga0070678_100164766 | |||
| 715 | Ga0070706_100018922 | |||
| 716 | Ga0070706_100045763 | |||
| 717 | Ga0070707_100006972 | |||
| 718 | Ga0070707_100015458 | |||
| 719 | Ga0070707_100022987 | |||
| 720 | Ga0070707_100154290 | |||
| 721 | Ga0070707_100185440 | |||
| 722 | Ga0070698_100005345 | |||
| 723 | Ga0070698_100007299 | |||
| 724 | Ga0070698_100010980 | |||
| 725 | Ga0070699_100059959 | |||
| 726 | Ga0070679_100080310 | |||
| 727 | Ga0070697_100042540 | |||
| 728 | Ga0070697_100151059 | |||
| 729 | Ga0068857_100261891 | |||
| 730 | Ga0070702_100001993 | |||
| 731 | Ga0068860_100000504 | |||
| 732 | Ga0081455_10000154 | |||
| 733 | Ga0081455_10165806 | |||
| 734 | Ga0081538_10000861 | |||
| 735 | Ga0081538_10019546 | |||
| 736 | Ga0081540_1066115 | |||
| 737 | Ga0081539_10003926 | |||
| 738 | Ga0081539_10006850 | |||
| 739 | Ga0081539_10090901 | |||
| 740 | Ga0070717_10006155 | |||
| 741 | Ga0070717_10018383 | |||
| 742 | Ga0070717_10045053 | |||
| 743 | Ga0070717_10045845 | |||
| 744 | Ga0075365_10000512 | |||
| 745 | Ga0075365_10002626 | |||
| 746 | Ga0075365_10038168 | |||
| 747 | Ga0075365_10038195 | |||
| 748 | Ga0075365_10038490 | |||
| 749 | Ga0075365_10051272 | |||
| 750 | Ga0075365_10085358 | |||
| 751 | Ga0075365_10088725 | |||
| 752 | Ga0075368_10001405 | |||
| 753 | Ga0075368_10025802 | |||
| 754 | Ga0075363_100051503 | |||
| 755 | Ga0075364_10120809 | |||
| 756 | Ga0070715_10000215 | |||
| 757 | Ga0070715_10011770 | |||
| 758 | Ga0070716_100026457 | |||
| 759 | Ga0070716_100041128 | |||
| 760 | Ga0070712_100097577 | |||
| 761 | Ga0075362_10012311 | |||
| 762 | Ga0075367_10004145 | |||
| 763 | Ga0075367_10027615 | |||
| 764 | Ga0075370_10007138 | |||
| 765 | Ga0075370_10030784 | |||
| 766 | Ga0075370_10072873 | |||
| 767 | Ga0075428_100002034 | |||
| 768 | Ga0075428_100005268 | |||
| 769 | Ga0075428_100027499 | |||
| 770 | Ga0075430_100006047 | |||
| 771 | Ga0075430_100006628 | |||
| 772 | Ga0075431_100003219 | |||
| 773 | Ga0075431_100006037 | |||
| 774 | Ga0075431_100008698 | |||
| 775 | Ga0075431_100262845 | |||
| 776 | Ga0075429_100011712 | |||
| 777 | Ga0075429_100025562 | |||
| 778 | Ga0075429_100100630 | |||
| 779 | Ga0105251_10007858 | |||
| 780 | Ga0111539_10061836 | |||
| 781 | Ga0111539_10353181 | |||
| 782 | Ga0114129_10016830 | |||
| 783 | Ga0114129_10054408 | |||
| 784 | Ga0105239_10156362 | |||
| 785 | Ga0105239_10165577 | |||
| 786 | Ga0105246_10000301 | |||
| 787 | Ga0157370_10129883 | |||
| 788 | Ga0157369_10010651 | |||
| 789 | Ga0157369_10028880 | |||
| 790 | Ga0157372_10201752 | |||
| 791 | Ga0157375_10033075 | |||
| 792 | Ga0157375_10043714 | |||
| 793 | Ga0157375_10082515 | |||
| 794 | Ga0157380_10038706 | |||
| 795 | Ga0182008_10000809 | |||
| 796 | Ga0157379_10180217 | |||
| 797 | Ga0157379_10222488 | |||
| 798 | Ga0182007_10001310 | |||
| 799 | Ga0183367_1008 | |||
| 800 | Ga0163161_10025668 | |||
