F475689

General Info

Members Datasets Scaffolds Average Seq Length
693 410 1386 434

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221679|2644447324
Length 499
Sequence GPVHSPGEKVWTTLLTTAHSLWSPLWTTTAPGPVSCSRPATMPCTRCGQKKVLEDLAIDQPPVRHPDATSREVLRLAVPAFLALVAEPAFLLADSAIVGRLGTVPLAGLGVASAALSTAAGIFIFLAYGTTASVSRRAGAGDARAAFGLGVDGVWLALVLGVASGALLLAAAPWVAGAFDASGAATAQAVTYLRVSAFGVPGMLTVLAATGVLRGLQDTRTPLAVAVAGFSLNIVLNVVFVFGLGLGIAGSALGTVVAQTLMGTALVAVVVRGGRRHGASLRAHPLRVLAAARDGVPLLVRTLALRAVLLLTTWAAASGGDVTLASYQVSATVWTFLVFALDALAIAAQALTGHALGAGDVARARALTALMLRWGVVGGAVFGAVVVLLHRVLPPLFTADAGVRASLAGALIVVGLQQPLSGYVFVLDGVLIGAGDGRWLARAALAQLVVYVPVVLAVRAGAGSASALWWGFGVFMLVRGALLGWRARGPQWAVVGASR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
122 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
126 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
262 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
263 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2643221679 Angustibacter sp. Root456 Isolate Unclassified
271 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
272 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
273 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
274 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
275 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
276 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
277 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
278 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
279 2643221548 Streptomyces sp. Root55 Isolate Unclassified
280 2643221561 Nocardioides sp. Root151 Isolate Unclassified
281 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
282 2643221576 Nocardioides sp. Root614 Isolate Unclassified
283 2643221578 Streptomyces sp. Root63 Isolate Unclassified
284 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
285 2643221590 Nocardioides sp. Root682 Isolate Unclassified
286 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
287 2643221604 Nocardioides sp. Root190 Isolate Unclassified
288 2643221613 Oerskovia sp. Root22 Isolate Unclassified
289 2643221615 Nocardioides sp. Root224 Isolate Unclassified
290 2643221617 Nocardioides sp. Root79 Isolate Unclassified
291 2643221620 Nocardioides sp. Root240 Isolate Unclassified
292 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
293 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
294 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
295 2643221670 Streptomyces sp. Root431 Isolate Unclassified
296 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
297 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
298 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
299 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
300 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
301 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
302 2643221696 Nocardioides sp. Root140 Isolate Unclassified
303 2643221714 Streptomyces sp. Root264 Isolate Unclassified
304 2643221721 Oerskovia sp. Root918 Isolate Unclassified
305 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
306 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
307 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
308 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
309 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
310 2738541305 Nocardioides sp. CF167 Isolate Unclassified
311 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
312 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
313 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
314 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
315 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
316 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
317 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
318 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
319 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
320 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
321 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
322 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
323 2808606394 Promicromonospora sp. C35 Isolate Unclassified
324 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
325 2808606448 Streptomyces sp. 193411 Isolate Unclassified
326 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
327 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
328 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
329 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
330 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
331 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
332 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
333 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
334 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
335 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
336 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
337 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
338 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
339 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
340 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
341 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
342 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
343 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
344 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
345 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
346 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
347 2862574272 Streptomyces sp. AcE210 Isolate Nodule
348 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
349 2867369537 Streptomyces sp. Z26 Isolate Unclassified
350 2867428634 Streptomyces sp. RP5T Isolate Unclassified
351 2867475112 Streptomyces sp. TM32 Isolate Unclassified
352 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
353 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
354 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
355 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
356 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
357 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
358 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
359 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
360 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
361 2891562705 Microbispora tritici MT50 Isolate Unclassified
362 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