| 801 | Ga0209758_1006734 | |||
| 802 | Ga0207426_1003012 | |||
| 803 | Ga0207426_1006736 | |||
| 804 | Ga0207426_1011274 | |||
| 805 | Ga0207692_10002071 | |||
| 806 | Ga0207692_10007254 | |||
| 807 | Ga0207647_10002992 | |||
| 808 | Ga0207647_10041322 | |||
| 809 | Ga0207685_10003470 | |||
| 810 | Ga0207685_10003755 | |||
| 811 | Ga0207685_10014678 | |||
| 812 | Ga0207699_10001491 | |||
| 813 | Ga0207699_10060383 | |||
| 814 | Ga0207684_10009758 | |||
| 815 | Ga0207693_10002505 | |||
| 816 | Ga0207693_10045332 | |||
| 817 | Ga0207693_10186386 | |||
| 818 | Ga0207652_10106048 | |||
| 819 | Ga0207646_10010545 | |||
| 820 | Ga0207646_10195494 | |||
| 821 | Ga0207700_10000997 | |||
| 822 | Ga0207664_10001190 | |||
| 823 | Ga0207664_10011115 | |||
| 824 | Ga0207686_10017345 | |||
| 825 | Ga0207709_10032751 | |||
| 826 | Ga0207665_10000660 | |||
| 827 | Ga0207658_10033468 | |||
| 828 | Ga0207639_10068716 | |||
| 829 | Ga0207678_10115734 | |||
| 830 | Ga0207702_10076571 | |||
| 831 | Ga0207702_10149417 | |||
| 832 | Ga0207641_10311153 | |||
| 833 | Ga0207674_10047401 | |||
| 834 | Ga0268266_10329998 | |||
| 835 | Ga0268264_10000547 | |||
| 836 | Ga0307517_10010298 | |||
| 837 | Ga0307515_10006675 | |||
| 838 | Ga0307515_10046074 | |||
| 839 | Ga0307511_10043387 | |||
| 840 | Ga0307511_10068813 | |||
| 841 | Ga0307513_10000175 | |||
| 842 | Ga0307513_10001562 | |||
| 843 | Ga0307513_10156947 | |||
| 844 | Ga0307513_10201543 | |||
| 845 | Ga0307509_10087596 | |||
| 846 | Ga0307509_10106105 | |||
| 847 | Ga0307508_10008367 | |||
| 848 | Ga0307508_10012953 | |||
| 849 | Ga0307508_10059204 | |||
| 850 | Ga0307508_10109245 | |||
| 851 | Ga0307514_10112692 | |||
| 852 | Ga0316579_10000286 | |||
| 853 | Ga0316579_10003583 | |||
| 854 | Ga0316579_10045826 | |||
| 855 | Ga0316576_10163785 | |||
| 856 | Ga0316578_10000296 | |||
| 857 | Ga0307516_10005023 | |||
| 858 | Ga0307516_10064631 | |||
| 859 | Ga0307405_10038046 | |||
| 860 | Ga0316577_10015686 | |||
| 861 | Ga0307413_10114794 | |||
| 862 | Ga0307413_10163368 | |||
| 863 | Ga0307410_10010328 | |||
| 864 | Ga0307406_10041838 | |||
| 865 | Ga0307412_10007532 | |||
| 866 | Ga0307412_10038108 | |||
| 867 | Ga0307409_100045382 | |||
| 868 | Ga0307416_100076047 | |||
| 869 | Ga0307411_10018701 | |||
| 870 | Ga0307415_100047581 | |||
| 871 | Ga0316580_10018422 | |||
| 872 | Ga0307507_10079012 | |||
| 873 | Ga0307507_10175151 | |||
| 874 | Ga0307510_10090565 | |||
| 875 | Ga0307510_10160408 | |||
| 876 | Ga0373936_0014393 | |||
| 877 | Ga0316574_0001345 | |||
| 878 | Ga0316582_0006539 | |||
| 879 | Ga0316582_0154481 | |||
| 880 | Ga0316584_0001023 | |||
| 881 | Ga0316584_0013441 | |||
| 882 | Ga0316584_0100433 | |||
| 883 | Ga0395900_0044148 | |||
| 884 | Ga0395900_0136289 | |||
| 885 | Ga0395898_0018351 | |||
| 886 | Ga0395898_0040738 | |||
| 887 | Ga0395898_0085221 | |||