363 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
364 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
365 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
366 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
367 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
368 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
369 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
370 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
371 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
372 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
373 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
374 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
375 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
376 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
377 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
378 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
379 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
380 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
381 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
382 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
383 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
384 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
385 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
386 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
387 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
388 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
389 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
390 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
391 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
392 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
393 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
394 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
395 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
396 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
397 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
398 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
399 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
400 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
401 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
402 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
403 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
404 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
405 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
406 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
407 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
408 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
409 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
410 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.37
Metatranscriptomes 0.14
Isolates 20.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 0.43
Rhizoplane 5.92
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002388 3300001989 Bacteria 7243
2 JGI24737J22298_10004268 3300001990 Bacteria 4992
3 JGI24735J21928_10005654 3300002067 Bacteria 4135
4 JGI24738J21930_10008082 3300002075 Bacteria 2402
5 rootH1_10005518 3300003316 Bacteria 3371
6 Ga0006562J51391_1088201 3300003578 Bacteria 1580
7 Ga0070682_100086148 3300005337 Bacteria 2045
8 Ga0070668_100128044 3300005347 Bacteria 2035
9 Ga0070667_100008551 3300005367 Bacteria 8485
10 Ga0070709_10000675 3300005434 Bacteria 19453
11 Ga0070709_10030491 3300005434 Bacteria 3237
12 Ga0070714_100001941 3300005435 Bacteria 15103
13 Ga0070714_100078099 3300005435 Bacteria 2876
14 Ga0070713_100001726 3300005436 Bacteria 14076
15 Ga0070713_100011371 3300005436 Bacteria 6480
16 Ga0070710_10002007 3300005437 Bacteria 9628
17 Ga0070711_100003590 3300005439 Bacteria 9050
18 Ga0070711_100013350 3300005439 Bacteria 5158
19 Ga0070708_100051406 3300005445 Bacteria 3652
20 Ga0070678_100159324 3300005456 Bacteria 1827
21 Ga0070678_100164766 3300005456 Bacteria 1800
22 Ga0070706_100018922 3300005467 Bacteria 6352
23 Ga0070706_100045763 3300005467 Bacteria 4040
24 Ga0070707_100006972 3300005468 Bacteria 10472
25 Ga0070707_100015458 3300005468 Bacteria 7162
26 Ga0070707_100022987 3300005468 Bacteria 5896
27 Ga0070707_100154290 3300005468 Bacteria 2237
28 Ga0070707_100185440 3300005468 Bacteria 2029
29 Ga0070698_100005345 3300005471 Bacteria 14049
30 Ga0070698_100007299 3300005471 Bacteria 11966
31 Ga0070698_100010980 3300005471 Bacteria 9637
32 Ga0070699_100059959 3300005518 Bacteria 3296
33 Ga0070679_100080310 3300005530 Bacteria 3250
34 Ga0070697_100042540 3300005536 Bacteria 3677
35 Ga0070697_100151059 3300005536 Bacteria 1958
36 Ga0068857_100261891 3300005577 Bacteria 1587
37 Ga0070702_100001993 3300005615 Bacteria 8607
38 Ga0068860_100000504 3300005843 Bacteria 48482
39 Ga0081455_10000154 3300005937 Bacteria 82712
40 Ga0081455_10165806 3300005937 Bacteria 1688
41 Ga0081538_10000861 3300005981 Bacteria 32719
42 Ga0081538_10019546 3300005981 Bacteria 5027
43 Ga0081540_1066115 3300005983 Bacteria 1696
44 Ga0081539_10003926 3300005985 Bacteria 17262
45 Ga0081539_10006850 3300005985 Bacteria 10654
46 Ga0081539_10090901 3300005985 Bacteria 1578
47 Ga0070717_10006155 3300006028 Bacteria 8812
48 Ga0070717_10018383 3300006028 Bacteria 5455
49 Ga0070717_10045053 3300006028 Bacteria 3605
50 Ga0070717_10045845 3300006028 Bacteria 3575
51 Ga0075365_10000512 3300006038 Bacteria 14786
52 Ga0075365_10002626 3300006038 Bacteria 8904
53 Ga0075365_10038168 3300006038 Bacteria 3120
54 Ga0075365_10038195 3300006038 Bacteria 3119
55 Ga0075365_10038490 3300006038 Bacteria 3109
56 Ga0075365_10051272 3300006038 Bacteria 2725
57 Ga0075365_10085358 3300006038 Bacteria 2144
58 Ga0075365_10088725 3300006038 Bacteria 2104
59 Ga0075368_10001405 3300006042 Bacteria 7692
60 Ga0075368_10025802 3300006042 Bacteria 2255
61 Ga0075363_100051503 3300006048 Bacteria 2196
62 Ga0075364_10120809 3300006051 Bacteria 1753
63 Ga0070715_10000215 3300006163 Bacteria 13666
64 Ga0070715_10011770 3300006163 Bacteria 3160
65 Ga0070716_100026457 3300006173 Bacteria 3107
66 Ga0070716_100041128 3300006173 Bacteria 2574
67 Ga0070712_100097577 3300006175 Bacteria 2166
68 Ga0075362_10012311 3300006177 Bacteria 3395
69 Ga0075367_10004145 3300006178 Bacteria 7033
70 Ga0075367_10027615 3300006178 Bacteria 3231
71 Ga0075370_10007138 3300006353 Bacteria 5671
72 Ga0075370_10030784 3300006353 Bacteria 2995
73 Ga0075370_10072873 3300006353 Bacteria 1966
74 Ga0075428_100002034 3300006844 Bacteria 21796
75 Ga0075428_100005268 3300006844 Bacteria 14385
76 Ga0075428_100027499 3300006844 Bacteria 6292
77 Ga0075430_100006047 3300006846 Bacteria 10207
78 Ga0075430_100006628 3300006846 Bacteria 9762
79 Ga0075431_100003219 3300006847 Bacteria 15801
80 Ga0075431_100006037 3300006847 Bacteria 12011
81 Ga0075431_100008698 3300006847 Bacteria 10172
82 Ga0075431_100262845 3300006847 Bacteria 1751
83 Ga0075429_100011712 3300006880 Bacteria 7607
84 Ga0075429_100025562 3300006880 Bacteria 5125
85 Ga0075429_100100630 3300006880 Bacteria 2523
86 Ga0105251_10007858 3300009011 Bacteria 6488
87 Ga0111539_10061836 3300009094 Bacteria 4435
88 Ga0111539_10353181 3300009094 Bacteria 1711
89 Ga0114129_10016830 3300009147 Bacteria 10409
90 Ga0114129_10054408 3300009147 Bacteria 5611
91 Ga0105239_10156362 3300010375 Bacteria 2546
92 Ga0105239_10165577 3300010375 Bacteria 2472
93 Ga0105246_10000301 3300011119 Bacteria 26083
94 Ga0157370_10129883 3300013104 Bacteria 2350
95 Ga0157369_10010651 3300013105 Bacteria 10468
96 Ga0157369_10028880 3300013105 Bacteria 6135
97 Ga0157372_10201752 3300013307 Bacteria 2304
98 Ga0157375_10033075 3300013308 Bacteria 4910
99 Ga0157375_10043714 3300013308 Bacteria 4347
100 Ga0157375_10082515 3300013308 Bacteria 3257
101 Ga0157380_10038706 3300014326 Bacteria 3704
102 Ga0182008_10000809 3300014497 Bacteria 21867
103 Ga0157379_10180217 3300014968 Bacteria 1909
104 Ga0157379_10222488 3300014968 Bacteria 1710
105 Ga0182007_10001310 3300015262 Bacteria 13457
106 Ga0183367_1008 3300015688 Bacteria 490626
107 Ga0163161_10025668 3300017792 Bacteria 4172
108 Ga0209758_1006734 3300025297 Bacteria 8093
109 Ga0207426_1003012 3300025302 Bacteria 9782
110 Ga0207426_1006736 3300025302 Bacteria 4923
111 Ga0207426_1011274 3300025302 Bacteria 3415
112 Ga0207692_10002071 3300025898 Bacteria 7664
113 Ga0207692_10007254 3300025898 Bacteria 4533
114 Ga0207647_10002992 3300025904 Bacteria 12717
115 Ga0207647_10041322 3300025904 Bacteria 2900
116 Ga0207685_10003470 3300025905 Bacteria 3841
117 Ga0207685_10003755 3300025905 Bacteria 3747
118 Ga0207685_10014678 3300025905 Bacteria 2458
119 Ga0207699_10001491 3300025906 Bacteria 11123
120 Ga0207699_10060383 3300025906 Bacteria 2276
121 Ga0207684_10009758 3300025910 Bacteria 8466
122 Ga0207693_10002505 3300025915 Bacteria 15969
123 Ga0207693_10045332 3300025915 Bacteria 3455
124 Ga0207693_10186386 3300025915 Bacteria 1633
125 Ga0207652_10106048 3300025921 Bacteria 2487
126 Ga0207646_10010545 3300025922 Bacteria 9019
127 Ga0207646_10195494 3300025922 Bacteria 1827
128 Ga0207700_10000997 3300025928 Bacteria 16322
129 Ga0207664_10001190 3300025929 Bacteria 17302
130 Ga0207664_10011115 3300025929 Bacteria 6378
131 Ga0207686_10017345 3300025934 Bacteria 4056
132 Ga0207709_10032751 3300025935 Bacteria 3046
133 Ga0207665_10000660 3300025939 Bacteria 23254
134 Ga0207658_10033468 3300025986 Bacteria 3667
135 Ga0207639_10068716 3300026041 Bacteria 2762
136 Ga0207678_10115734 3300026067 Bacteria 2287
137 Ga0207702_10076571 3300026078 Bacteria 2892
138 Ga0207702_10149417 3300026078 Bacteria 2124
139 Ga0207641_10311153 3300026088 Bacteria 1491
140 Ga0207674_10047401 3300026116 Bacteria 4406
141 Ga0268266_10329998 3300028379 Bacteria 1430
142 Ga0268264_10000547 3300028381 Bacteria 47223
143 Ga0307517_10010298 3300028786 Bacteria 13101
144 Ga0307515_10006675 3300028794 Bacteria 22994
145 Ga0307515_10046074 3300028794 Bacteria 6678
146 Ga0307511_10043387 3300030521 Bacteria 3760
147 Ga0307511_10068813 3300030521 Bacteria 2610
148 Ga0307513_10000175 3300031456 Bacteria 92151
149 Ga0307513_10001562 3300031456 Bacteria 32853
150 Ga0307513_10156947 3300031456 Bacteria 2174
151 Ga0307513_10201543 3300031456 Bacteria 1830
152 Ga0307509_10087596 3300031507 Bacteria 3198
153 Ga0307509_10106105 3300031507 Bacteria 2829
154 Ga0307508_10008367 3300031616 Bacteria 9560
155 Ga0307508_10012953 3300031616 Bacteria 7625
156 Ga0307508_10059204 3300031616 Bacteria 3388
157 Ga0307508_10109245 3300031616 Bacteria 2365
158 Ga0307514_10112692 3300031649 Bacteria 1922
159 Ga0316579_10000286 3300031691 Bacteria 15468
160 Ga0316579_10003583 3300031691 Bacteria 6089
161 Ga0316579_10045826 3300031691 Bacteria 2039
162 Ga0316576_10163785 3300031727 Bacteria 1677
163 Ga0316578_10000296 3300031728 Bacteria 15182
164 Ga0307516_10005023 3300031730 Bacteria 16020
165 Ga0307516_10064631 3300031730 Bacteria 3537
166 Ga0307405_10038046 3300031731 Bacteria 2897
167 Ga0316577_10015686 3300031733 Bacteria 4168
168 Ga0307413_10114794 3300031824 Bacteria 1811
169 Ga0307413_10163368 3300031824 Bacteria 1567
170 Ga0307410_10010328 3300031852 Bacteria 5281
171 Ga0307406_10041838 3300031901 Bacteria 2858
172 Ga0307412_10007532 3300031911 Bacteria 6181
173 Ga0307412_10038108 3300031911 Bacteria 3093
174 Ga0307409_100045382 3300031995 Bacteria 3317
175 Ga0307416_100076047 3300032002 Bacteria 2812
176 Ga0307411_10018701 3300032005 Bacteria 3983
177 Ga0307415_100047581 3300032126 Bacteria 2887
178 Ga0316580_10018422 3300032139 Bacteria 2147
179 Ga0307507_10079012 3300033179 Bacteria 2911
180 Ga0307507_10175151 3300033179 Bacteria 1548
181 Ga0307510_10090565 3300033180 Bacteria 2904
182 Ga0307510_10160408 3300033180 Bacteria 1846
183 Ga0373936_0014393 3300035113 Bacteria 3023
184 Ga0316574_0001345 3300035398 Bacteria 11551
185 Ga0316582_0006539 3300036647 Bacteria 6131
186 Ga0316582_0154481 3300036647 Bacteria 1552
187 Ga0316584_0001023 3300036712 Bacteria 16179
188 Ga0316584_0013441 3300036712 Bacteria 5793
189 Ga0316584_0100433 3300036712 Bacteria 2166
190 Ga0395900_0044148 3300037418 Bacteria 4594
191 Ga0395900_0136289 3300037418 Bacteria 2515
192 Ga0395898_0018351 3300037466 Bacteria 7134
193 Ga0395898_0040738 3300037466 Bacteria 4591
194 Ga0395898_0085221 3300037466 Bacteria 3045
195 Ga0395901_0010043 3300038443 Bacteria 9599
196 Ga0395901_0238916 3300038443 Bacteria 1895
197 Ga0395901_0364158 3300038443 Bacteria 1490
198 Ga0395901_0395366 3300038443 Bacteria 1421
199 Ga0439436_0001203 3300041404 Bacteria 7367
200 Ga0439436_0002809 3300041404 Bacteria 5275
201 Ga0439439_0002245 3300041406 Bacteria 4067
202 Ga0451791_1406329 3300041451 Bacteria 3613
203 Ga0451793_0205636 3300041452 Bacteria 7759
204 Ga0451833_0143314 3300041491 Bacteria 2337
205 Ga0451833_1442922 3300041491 Bacteria 1786
206 Ga0451837_1058626 3300041494 Bacteria 3748