| 888 | Ga0395901_0010043 | |||
| 889 | Ga0395901_0238916 | |||
| 890 | Ga0395901_0364158 | |||
| 891 | Ga0395901_0395366 | |||
| 892 | Ga0439436_0001203 | |||
| 893 | Ga0439436_0002809 | |||
| 894 | Ga0439439_0002245 | |||
| 895 | Ga0451791_1406329 | |||
| 896 | Ga0451793_0205636 | |||
| 897 | Ga0451833_0143314 | |||
| 898 | Ga0451833_1442922 | |||
| 899 | Ga0451837_1058626 | |||
| 900 | Ga0451853_0754630 | |||
| 901 | Ga0451853_1416036 | |||
| 902 | Ga0451853_2303190 | |||
| 903 | Ga0439433_0003641 | |||
| 904 | Ga0439433_0018765 | |||
| 905 | Ga0439442_011497 | |||
| 906 | Ga0439449_0010872 | |||
| 907 | Ga0439457_000052 | |||
| 908 | Ga0439457_002335 | |||
| 909 | Ga0450896_001440 | |||
| 910 | Ga0450907_003281 | |||
| 911 | Ga0439458_0002720 | |||
| 912 | Ga0439434_0014214 | |||
| 913 | Ga0466969_0002369 | |||
| 914 | Ga0466969_0002452 | |||
| 915 | Ga0466969_0005241 | |||
| 916 | Ga0466969_0018674 | |||
| 917 | Ga0466972_0003319 | |||
| 918 | Ga0466972_0004438 | |||
| 919 | Ga0466965_0039253 | |||
| 920 | Ga0466965_0050664 | |||
| 921 | Ga0466966_0006809 | |||
| 922 | Ga0466966_0008350 | |||
| 923 | Ga0466966_0012689 | |||
| 924 | Ga0466966_0016942 | |||
| 925 | Ga0466961_0005077 | |||
| 926 | Ga0466961_0100988 | |||
| 927 | Ga0466963_0000753 | |||
| 928 | Ga0466963_0007911 | |||
| 929 | Ga0466963_0039086 | |||
| 930 | Ga0466964_0018125 | |||
| 931 | Ga0466971_0004497 | |||
| 932 | Ga0466968_0023255 | |||
| 933 | Ga0466970_0008541 | |||
| 934 | Ga0466970_0012045 | |||
| 935 | Ga0466970_0081680 | |||
| 936 | Ga0466970_0082195 | |||
| 937 | Ga0466957_0000165 | |||
| 938 | Ga0466960_0001275 | |||
| 939 | Ga0466960_0006570 | |||
| 940 | Ga0466960_0012735 | |||
| 941 | Ga0466960_0053877 | |||
| 942 | Ga0466959_0006874 | |||
| 943 | Ga0466959_0016752 | |||
| 944 | Ga0466959_0027946 | |||
| 945 | Ga0466958_0000098 | |||
| 946 | Ga0466967_0006167 | |||
| 947 | Ga0466967_0033099 | |||
| 948 | Ga0466967_0037284 | |||
| 949 | Ga0466967_0248352 | |||
| 950 | Ga0495592_0005778 | |||
| 951 | Ga0495603_0004116 | |||
| 952 | Ga0495603_0030505 | |||
| 953 | Ga0495603_0039657 | |||
| 954 | Ga0495603_0041543 | |||
| 955 | Ga0495629_0004750 | |||
| 956 | Ga0495629_0005303 | |||
| 957 | Ga0495629_0034097 | |||
| 958 | Ga0495629_0040023 | |||
| 959 | Ga0495629_0041692 | |||
| 960 | Ga0495629_0081575 | |||
| 961 | Ga0495629_0132331 | |||
| 962 | Ga0495651_0005250 | |||
| 963 | Ga0495651_0009752 | |||
| 964 | Ga0495653_0043581 | |||
| 965 | Ga0495580_0002444 | |||
| 966 | Ga0495605_0028157 | |||
| 967 | Ga0495662_0001039 | |||
| 968 | Ga0495662_0052450 | |||
| 969 | Ga0495662_0057908 | |||
| 970 | Ga0495664_0001036 | |||
| 971 | Ga0495585_0019748 | |||
| 972 | Ga0495594_0000431 | |||
| 973 | Ga0495583_0031329 | |||
| 974 | Ga0495606_0022079 | |||
| 975 | Ga0495608_0008080 | |||
| 976 | Ga0495608_0022878 | |||
| 977 | Ga0495618_0054771 | |||
| 978 | Ga0495620_0039489 | |||
| 979 | Ga0495620_0043445 | |||
| 980 | Ga0495628_0007220 | |||
| 981 | Ga0495628_0102418 | |||
| 982 | Ga0495628_0116549 | |||
| 983 | Ga0495643_0012404 | |||
| 984 | Ga0495644_0071724 | |||
| 985 | Ga0495648_0045970 | |||
| 986 | Ga0495648_0068080 | |||
| 987 | Ga0495666_0011364 | |||
| 988 | Ga0495640_0039932 | |||
| 989 | Ga0495640_0065158 | |||
| 990 | Ga0495640_0113755 | |||
| 991 | Ga0495586_0020579 | |||
| 992 | Ga0495586_0058122 | |||
| 993 | Ga0495587_0003636 | |||
| 994 | Ga0495609_0005469 | |||
| 995 | Ga0495597_0064171 | |||
| 996 | Ga0495645_0022410 | |||
| 997 | Ga0495645_0032112 | |||
| 998 | Ga0495645_0034991 | |||
| 999 | Ga0495645_0051174 | |||
| 1000 | Ga0495633_0018919 | |||
| 1001 | Ga0495668_0024990 | |||
| 1002 | Ga0495668_0103271 | |||
| 1003 | Ga0495634_0049588 | |||
| 1004 | Ga0495611_0043560 | |||
| 1005 | Ga0495611_0107991 | |||
| 1006 | Ga0495625_0015369 | |||
| 1007 | Ga0495625_0109307 | |||
| 1008 | Ga0495635_0088206 | |||
| 1009 | Ga0495661_0027102 | |||
| 1010 | Ga0495588_0006044 | |||
| 1011 | Ga0495588_0011493 | |||
| 1012 | Ga0495588_0028760 | |||
| 1013 | Ga0495588_0039848 | |||
| 1014 | Ga0495657_0001822 | |||
| 1015 | Ga0495657_0003523 | |||
| 1016 | Ga0495657_0022374 | |||
| 1017 | Ga0495657_0064656 | |||
| 1018 | Ga0495646_0002307 | |||
| 1019 | Ga0495613_0001140 | |||
| 1020 | Ga0495613_0003810 | |||
| 1021 | Ga0495613_0005753 | |||
| 1022 | Ga0495613_0011933 | |||
| 1023 | Ga0495613_0020323 | |||
| 1024 | Ga0495613_0119670 | |||
| 1025 | Ga0495613_0129003 | |||
| 1026 | Ga0495624_0070985 | |||
| 1027 | Ga0495624_0079913 | |||
| 1028 | Ga0495670_0026856 | |||
| 1029 | Ga0495671_0012751 | |||
| 1030 | Ga0495649_0007740 | |||
| 1031 | Ga0495649_0030071 | |||
| 1032 | Ga0495589_0029972 | |||
| 1033 | Ga0495589_0045833 | |||
| 1034 | Ga0495600_0028610 | |||
| 1035 | Ga0495600_0043238 | |||
| 1036 | Ga0495581_0002446 | |||
| 1037 | Ga0495581_0009234 | |||
| 1038 | Ga0495604_0000570 | |||
| 1039 | Ga0495636_0010565 | |||
| 1040 | Ga0495636_0017890 | |||
| 1041 | Ga0495676_0002124 | |||
| 1042 | Ga0495676_0024116 | |||
| 1043 | Ga0495676_0039694 | |||
| 1044 | Ga0495676_0063681 | |||
| 1045 | Ga0495680_0006173 | |||
| 1046 | Ga0495687_011642 | |||
| 1047 | Ga0495687_012263 | |||
| 1048 | Ga0495675_0005337 | |||
| 1049 | Ga0495675_0011384 | |||
| 1050 | Ga0495675_0104326 | |||
| 1051 | Ga0495685_008643 | |||
| 1052 | Ga0495685_012465 | |||
| 1053 | Ga0495685_016071 | |||
| 1054 | Ga0495685_031689 | |||
| 1055 | Ga0495685_032525 | |||
| 1056 | Ga0495685_035452 | |||
| 1057 | Ga0495681_0003534 | |||
| 1058 | Ga0495684_0144766 | |||
| 1059 | Ga0495686_0107323 | |||
| 1060 | Ga0495593_0001398 | |||
| 1061 | Ga0495593_0010809 | |||
| 1062 | Ga0495593_0103339 | |||
| 1063 | Ga0495602_0202830 | |||
| 1064 | Ga0495614_0001262 | |||
| 1065 | Ga0495614_0001455 | |||
| 1066 | Ga0495614_0079185 | |||