207 Ga0451853_0754630 3300041512 Bacteria 9276
208 Ga0451853_1416036 3300041512 Bacteria 10955
209 Ga0451853_2303190 3300041512 Bacteria 2164
210 Ga0439433_0003641 3300041999 Bacteria 3313
211 Ga0439433_0018765 3300041999 Bacteria 1540
212 Ga0439442_011497 3300042002 Bacteria 1803
213 Ga0439449_0010872 3300042007 Bacteria 3434
214 Ga0439457_000052 3300042014 Bacteria 24278
215 Ga0439457_002335 3300042014 Bacteria 5446
216 Ga0450896_001440 3300042133 Bacteria 2929
217 Ga0450907_003281 3300042146 Bacteria 2912
218 Ga0439458_0002720 3300042157 Bacteria 4269
219 Ga0439434_0014214 3300042435 Bacteria 2368
220 Ga0466969_0002369 3300044656 Bacteria 10068
221 Ga0466969_0002452 3300044656 Bacteria 9893
222 Ga0466969_0005241 3300044656 Bacteria 6904
223 Ga0466969_0018674 3300044656 Bacteria 3611
224 Ga0466972_0003319 3300044658 Bacteria 7982
225 Ga0466972_0004438 3300044658 Bacteria 7020
226 Ga0466965_0039253 3300044683 Bacteria 2327
227 Ga0466965_0050664 3300044683 Bacteria 2059
228 Ga0466966_0006809 3300044684 Bacteria 7571
229 Ga0466966_0008350 3300044684 Bacteria 6858
230 Ga0466966_0012689 3300044684 Bacteria 5584
231 Ga0466966_0016942 3300044684 Bacteria 4816
232 Ga0466961_0005077 3300044693 Bacteria 8281
233 Ga0466961_0100988 3300044693 Bacteria 1817
234 Ga0466963_0000753 3300044694 Bacteria 15986
235 Ga0466963_0007911 3300044694 Bacteria 6365
236 Ga0466963_0039086 3300044694 Bacteria 3106
237 Ga0466964_0018125 3300044706 Bacteria 2700
238 Ga0466971_0004497 3300044719 Bacteria 6027
239 Ga0466968_0023255 3300044735 Bacteria 2523
240 Ga0466970_0008541 3300044765 Bacteria 5157
241 Ga0466970_0012045 3300044765 Bacteria 4417
242 Ga0466970_0081680 3300044765 Bacteria 1748
243 Ga0466970_0082195 3300044765 Bacteria 1742
244 Ga0466957_0000165 3300044842 Bacteria 29339
245 Ga0466960_0001275 3300044901 Bacteria 9124
246 Ga0466960_0006570 3300044901 Bacteria 4671
247 Ga0466960_0012735 3300044901 Bacteria 3557
248 Ga0466960_0053877 3300044901 Bacteria 1951
249 Ga0466959_0006874 3300045049 Bacteria 7936
250 Ga0466959_0016752 3300045049 Bacteria 5362
251 Ga0466959_0027946 3300045049 Bacteria 4183
252 Ga0466958_0000098 3300045836 Bacteria 27382
253 Ga0466967_0006167 3300045976 Bacteria 8442
254 Ga0466967_0033099 3300045976 Bacteria 4374
255 Ga0466967_0037284 3300045976 Bacteria 4159
256 Ga0466967_0248352 3300045976 Bacteria 1699
257 Ga0495592_0005778 3300046454 Bacteria 9163
258 Ga0495603_0004116 3300046455 Bacteria 8663
259 Ga0495603_0030505 3300046455 Bacteria 3246
260 Ga0495603_0039657 3300046455 Bacteria 2820
261 Ga0495603_0041543 3300046455 Bacteria 2749
262 Ga0495629_0004750 3300046459 Bacteria 10179
263 Ga0495629_0005303 3300046459 Bacteria 9637
264 Ga0495629_0034097 3300046459 Bacteria 3598
265 Ga0495629_0040023 3300046459 Bacteria 3297
266 Ga0495629_0041692 3300046459 Bacteria 3229
267 Ga0495629_0081575 3300046459 Bacteria 2257
268 Ga0495629_0132331 3300046459 Bacteria 1737
269 Ga0495651_0005250 3300046462 Bacteria 9874
270 Ga0495651_0009752 3300046462 Bacteria 7385
271 Ga0495653_0043581 3300046463 Bacteria 3488
272 Ga0495580_0002444 3300046472 Bacteria 16239
273 Ga0495605_0028157 3300046474 Bacteria 2902
274 Ga0495662_0001039 3300046476 Bacteria 13621
275 Ga0495662_0052450 3300046476 Bacteria 1969
276 Ga0495662_0057908 3300046476 Bacteria 1871
277 Ga0495664_0001036 3300046477 Bacteria 14362
278 Ga0495585_0019748 3300046492 Bacteria 3882
279 Ga0495594_0000431 3300046499 Bacteria 21108
280 Ga0495583_0031329 3300046506 Bacteria 2579
281 Ga0495606_0022079 3300046507 Bacteria 4648
282 Ga0495608_0008080 3300046511 Bacteria 7395
283 Ga0495608_0022878 3300046511 Bacteria 4288
284 Ga0495618_0054771 3300046514 Bacteria 2525
285 Ga0495620_0039489 3300046515 Bacteria 2084
286 Ga0495620_0043445 3300046515 Bacteria 1957
287 Ga0495628_0007220 3300046516 Bacteria 9619
288 Ga0495628_0102418 3300046516 Bacteria 2209
289 Ga0495628_0116549 3300046516 Bacteria 2051
290 Ga0495643_0012404 3300046522 Bacteria 5141
291 Ga0495644_0071724 3300046523 Bacteria 1302
292 Ga0495648_0045970 3300046524 Bacteria 2710
293 Ga0495648_0068080 3300046524 Bacteria 2079
294 Ga0495666_0011364 3300046526 Bacteria 4442
295 Ga0495640_0039932 3300046533 Bacteria 3289
296 Ga0495640_0065158 3300046533 Bacteria 2461
297 Ga0495640_0113755 3300046533 Bacteria 1765
298 Ga0495586_0020579 3300046535 Bacteria 3513
299 Ga0495586_0058122 3300046535 Bacteria 2100
300 Ga0495587_0003636 3300046536 Bacteria 10264
301 Ga0495609_0005469 3300046538 Bacteria 6660
302 Ga0495597_0064171 3300046542 Bacteria 1595
303 Ga0495645_0022410 3300046543 Bacteria 4570
304 Ga0495645_0032112 3300046543 Bacteria 3829
305 Ga0495645_0034991 3300046543 Bacteria 3662
306 Ga0495645_0051174 3300046543 Bacteria 3006
307 Ga0495633_0018919 3300046558 Bacteria 3487
308 Ga0495668_0024990 3300046616 Bacteria 3395
309 Ga0495668_0103271 3300046616 Bacteria 1559
310 Ga0495634_0049588 3300046642 Bacteria 2822
311 Ga0495611_0043560 3300046648 Bacteria 2006
312 Ga0495611_0107991 3300046648 Bacteria 1294
313 Ga0495625_0015369 3300046660 Bacteria 6065
314 Ga0495625_0109307 3300046660 Bacteria 1891
315 Ga0495635_0088206 3300046663 Bacteria 2122
316 Ga0495661_0027102 3300046665 Bacteria 3681
317 Ga0495588_0006044 3300046674 Bacteria 5431
318 Ga0495588_0011493 3300046674 Bacteria 4157
319 Ga0495588_0028760 3300046674 Bacteria 2784
320 Ga0495588_0039848 3300046674 Bacteria 2394
321 Ga0495657_0001822 3300046675 Bacteria 18224
322 Ga0495657_0003523 3300046675 Bacteria 12761
323 Ga0495657_0022374 3300046675 Bacteria 4529
324 Ga0495657_0064656 3300046675 Bacteria 2408
325 Ga0495646_0002307 3300046680 Bacteria 11674
326 Ga0495613_0001140 3300046689 Bacteria 20239
327 Ga0495613_0003810 3300046689 Bacteria 11302
328 Ga0495613_0005753 3300046689 Bacteria 9286
329 Ga0495613_0011933 3300046689 Bacteria 6458
330 Ga0495613_0020323 3300046689 Bacteria 4950
331 Ga0495613_0119670 3300046689 Bacteria 1891
332 Ga0495613_0129003 3300046689 Bacteria 1811
333 Ga0495624_0070985 3300046690 Bacteria 2167
334 Ga0495624_0079913 3300046690 Bacteria 2027
335 Ga0495670_0026856 3300046691 Bacteria 2850
336 Ga0495671_0012751 3300046692 Bacteria 4580
337 Ga0495649_0007740 3300046694 Bacteria 6521
338 Ga0495649_0030071 3300046694 Bacteria 3000
339 Ga0495589_0029972 3300046794 Bacteria 2741
340 Ga0495589_0045833 3300046794 Bacteria 2171
341 Ga0495600_0028610 3300046809 Bacteria 3605
342 Ga0495600_0043238 3300046809 Bacteria 2937