| 1067 | Ga0495626_0012119 | |||
| 1068 | Ga0496100_0150770 | |||
| 1069 | Ga0496100_0166702 | |||
| 1070 | Ga0496101_0057138 | |||
| 1071 | Ga0496102_0011636 | |||
| 1072 | Ga0496102_0014468 | |||
| 1073 | Ga0496102_0032073 | |||
| 1074 | Ga0496102_0102248 | |||
| 1075 | Ga0496103_0020422 | |||
| 1076 | Ga0496104_0006307 | |||
| 1077 | Ga0496104_0052956 | |||
| 1078 | Ga0496104_0132808 | |||
| 1079 | Ga0496105_0076211 | |||
| 1080 | Ga0496106_0168709 | |||
| 1081 | Ga0496108_0036895 | |||
| 1082 | Ga0496108_0046614 | |||
| 1083 | Ga0496108_0096175 | |||
| 1084 | Ga0496108_0201686 | |||
| 1085 | Ga0496109_0001632 | |||
| 1086 | Ga0496109_0023868 | |||
| 1087 | Ga0496109_0184497 | |||
| 1088 | Ga0496109_0263232 | |||
| 1089 | Ga0496110_0000651 | |||
| 1090 | Ga0496110_0115879 | |||
| 1091 | Ga0496111_0000163 | |||
| 1092 | Ga0496112_0063204 | |||
| 1093 | Ga0496112_0064240 | |||
| 1094 | Ga0496113_0005546 | |||
| 1095 | Ga0496114_0002234 | |||
| 1096 | Ga0496114_0005759 | |||
| 1097 | Ga0496114_0018921 | |||
| 1098 | Ga0496114_0039074 | |||
| 1099 | Ga0496114_0041155 | |||
| 1100 | Ga0496114_0135708 | |||
| 1101 | Ga0496114_0139281 | |||
| 1102 | Ga0496114_0152621 | |||
| 1103 | Ga0496114_0243767 | |||
| 1104 | Ga0496115_0077813 | |||
| 1105 | Ga0496115_0176461 | |||
| 1106 | Ga0496126_0077704 | |||
| 1107 | Ga0496126_0115627 | |||
| 1108 | Ga0501031_0000156 | |||
| 1109 | Ga0501031_0007531 | |||
| 1110 | Ga0501031_0009350 | |||
| 1111 | Ga0501031_0014297 | |||
| 1112 | Ga0501031_0148467 | |||
| 1113 | Ga0501032_0001239 | |||
| 1114 | Ga0501032_0025536 | |||
| 1115 | Ga0501032_0137800 | |||
| 1116 | Ga0501033_0002504 | |||
| 1117 | Ga0501033_0010769 | |||
| 1118 | Ga0501033_0035903 | |||
| 1119 | Ga0501033_0047540 | |||
| 1120 | Ga0501033_0060116 | |||
| 1121 | Ga0501034_0020900 | |||
| 1122 | Ga0501034_0040056 | |||
| 1123 | Ga0501034_0151943 | |||
| 1124 | Ga0501036_0001565 | |||
| 1125 | Ga0501036_0006697 | |||
| 1126 | Ga0501036_0014835 | |||
| 1127 | Ga0501036_0027966 | |||
| 1128 | Ga0501036_0089965 | |||
| 1129 | Ga0501037_0001404 | |||
| 1130 | Ga0501037_0007220 | |||
| 1131 | Ga0501037_0022824 | |||
| 1132 | Ga0501037_0040004 | |||
| 1133 | Ga0501037_0056013 | |||
| 1134 | Ga0501038_0000759 | |||
| 1135 | Ga0501038_0005500 | |||
| 1136 | Ga0501038_0033630 | |||
| 1137 | Ga0501038_0040129 | |||
| 1138 | Ga0501038_0066724 | |||
| 1139 | Ga0501038_0220572 | |||
| 1140 | Ga0501039_0007615 | |||
| 1141 | Ga0501039_0018712 | |||
| 1142 | Ga0501039_0030825 | |||
| 1143 | Ga0501039_0035639 | |||
| 1144 | Ga0501039_0040960 | |||
| 1145 | Ga0501039_0080671 | |||
| 1146 | Ga0501040_0102619 | |||
| 1147 | Ga0501041_0002636 | |||
| 1148 | Ga0501041_0048720 | |||
| 1149 | Ga0501042_0001495 | |||
| 1150 | Ga0501042_0039624 | |||
| 1151 | Ga0501043_0000624 | |||
| 1152 | Ga0501043_0016151 | |||
| 1153 | Ga0501043_0069284 | |||
| 1154 | Ga0501043_0078026 | |||
| 1155 | Ga0501043_0096957 | |||
| 1156 | Ga0501046_0000631 | |||
| 1157 | Ga0501046_0000920 | |||
| 1158 | Ga0501046_0007616 | |||
| 1159 | Ga0501046_0031704 | |||
| 1160 | Ga0501046_0055119 | |||
| 1161 | Ga0501046_0133426 | |||
| 1162 | Ga0501047_0034015 | |||
| 1163 | Ga0501047_0076786 | |||
| 1164 | Ga0501048_0002943 | |||
| 1165 | Ga0501048_0006530 | |||
| 1166 | Ga0501048_0012120 | |||
| 1167 | Ga0501048_0085034 | |||
| 1168 | Ga0501067_0018587 | |||
| 1169 | Ga0501068_0006582 | |||
| 1170 | Ga0501069_0011639 | |||
| 1171 | Ga0501069_0052190 | |||
| 1172 | Ga0501070_0009017 | |||
| 1173 | Ga0501070_0010359 | |||
| 1174 | Ga0501070_0028564 | |||
| 1175 | Ga0501071_0036560 | |||
| 1176 | Ga0501071_0056139 | |||
| 1177 | Ga0501072_0001887 | |||
| 1178 | Ga0501072_0041382 | |||
| 1179 | Ga0501072_0074093 | |||
| 1180 | Ga0501072_0084608 | |||
| 1181 | Ga0501072_0193991 | |||
| 1182 | Ga0501073_0000422 | |||
| 1183 | Ga0501073_0035097 | |||
| 1184 | Ga0501074_0000674 | |||
| 1185 | Ga0501074_0007013 | |||
| 1186 | Ga0501074_0059395 | |||
| 1187 | Ga0501075_0024325 | |||
| 1188 | Ga0501076_0005878 | |||
| 1189 | Ga0501079_0101469 | |||
| 1190 | Ga0501080_0025172 | |||
| 1191 | Ga0501080_0109627 | |||
| 1192 | Ga0501081_0011385 | |||
| 1193 | Ga0501081_0080793 | |||
| 1194 | Ga0501083_0009150 | |||
| 1195 | Ga0501035_0027681 | |||
| 1196 | Ga0501035_0100940 | |||
| 1197 | Ga0501035_0202727 | |||
| 1198 | Ga0501044_0003731 | |||
| 1199 | Ga0501044_0013107 | |||
| 1200 | Ga0501044_0038403 | |||
| 1201 | Ga0501044_0045128 | |||
| 1202 | Ga0501044_0061479 | |||
| 1203 | Ga0501044_0062611 | |||
| 1204 | Ga0501044_0075689 | |||
| 1205 | Ga0501044_0076210 | |||
| 1206 | Ga0501044_0243157 | |||
| 1207 | Ga0501044_0322330 | |||
| 1208 | Ga0501045_0024744 | |||
| 1209 | Ga0501045_0057388 | |||
| 1210 | nmdc:mga00v17_30928_c1 | |||
| 1211 | nmdc:mga00v17_8044_c1 | |||
| 1212 | nmdc:mga00v17_94361_c2 | |||
| 1213 | nmdc:mga0yw44_165044_c1 | |||
| 1214 | nmdc:mga0yw44_19236_c1 | |||
| 1215 | nmdc:mga0yw44_41809_c1 | |||
| 1216 | nmdc:mga0yw44_72443_c1 | |||
| 1217 | nmdc:mga0yw44_889_c1 | |||
| 1218 | nmdc:mga06z11_7115_c1 | |||
| 1219 | nmdc:mga04h51_2660_c1 | |||
| 1220 | nmdc:mga07m45_20395_c1 | |||
| 1221 | nmdc:mga07m45_40255_c1 | |||
| 1222 | nmdc:mga05p37_14632_c1 | |||
| 1223 | nmdc:mga05p37_6897_c1 | |||
| 1224 | nmdc:mga09592_2052_c1 | |||
| 1225 | nmdc:mga09592_3497_c1 | |||
| 1226 | nmdc:mga0qj67_21466_c1 | |||
| 1227 | nmdc:mga0qj67_9107_c1 | |||
| 1228 | nmdc:mga06r32_2152_c1 | |||
| 1229 | nmdc:mga06r32_657_c1 | |||
| 1230 | Ga0495619_0014384 | |||
| 1231 | Ga0495619_0023279 | |||
| 1232 | Ga0500556_0000498 | |||
| 1233 | Ga0500572_018800 | |||
| 1234 | Ga0500593_000073 | |||
| 1235 | Ga0500616_0002468 | |||
| 1236 | Ga0500634_0050445 | |||
| 1237 | Ga0501084_0002400 | |||