343 Ga0495581_0002446 3300047315 Bacteria 10500
344 Ga0495581_0009234 3300047315 Bacteria 5704
345 Ga0495604_0000570 3300047317 Bacteria 32433
346 Ga0495636_0010565 3300047318 Bacteria 3647
347 Ga0495636_0017890 3300047318 Bacteria 2840
348 Ga0495676_0002124 3300047321 Bacteria 17506
349 Ga0495676_0024116 3300047321 Bacteria 5270
350 Ga0495676_0039694 3300047321 Bacteria 3894
351 Ga0495676_0063681 3300047321 Bacteria 2872
352 Ga0495680_0006173 3300047322 Bacteria 11175
353 Ga0495687_011642 3300047443 Bacteria 4712
354 Ga0495687_012263 3300047443 Bacteria 4540
355 Ga0495675_0005337 3300047444 Bacteria 7830
356 Ga0495675_0011384 3300047444 Bacteria 5584
357 Ga0495675_0104326 3300047444 Bacteria 1772
358 Ga0495685_008643 3300047447 Bacteria 3388
359 Ga0495685_012465 3300047447 Bacteria 2880
360 Ga0495685_016071 3300047447 Bacteria 2557
361 Ga0495685_031689 3300047447 Bacteria 1816
362 Ga0495685_032525 3300047447 Bacteria 1792
363 Ga0495685_035452 3300047447 Bacteria 1714
364 Ga0495681_0003534 3300047470 Bacteria 10869
365 Ga0495684_0144766 3300047471 Bacteria 1780
366 Ga0495686_0107323 3300047472 Bacteria 1678
367 Ga0495593_0001398 3300047673 Bacteria 14116
368 Ga0495593_0010809 3300047673 Bacteria 5262
369 Ga0495593_0103339 3300047673 Bacteria 1460
370 Ga0495602_0202830 3300048088 Bacteria 1512
371 Ga0495614_0001262 3300048089 Bacteria 10873
372 Ga0495614_0001455 3300048089 Bacteria 10234
373 Ga0495614_0079185 3300048089 Bacteria 1422
374 Ga0495626_0012119 3300048091 Bacteria 4533
375 Ga0496100_0150770 3300048903 Bacteria 1658
376 Ga0496100_0166702 3300048903 Bacteria 1583
377 Ga0496101_0057138 3300048904 Bacteria 2822
378 Ga0496102_0011636 3300048905 Bacteria 7594
379 Ga0496102_0014468 3300048905 Bacteria 6856
380 Ga0496102_0032073 3300048905 Bacteria 4718
381 Ga0496102_0102248 3300048905 Bacteria 2664
382 Ga0496103_0020422 3300048906 Bacteria 3978
383 Ga0496104_0006307 3300048907 Bacteria 10430
384 Ga0496104_0052956 3300048907 Bacteria 3834
385 Ga0496104_0132808 3300048907 Bacteria 2391
386 Ga0496105_0076211 3300048908 Bacteria 2769
387 Ga0496106_0168709 3300048909 Bacteria 1734
388 Ga0496108_0036895 3300048911 Bacteria 4069
389 Ga0496108_0046614 3300048911 Bacteria 3621
390 Ga0496108_0096175 3300048911 Bacteria 2522
391 Ga0496108_0201686 3300048911 Bacteria 1726
392 Ga0496109_0001632 3300048912 Bacteria 18743
393 Ga0496109_0023868 3300048912 Bacteria 5430
394 Ga0496109_0184497 3300048912 Bacteria 1960
395 Ga0496109_0263232 3300048912 Bacteria 1624
396 Ga0496110_0000651 3300048913 Bacteria 23688
397 Ga0496110_0115879 3300048913 Bacteria 2412
398 Ga0496111_0000163 3300048914 Bacteria 30013
399 Ga0496112_0063204 3300048915 Bacteria 3651
400 Ga0496112_0064240 3300048915 Bacteria 3622
401 Ga0496113_0005546 3300048916 Bacteria 7883
402 Ga0496114_0002234 3300048917 Bacteria 14757
403 Ga0496114_0005759 3300048917 Bacteria 9729
404 Ga0496114_0018921 3300048917 Bacteria 5578
405 Ga0496114_0039074 3300048917 Bacteria 3927
406 Ga0496114_0041155 3300048917 Bacteria 3829
407 Ga0496114_0135708 3300048917 Bacteria 2127
408 Ga0496114_0139281 3300048917 Bacteria 2100
409 Ga0496114_0152621 3300048917 Bacteria 2004
410 Ga0496114_0243767 3300048917 Bacteria 1581
411 Ga0496115_0077813 3300048918 Bacteria 2698
412 Ga0496115_0176461 3300048918 Bacteria 1767
413 Ga0496126_0077704 3300048929 Bacteria 2942
414 Ga0496126_0115627 3300048929 Bacteria 2332
415 Ga0501031_0000156 3300049568 Bacteria 38816
416 Ga0501031_0007531 3300049568 Bacteria 7092
417 Ga0501031_0009350 3300049568 Bacteria 6372
418 Ga0501031_0014297 3300049568 Bacteria 5162
419 Ga0501031_0148467 3300049568 Bacteria 1532
420 Ga0501032_0001239 3300049569 Bacteria 20482
421 Ga0501032_0025536 3300049569 Bacteria 4072
422 Ga0501032_0137800 3300049569 Bacteria 1608
423 Ga0501033_0002504 3300049570 Bacteria 15567
424 Ga0501033_0010769 3300049570 Bacteria 7012
425 Ga0501033_0035903 3300049570 Bacteria 3715
426 Ga0501033_0047540 3300049570 Bacteria 3190
427 Ga0501033_0060116 3300049570 Bacteria 2804
428 Ga0501034_0020900 3300049571 Bacteria 6682
429 Ga0501034_0040056 3300049571 Bacteria 4744
430 Ga0501034_0151943 3300049571 Bacteria 2291
431 Ga0501036_0001565 3300049572 Bacteria 17677
432 Ga0501036_0006697 3300049572 Bacteria 9365
433 Ga0501036_0014835 3300049572 Bacteria 6499
434 Ga0501036_0027966 3300049572 Bacteria 4767
435 Ga0501036_0089965 3300049572 Bacteria 2593
436 Ga0501037_0001404 3300049573 Bacteria 17665
437 Ga0501037_0007220 3300049573 Bacteria 8118
438 Ga0501037_0022824 3300049573 Bacteria 4626
439 Ga0501037_0040004 3300049573 Bacteria 3450
440 Ga0501037_0056013 3300049573 Bacteria 2881
441 Ga0501038_0000759 3300049574 Bacteria 28718
442 Ga0501038_0005500 3300049574 Bacteria 11760
443 Ga0501038_0033630 3300049574 Bacteria 4515
444 Ga0501038_0040129 3300049574 Bacteria 4091
445 Ga0501038_0066724 3300049574 Bacteria 3063
446 Ga0501038_0220572 3300049574 Bacteria 1513
447 Ga0501039_0007615 3300049575 Bacteria 8272
448 Ga0501039_0018712 3300049575 Bacteria 5316
449 Ga0501039_0030825 3300049575 Bacteria 4135
450 Ga0501039_0035639 3300049575 Bacteria 3840
451 Ga0501039_0040960 3300049575 Bacteria 3576
452 Ga0501039_0080671 3300049575 Bacteria 2532
453 Ga0501040_0102619 3300049576 Bacteria 1996
454 Ga0501041_0002636 3300049577 Bacteria 10229
455 Ga0501041_0048720 3300049577 Bacteria 2581
456 Ga0501042_0001495 3300049578 Bacteria 13805
457 Ga0501042_0039624 3300049578 Bacteria 3349
458 Ga0501043_0000624 3300049579 Bacteria 31242
459 Ga0501043_0016151 3300049579 Bacteria 5854
460 Ga0501043_0069284 3300049579 Bacteria 2770
461 Ga0501043_0078026 3300049579 Bacteria 2602
462 Ga0501043_0096957 3300049579 Bacteria 2318
463 Ga0501046_0000631 3300049580 Bacteria 34597
464 Ga0501046_0000920 3300049580 Bacteria 28874
465 Ga0501046_0007616 3300049580 Bacteria 9499
466 Ga0501046_0031704 3300049580 Bacteria 4282
467 Ga0501046_0055119 3300049580 Bacteria 3126
468 Ga0501046_0133426 3300049580 Bacteria 1882
469 Ga0501047_0034015 3300049581 Bacteria 4920
470 Ga0501047_0076786 3300049581 Bacteria 3214
471 Ga0501048_0002943 3300049582 Bacteria 13019
472 Ga0501048_0006530 3300049582 Bacteria 8865
473 Ga0501048_0012120 3300049582 Bacteria 6424
474 Ga0501048_0085034 3300049582 Bacteria 2231
475 Ga0501067_0018587 3300049583 Bacteria 3847
476 Ga0501068_0006582 3300049584 Bacteria 6410
477 Ga0501069_0011639 3300049585 Bacteria 4664
478 Ga0501069_0052190 3300049585 Bacteria 2277