| 1238 | Ga0501084_0049460 | |||
| 1239 | Ga0501084_0054959 | |||
| 1240 | Ga0501082_0028110 | |||
| 1241 | Ga0501082_0209351 | |||
| 1242 | Ga0466962_0000132 | |||
| 1243 | Ga0466962_0007121 | |||
| 1244 | Ga0530510_0119076 | |||
| 1245 | 2644447324 | |||
| 1246 | 2515853467 | |||
| 1247 | 2547406085 | |||
| 1248 | 2554257524 | |||
| 1249 | 2585298466 | |||
| 1250 | 2585305769 | |||
| 1251 | 2585314553 | |||
| 1252 | 2616700356 | |||
| 1253 | 2616702148 | |||
| 1254 | 2616904202 | |||
| 1255 | 2643763141 | |||
| 1256 | 2643827091 | |||
| 1257 | 2643852023 | |||
| 1258 | 2643891100 | |||
| 1259 | 2643900154 | |||
| 1260 | 2643947908 | |||
| 1261 | 2643960156 | |||
| 1262 | 2644018196 | |||
| 1263 | 2644035105 | |||
| 1264 | 2644084480 | |||
| 1265 | 2644092350 | |||
| 1266 | 2644101219 | |||
| 1267 | 2644119375 | |||
| 1268 | 2644136544 | |||
| 1269 | 2644174234 | |||
| 1270 | 2644322153 | |||
| 1271 | 2644390654 | |||
| 1272 | 2644405622 | |||
| 1273 | 2644433774 | |||
| 1274 | 2644443085 | |||
| 1275 | 2644463989 | |||
| 1276 | 2644504288 | |||
| 1277 | 2644524185 | |||
| 1278 | 2644534444 | |||
| 1279 | 2644627103 | |||
| 1280 | 2644667097 | |||
| 1281 | 2644668284 | |||
| 1282 | 2676476242 | |||
| 1283 | 2729909446 | |||
| 1284 | 2731906329 | |||
| 1285 | 2738694421 | |||
| 1286 | 2738868856 | |||
| 1287 | 2739323897 | |||
| 1288 | 2739606812 | |||
| 1289 | 2760305300 | |||
| 1290 | 2760620892 | |||
| 1291 | 2774395494 | |||
| 1292 | 2784589026 | |||
| 1293 | 2785342821 | |||
| 1294 | 2785369982 | |||
| 1295 | 2804846350 | |||
| 1296 | 2808842476 | |||
| 1297 | 2808872181 | |||
| 1298 | 2808920982 | |||
| 1299 | 2809025677 | |||
| 1300 | 2809193671 | |||
| 1301 | 2809232629 | |||
| 1302 | 2810365967 | |||
| 1303 | 2811845747 | |||
| 1304 | 2812330266 | |||
| 1305 | 2812348400 | |||
| 1306 | 2812357625 | |||
| 1307 | 2812363224 | |||
| 1308 | 2812480145 | |||
| 1309 | 2816422170 | |||
| 1310 | 2819697309 | |||
| 1311 | 2819741603 | |||
| 1312 | 2827634073 | |||
| 1313 | 2835190844 | |||
| 1314 | 2837271804 | |||
| 1315 | 2839987377 | |||
| 1316 | 2852637297 | |||
| 1317 | 2856742563 | |||
| 1318 | 2857486169 | |||
| 1319 | 2862178944 | |||
| 1320 | 2862286080 | |||
| 1321 | 2862291389 | |||
| 1322 | 2862390462 | |||
| 1323 | 2862578835 | |||
| 1324 | 2863412710 | |||
| 1325 | 2867372470 | |||
| 1326 | 2867436428 | |||
| 1327 | 2867480430 | |||
| 1328 | 2868089949 | |||
| 1329 | 2873155323 | |||
| 1330 | 2875395176 | |||
| 1331 | 2877680645 | |||
| 1332 | 2883822341 | |||
| 1333 | 2884997538 | |||
| 1334 | 2887445199 | |||
| 1335 | 2891404150 | |||
| 1336 | 2891557232 | |||
| 1337 | 2891565058 | |||
| 1338 | 2891973865 | |||
| 1339 | 2905929976 | |||
| 1340 | 2912719360 | |||
| 1341 | 2912731426 | |||
| 1342 | 2918505148 | |||
| 1343 | 2919448574 | |||
| 1344 | 2919471860 | |||
| 1345 | 2932434060 | |||
| 1346 | 2935893626 | |||