479 Ga0501070_0009017 3300049586 Bacteria 8440
480 Ga0501070_0010359 3300049586 Bacteria 7880
481 Ga0501070_0028564 3300049586 Bacteria 4678
482 Ga0501071_0036560 3300049587 Bacteria 3503
483 Ga0501071_0056139 3300049587 Bacteria 2844
484 Ga0501072_0001887 3300049588 Bacteria 15611
485 Ga0501072_0041382 3300049588 Bacteria 3619
486 Ga0501072_0074093 3300049588 Bacteria 2692
487 Ga0501072_0084608 3300049588 Bacteria 2515
488 Ga0501072_0193991 3300049588 Bacteria 1620
489 Ga0501073_0000422 3300049589 Bacteria 28939
490 Ga0501073_0035097 3300049589 Bacteria 3565
491 Ga0501074_0000674 3300049590 Bacteria 21318
492 Ga0501074_0007013 3300049590 Bacteria 8134
493 Ga0501074_0059395 3300049590 Bacteria 2755
494 Ga0501075_0024325 3300049591 Bacteria 4439
495 Ga0501076_0005878 3300049592 Bacteria 8850
496 Ga0501079_0101469 3300049741 Bacteria 2231
497 Ga0501080_0025172 3300049742 Bacteria 5523
498 Ga0501080_0109627 3300049742 Bacteria 2559
499 Ga0501081_0011385 3300049743 Bacteria 5822
500 Ga0501081_0080793 3300049743 Bacteria 2276
501 Ga0501083_0009150 3300049744 Bacteria 6997
502 Ga0501035_0027681 3300049822 Bacteria 5181
503 Ga0501035_0100940 3300049822 Bacteria 2533
504 Ga0501035_0202727 3300049822 Bacteria 1700
505 Ga0501044_0003731 3300049823 Bacteria 17108
506 Ga0501044_0013107 3300049823 Bacteria 8975
507 Ga0501044_0038403 3300049823 Bacteria 5000
508 Ga0501044_0045128 3300049823 Bacteria 4569
509 Ga0501044_0061479 3300049823 Bacteria 3842
510 Ga0501044_0062611 3300049823 Bacteria 3802
511 Ga0501044_0075689 3300049823 Bacteria 3417
512 Ga0501044_0076210 3300049823 Bacteria 3405
513 Ga0501044_0243157 3300049823 Bacteria 1743
514 Ga0501044_0322330 3300049823 Bacteria 1469
515 Ga0501045_0024744 3300049824 Bacteria 4312
516 Ga0501045_0057388 3300049824 Bacteria 2849
517 nmdc:mga00v17_30928_c1 3300050491 Bacteria 3153
518 nmdc:mga00v17_8044_c1 3300050491 Bacteria 5659
519 nmdc:mga00v17_94361_c2 3300050491 Bacteria 1464
520 nmdc:mga0yw44_165044_c1 3300050492 Bacteria 1451
521 nmdc:mga0yw44_19236_c1 3300050492 Bacteria 3761
522 nmdc:mga0yw44_41809_c1 3300050492 Bacteria 2730
523 nmdc:mga0yw44_72443_c1 3300050492 Bacteria 2141
524 nmdc:mga0yw44_889_c1 3300050492 Bacteria 11260
525 nmdc:mga06z11_7115_c1 3300050494 Bacteria 4592
526 nmdc:mga04h51_2660_c1 3300050495 Bacteria 4256
527 nmdc:mga07m45_20395_c1 3300050496 Bacteria 3600
528 nmdc:mga07m45_40255_c1 3300050496 Bacteria 2615
529 nmdc:mga05p37_14632_c1 3300050507 Bacteria 9426
530 nmdc:mga05p37_6897_c1 3300050507 Bacteria 13390
531 nmdc:mga09592_2052_c1 3300050508 Bacteria 16244
532 nmdc:mga09592_3497_c1 3300050508 Bacteria 12680
533 nmdc:mga0qj67_21466_c1 3300050509 Bacteria 4953
534 nmdc:mga0qj67_9107_c1 3300050509 Bacteria 7366
535 nmdc:mga06r32_2152_c1 3300050510 Bacteria 17619
536 nmdc:mga06r32_657_c1 3300050510 Bacteria 30190
537 Ga0495619_0014384 3300053085 Bacteria 4997
538 Ga0495619_0023279 3300053085 Bacteria 3970
539 Ga0500556_0000498 3300053104 Bacteria 27278
540 Ga0500572_018800 3300053111 Bacteria 1795
541 Ga0500593_000073 3300053117 Bacteria 37609
542 Ga0500616_0002468 3300053153 Bacteria 15343
543 Ga0500634_0050445 3300053161 Bacteria 2241
544 Ga0501084_0002400 3300054114 Bacteria 15070
545 Ga0501084_0049460 3300054114 Bacteria 3519
546 Ga0501084_0054959 3300054114 Bacteria 3331
547 Ga0501082_0028110 3300060353 Bacteria 4846
548 Ga0501082_0209351 3300060353 Bacteria 1697
549 Ga0466962_0000132 3300061719 Bacteria 30670
550 Ga0466962_0007121 3300061719 Bacteria 5357
551 Ga0530510_0119076 3300061734 Bacteria 1937
552 2644447324 2643221679 Bacteria 3839507
553 2515853467 2515154155 Bacteria 7985436
554 2547406085 2547132111 Bacteria 8013147
555 2554257524 2554235005 Bacteria 6457341
556 2585298466 2582581312 Bacteria 7308206
557 2585305769 2582581313 Bacteria 10042643
558 2585314553 2582581314 Bacteria 11452267
559 2616700356 2616644814 Bacteria 11555299
560 2616702148 2616644814 Bacteria 11555299
561 2616904202 2616644941 Bacteria 8510691
562 2643763141 2643221548 Bacteria 8053412
563 2643827091 2643221561 Bacteria 4984412
564 2643852023 2643221567 Bacteria 4163945
565 2643891100 2643221576 Bacteria 5214352
566 2643900154 2643221578 Bacteria 9213798
567 2643947908 2643221587 Bacteria 7586415
568 2643960156 2643221590 Bacteria 5214697
569 2644018196 2643221601 Bacteria 7493239
570 2644035105 2643221604 Bacteria 5014917
571 2644084480 2643221613 Bacteria 4622396
572 2644092350 2643221615 Bacteria 5487866
573 2644101219 2643221617 Bacteria 5139111
574 2644119375 2643221620 Bacteria 5134593
575 2644136544 2643221624 Bacteria 4384879
576 2644174234 2643221631 Bacteria 8168043
577 2644322153 2643221657 Bacteria 5490246
578 2644390654 2643221670 Bacteria 6497041
579 2644405622 2643221673 Bacteria 9196637
580 2644433774 2643221677 Bacteria 7584031
581 2644443085 2643221678 Bacteria 9540101
582 2644463989 2643221682 Bacteria 6743283
583 2644504288 2643221690 Bacteria 4654705
584 2644524185 2643221694 Bacteria 4392972
585 2644534444 2643221696 Bacteria 5431823
586 2644627103 2643221714 Bacteria 9015452
587 2644667097 2643221721 Bacteria 4486924
588 2644668284 2643221722 Bacteria 4247614
589 2676476242 2675903058 Bacteria 6822861
590 2729909446 2728369276 Bacteria 5610032
591 2731906329 2731639228 Bacteria 4187555
592 2738694421 2738541272 Bacteria 6848551
593 2738868856 2738541305 Bacteria 4910150
594 2739323897 2738543027 Bacteria 6409078
595 2739606812 2739367654 Bacteria 6049412
596 2760305300 2758568522 Bacteria 5953541
597 2760620892 2758568621 Bacteria 5967089
598 2774395494 2773857762 Bacteria 5971770
599 2784589026 2784132148 Bacteria 8627943
600 2785342821 2784746763 Bacteria 9783172
601 2785369982 2784746768 Bacteria 10036182
602 2804846350 2802429296 Bacteria 7227771
603 2808842476 2808606359 Bacteria 9866990
604 2808872181 2808606365 Bacteria 4301966
605 2808920982 2808606375 Bacteria 9466072
606 2809025677 2808606394 Bacteria 6248540
607 2809193671 2808606439 Bacteria 5952208
608 2809232629 2808606448 Bacteria 8656184
609 2810365967 2808606700 Bacteria 3482157
610 2811845747 2808606982 Bacteria 7791042
611 2812330266 2811994874 Bacteria 5367947
612 2812348400 2811994878 Bacteria 5992952
613 2812357625 2811994879 Bacteria 9313447
614 2812363224 2811994880 Bacteria 4147780
615 2812480145 2811994917 Bacteria 7761064
616 2816422170 2816332119 Bacteria 8120218
617 2819697309 2818991463 Bacteria 7948711
618 2819741603 2818991472 Bacteria 10089953
619 2827634073 2827628540 Bacteria 6858585
620 2835190844 2835188231 Bacteria 3476928
621 2837271804 2837268691 Bacteria 7850704
622 2839987377 2839986021 Bacteria 3685650
623 2852637297 2852635781 Bacteria 8251373
624 2856742563 2856741275 Bacteria 8096094
625 2857486169 2857481737 Bacteria 4761446
626 2862178944 2862178590 Bacteria 8583590
627 2862286080 2862281513 Bacteria 9621493
628 2862291389 2862290372 Bacteria 7471434
629 2862390462 2862382967 Bacteria 10317375
630 2862578835 2862574272 Bacteria 10567477
631 2863412710 2863404153 Bacteria 9672205
632 2867372470 2867369537 Bacteria 6501581
633 2867436428 2867428634 Bacteria 9590268
634 2867480430 2867475112 Bacteria 6909112
635 2868089949 2868088558 Bacteria 7609351
636 2873155323 2873151551 Bacteria 8625867
637 2875395176 2875391855 Bacteria 7600475
638 2877680645 2877676314 Bacteria 9512378
639 2883822341 2883821847 Bacteria 5121194
640 2884997538 2884994152 Bacteria 4492978
641 2887445199 2887443736 Bacteria 4426037
642 2891404150 2891395885 Bacteria 9251614
643 2891557232 2891554331 Bacteria 8812224
644 2891565058 2891562705 Bacteria 8039471
645 2891973865 2891968417 Bacteria 5821697
646 2905929976 2905926851 Bacteria 4423176
647 2912719360 2912715099 Bacteria 9460473
648 2912731426 2912723979 Bacteria 8557534
649 2918505148 2918501144 Bacteria 8668083
650 2919448574 2919446982 Bacteria 3994487
651 2919471860 2919468124 Bacteria 9133025
652 2932434060 2932431166 Bacteria 4215299
653 2935893626 2935890801 Bacteria 4593001
654 2946006374 2946003308 Bacteria 3857229
655 2946049479 2946045630 Bacteria 8527308
656 2946068231 2946064051 Bacteria 8957905
657 2946076366 2946072368 Bacteria 8999607
658 2947228692 2947224130 Bacteria 9938529
659 2954715776 2954711539 Bacteria 10867210
660 2954725713 2954721474 Bacteria 10456478
661 2954736087 2954731030 Bacteria 10243860
662 2954744667 2954740390 Bacteria 10229294
663 2954754947 2954749733 Bacteria 10366972
664 2966602107 2966598605 Bacteria 7676064
665 2966924527 2966921586 Bacteria 3092803
666 2990061623 2990059506 Bacteria 9321252
667 2995468739 2995463766 Bacteria 8577691
668 2997459035 2997451912 Bacteria 8492419
669 2997604669 2997600082 Bacteria 9896405
670 3001889909 3001889506 Bacteria 2975194
671 3006399589 3006393351 Bacteria 6615579
672 3006425746 3006425503 Bacteria 6491253
673 3006488476 3006486233 Bacteria 8157040
674 3006499407 3006493962 Bacteria 8825450
675 8004022992 8004021418 Bacteria 4313954
676 8004027201 8004025490 Bacteria 4327753
677 8008566818 8008558824 Bacteria 10610750
678 8023630516 8023623736 Bacteria 8593882
679 8025419892 8025413630 Bacteria 7014048
680 8025484246 8025478263 Bacteria 8209203
681 8025534435 8025530807 Bacteria 8495698
682 8047897583 8047893842 Bacteria 11723082
683 8048129619 8048127548 Bacteria 11053136
684 8048361287 8048356638 Bacteria 11044339
685 8048374570 8048369669 Bacteria 11666822
686 8048383652 8048379754 Bacteria 11877923
687 8048411529 8048406513 Bacteria 8936924
688 8054167443 8054160619 Bacteria 7783213
689 8056062490 8056060235 Bacteria 7259403
690 8056450059 8056447290 Bacteria 7680491
691 8056580224 8056579771 Bacteria 5840325
692 8056671979 8056667051 Bacteria 6953971
693 8056838043 8056829672 Bacteria 9045328
694 JGI24739J22299_10002388
695 JGI24737J22298_10004268
696 JGI24735J21928_10005654
697 JGI24738J21930_10008082
698 rootH1_10005518
699 Ga0006562J51391_1088201
700 Ga0070682_100086148
701 Ga0070668_100128044
702 Ga0070667_100008551
703 Ga0070709_10000675
704 Ga0070709_10030491
705 Ga0070714_100001941
706 Ga0070714_100078099
707 Ga0070713_100001726
708 Ga0070713_100011371
709 Ga0070710_10002007
710 Ga0070711_100003590
711 Ga0070711_100013350
712 Ga0070708_100051406
713 Ga0070678_100159324
714 Ga0070678_100164766
715 Ga0070706_100018922
716 Ga0070706_100045763
717 Ga0070707_100006972
718 Ga0070707_100015458
719 Ga0070707_100022987
720 Ga0070707_100154290
721 Ga0070707_100185440
722 Ga0070698_100005345
723 Ga0070698_100007299
724 Ga0070698_100010980
725 Ga0070699_100059959
726 Ga0070679_100080310
727 Ga0070697_100042540
728 Ga0070697_100151059
729 Ga0068857_100261891
730 Ga0070702_100001993
731 Ga0068860_100000504
732 Ga0081455_10000154
733 Ga0081455_10165806
734 Ga0081538_10000861
735 Ga0081538_10019546
736 Ga0081540_1066115
737 Ga0081539_10003926
738 Ga0081539_10006850
739 Ga0081539_10090901
740 Ga0070717_10006155
741 Ga0070717_10018383
742 Ga0070717_10045053
743 Ga0070717_10045845
744 Ga0075365_10000512
745 Ga0075365_10002626
746 Ga0075365_10038168
747 Ga0075365_10038195
748 Ga0075365_10038490
749 Ga0075365_10051272
750 Ga0075365_10085358
751 Ga0075365_10088725
752 Ga0075368_10001405
753 Ga0075368_10025802
754 Ga0075363_100051503
755 Ga0075364_10120809
756 Ga0070715_10000215
757 Ga0070715_10011770
758 Ga0070716_100026457
759 Ga0070716_100041128
760 Ga0070712_100097577
761 Ga0075362_10012311
762 Ga0075367_10004145
763 Ga0075367_10027615
764 Ga0075370_10007138
765 Ga0075370_10030784
766 Ga0075370_10072873
767 Ga0075428_100002034
768 Ga0075428_100005268
769 Ga0075428_100027499
770 Ga0075430_100006047
771 Ga0075430_100006628
772 Ga0075431_100003219
773 Ga0075431_100006037
774 Ga0075431_100008698
775 Ga0075431_100262845
776 Ga0075429_100011712
777 Ga0075429_100025562
778 Ga0075429_100100630
779 Ga0105251_10007858
780 Ga0111539_10061836
781 Ga0111539_10353181
782 Ga0114129_10016830
783 Ga0114129_10054408
784 Ga0105239_10156362
785 Ga0105239_10165577
786 Ga0105246_10000301
787 Ga0157370_10129883
788 Ga0157369_10010651
789 Ga0157369_10028880
790 Ga0157372_10201752
791 Ga0157375_10033075
792 Ga0157375_10043714
793 Ga0157375_10082515
794 Ga0157380_10038706
795 Ga0182008_10000809
796 Ga0157379_10180217
797 Ga0157379_10222488
798 Ga0182007_10001310
799 Ga0183367_1008
800 Ga0163161_10025668
801 Ga0209758_1006734
802 Ga0207426_1003012
803 Ga0207426_1006736
804 Ga0207426_1011274
805 Ga0207692_10002071
806 Ga0207692_10007254
807 Ga0207647_10002992
808 Ga0207647_10041322
809 Ga0207685_10003470
810 Ga0207685_10003755
811 Ga0207685_10014678
812 Ga0207699_10001491
813 Ga0207699_10060383
814 Ga0207684_10009758
815 Ga0207693_10002505
816 Ga0207693_10045332
817 Ga0207693_10186386
818 Ga0207652_10106048
819 Ga0207646_10010545
820 Ga0207646_10195494
821 Ga0207700_10000997
822 Ga0207664_10001190
823 Ga0207664_10011115
824 Ga0207686_10017345
825 Ga0207709_10032751
826 Ga0207665_10000660
827 Ga0207658_10033468