| 1347 | 2946006374 | |||
| 1348 | 2946049479 | |||
| 1349 | 2946068231 | |||
| 1350 | 2946076366 | |||
| 1351 | 2947228692 | |||
| 1352 | 2954715776 | |||
| 1353 | 2954725713 | |||
| 1354 | 2954736087 | |||
| 1355 | 2954744667 | |||
| 1356 | 2954754947 | |||
| 1357 | 2966602107 | |||
| 1358 | 2966924527 | |||
| 1359 | 2990061623 | |||
| 1360 | 2995468739 | |||
| 1361 | 2997459035 | |||
| 1362 | 2997604669 | |||
| 1363 | 3001889909 | |||
| 1364 | 3006399589 | |||
| 1365 | 3006425746 | |||
| 1366 | 3006488476 | |||
| 1367 | 3006499407 | |||
| 1368 | 8004022992 | |||
| 1369 | 8004027201 | |||
| 1370 | 8008566818 | |||
| 1371 | 8023630516 | |||
| 1372 | 8025419892 | |||
| 1373 | 8025484246 | |||
| 1374 | 8025534435 | |||
| 1375 | 8047897583 | |||
| 1376 | 8048129619 | |||
| 1377 | 8048361287 | |||
| 1378 | 8048374570 | |||
| 1379 | 8048383652 | |||
| 1380 | 8048411529 | |||
| 1381 | 8054167443 | |||
| 1382 | 8056062490 | |||
| 1383 | 8056450059 | |||
| 1384 | 8056580224 | |||
| 1385 | 8056671979 | |||
| 1386 | 8056838043 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7php-assembly1.cif.gz_A | structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em | 0.8976 | 3 | 404 |
| 7dqk-assembly1.cif.gz_A | a nicotine mate transporter, nicotiana tabacum mate2 (ntmate2) | 0.8948 | 4 | 403 |
| 6z70-assembly1.cif.gz_A | structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state | 0.8924 | 4 | 399 |
| 4mlb-assembly1.cif.gz_C | reverse polarity of binding pocket suggests different function of a mop superfamily transporter from pyrococcus furiosus vc1 (dsm3638) | 0.8799 | 2 | 399 |
| 7php-assembly1.cif.gz_A | structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em | 0.8788 | 3 | 404 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71616_19_179_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9802 | 15 | 171 | 1.20.1250.20 |
| af_Q4DPE2_262_423_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.955 | 15 | 170 | 1.10.1760.20 |
| af_I1LJ83_112_274_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9543 | 15 | 170 | 1.20.1250.20 |
| af_U3Q0C3_281_442_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9515 | 15 | 163 | 1.20.1250.20 |
| af_Q86VL8_297_458_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9504 | 15 | 165 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6C9EEC3-F1-model_v4 | MATE family efflux transporter | 0.9766 | 5 | 256 |
GO:0005886
GO:0015297 GO:0042910 |
| AF-A0A6N9Y0U4-F1-model_v4 | deleted | 0.9661 | 17 | 251 |
|
| AF-A0A7K2EE20-F1-model_v4 | MATE family efflux transporter | 0.9654 | 5 | 253 |
GO:0005886
GO:0015297 GO:0042910 |
| AF-A0A382LGR4-F1-model_v4 | Polysaccharide biosynthesis protein C-terminal domain-containing protein | 0.9621 | 27 | 224 |
GO:0005886
GO:0015297 GO:0042910 |
| AF-A0A3M1DXV0-F1-model_v4 | MATE family efflux transporter | 0.9613 | 2 | 208 |
GO:0005886
GO:0015297 GO:0042910 |