828 Ga0207639_10068716
829 Ga0207678_10115734
830 Ga0207702_10076571
831 Ga0207702_10149417
832 Ga0207641_10311153
833 Ga0207674_10047401
834 Ga0268266_10329998
835 Ga0268264_10000547
836 Ga0307517_10010298
837 Ga0307515_10006675
838 Ga0307515_10046074
839 Ga0307511_10043387
840 Ga0307511_10068813
841 Ga0307513_10000175
842 Ga0307513_10001562
843 Ga0307513_10156947
844 Ga0307513_10201543
845 Ga0307509_10087596
846 Ga0307509_10106105
847 Ga0307508_10008367
848 Ga0307508_10012953
849 Ga0307508_10059204
850 Ga0307508_10109245
851 Ga0307514_10112692
852 Ga0316579_10000286
853 Ga0316579_10003583
854 Ga0316579_10045826
855 Ga0316576_10163785
856 Ga0316578_10000296
857 Ga0307516_10005023
858 Ga0307516_10064631
859 Ga0307405_10038046
860 Ga0316577_10015686
861 Ga0307413_10114794
862 Ga0307413_10163368
863 Ga0307410_10010328
864 Ga0307406_10041838
865 Ga0307412_10007532
866 Ga0307412_10038108
867 Ga0307409_100045382
868 Ga0307416_100076047
869 Ga0307411_10018701
870 Ga0307415_100047581
871 Ga0316580_10018422
872 Ga0307507_10079012
873 Ga0307507_10175151
874 Ga0307510_10090565
875 Ga0307510_10160408
876 Ga0373936_0014393
877 Ga0316574_0001345
878 Ga0316582_0006539
879 Ga0316582_0154481
880 Ga0316584_0001023
881 Ga0316584_0013441
882 Ga0316584_0100433
883 Ga0395900_0044148
884 Ga0395900_0136289
885 Ga0395898_0018351
886 Ga0395898_0040738
887 Ga0395898_0085221
888 Ga0395901_0010043
889 Ga0395901_0238916
890 Ga0395901_0364158
891 Ga0395901_0395366
892 Ga0439436_0001203
893 Ga0439436_0002809
894 Ga0439439_0002245
895 Ga0451791_1406329
896 Ga0451793_0205636
897 Ga0451833_0143314
898 Ga0451833_1442922
899 Ga0451837_1058626
900 Ga0451853_0754630
901 Ga0451853_1416036
902 Ga0451853_2303190
903 Ga0439433_0003641
904 Ga0439433_0018765
905 Ga0439442_011497
906 Ga0439449_0010872
907 Ga0439457_000052
908 Ga0439457_002335
909 Ga0450896_001440
910 Ga0450907_003281
911 Ga0439458_0002720
912 Ga0439434_0014214
913 Ga0466969_0002369
914 Ga0466969_0002452
915 Ga0466969_0005241
916 Ga0466969_0018674
917 Ga0466972_0003319
918 Ga0466972_0004438
919 Ga0466965_0039253
920 Ga0466965_0050664
921 Ga0466966_0006809
922 Ga0466966_0008350
923 Ga0466966_0012689
924 Ga0466966_0016942
925 Ga0466961_0005077
926 Ga0466961_0100988
927 Ga0466963_0000753
928 Ga0466963_0007911
929 Ga0466963_0039086
930 Ga0466964_0018125
931 Ga0466971_0004497
932 Ga0466968_0023255
933 Ga0466970_0008541
934 Ga0466970_0012045
935 Ga0466970_0081680
936 Ga0466970_0082195
937 Ga0466957_0000165
938 Ga0466960_0001275
939 Ga0466960_0006570
940 Ga0466960_0012735
941 Ga0466960_0053877
942 Ga0466959_0006874
943 Ga0466959_0016752
944 Ga0466959_0027946
945 Ga0466958_0000098
946 Ga0466967_0006167
947 Ga0466967_0033099
948 Ga0466967_0037284
949 Ga0466967_0248352
950 Ga0495592_0005778
951 Ga0495603_0004116
952 Ga0495603_0030505
953 Ga0495603_0039657
954 Ga0495603_0041543
955 Ga0495629_0004750
956 Ga0495629_0005303
957 Ga0495629_0034097
958 Ga0495629_0040023
959 Ga0495629_0041692
960 Ga0495629_0081575
961 Ga0495629_0132331
962 Ga0495651_0005250
963 Ga0495651_0009752
964 Ga0495653_0043581
965 Ga0495580_0002444
966 Ga0495605_0028157
967 Ga0495662_0001039
968 Ga0495662_0052450
969 Ga0495662_0057908
970 Ga0495664_0001036
971 Ga0495585_0019748
972 Ga0495594_0000431
973 Ga0495583_0031329
974 Ga0495606_0022079
975 Ga0495608_0008080
976 Ga0495608_0022878
977 Ga0495618_0054771
978 Ga0495620_0039489
979 Ga0495620_0043445
980 Ga0495628_0007220
981 Ga0495628_0102418
982 Ga0495628_0116549
983 Ga0495643_0012404
984 Ga0495644_0071724
985 Ga0495648_0045970
986 Ga0495648_0068080
987 Ga0495666_0011364
988 Ga0495640_0039932
989 Ga0495640_0065158
990 Ga0495640_0113755
991 Ga0495586_0020579
992 Ga0495586_0058122
993 Ga0495587_0003636
994 Ga0495609_0005469
995 Ga0495597_0064171
996 Ga0495645_0022410
997 Ga0495645_0032112
998 Ga0495645_0034991
999 Ga0495645_0051174
1000 Ga0495633_0018919
1001 Ga0495668_0024990
1002 Ga0495668_0103271
1003 Ga0495634_0049588
1004 Ga0495611_0043560
1005 Ga0495611_0107991
1006 Ga0495625_0015369
1007 Ga0495625_0109307
1008 Ga0495635_0088206
1009 Ga0495661_0027102
1010 Ga0495588_0006044
1011 Ga0495588_0011493
1012 Ga0495588_0028760
1013 Ga0495588_0039848
1014 Ga0495657_0001822
1015 Ga0495657_0003523
1016 Ga0495657_0022374
1017 Ga0495657_0064656
1018 Ga0495646_0002307
1019 Ga0495613_0001140
1020 Ga0495613_0003810
1021 Ga0495613_0005753
1022 Ga0495613_0011933
1023 Ga0495613_0020323
1024 Ga0495613_0119670
1025 Ga0495613_0129003
1026 Ga0495624_0070985
1027 Ga0495624_0079913
1028 Ga0495670_0026856
1029 Ga0495671_0012751
1030 Ga0495649_0007740
1031 Ga0495649_0030071
1032 Ga0495589_0029972
1033 Ga0495589_0045833
1034 Ga0495600_0028610
1035 Ga0495600_0043238
1036 Ga0495581_0002446
1037 Ga0495581_0009234
1038 Ga0495604_0000570
1039 Ga0495636_0010565
1040 Ga0495636_0017890
1041 Ga0495676_0002124
1042 Ga0495676_0024116
1043 Ga0495676_0039694
1044 Ga0495676_0063681
1045 Ga0495680_0006173
1046 Ga0495687_011642
1047 Ga0495687_012263
1048 Ga0495675_0005337
1049 Ga0495675_0011384
1050 Ga0495675_0104326
1051 Ga0495685_008643
1052 Ga0495685_012465
1053 Ga0495685_016071
1054 Ga0495685_031689
1055 Ga0495685_032525
1056 Ga0495685_035452
1057 Ga0495681_0003534
1058 Ga0495684_0144766
1059 Ga0495686_0107323
1060 Ga0495593_0001398
1061 Ga0495593_0010809
1062 Ga0495593_0103339
1063 Ga0495602_0202830
1064 Ga0495614_0001262
1065 Ga0495614_0001455
1066 Ga0495614_0079185
1067 Ga0495626_0012119
1068 Ga0496100_0150770
1069 Ga0496100_0166702
1070 Ga0496101_0057138
1071 Ga0496102_0011636
1072 Ga0496102_0014468
1073 Ga0496102_0032073
1074 Ga0496102_0102248
1075 Ga0496103_0020422
1076 Ga0496104_0006307
1077 Ga0496104_0052956
1078 Ga0496104_0132808
1079 Ga0496105_0076211
1080 Ga0496106_0168709
1081 Ga0496108_0036895
1082 Ga0496108_0046614
1083 Ga0496108_0096175
1084 Ga0496108_0201686
1085 Ga0496109_0001632
1086 Ga0496109_0023868
1087 Ga0496109_0184497
1088 Ga0496109_0263232
1089 Ga0496110_0000651
1090 Ga0496110_0115879
1091 Ga0496111_0000163
1092 Ga0496112_0063204
1093 Ga0496112_0064240
1094 Ga0496113_0005546
1095 Ga0496114_0002234
1096 Ga0496114_0005759
1097 Ga0496114_0018921
1098 Ga0496114_0039074
1099 Ga0496114_0041155
1100 Ga0496114_0135708
1101 Ga0496114_0139281
1102 Ga0496114_0152621
1103 Ga0496114_0243767
1104 Ga0496115_0077813
1105 Ga0496115_0176461
1106 Ga0496126_0077704
1107 Ga0496126_0115627
1108 Ga0501031_0000156
1109 Ga0501031_0007531
1110 Ga0501031_0009350
1111 Ga0501031_0014297
1112 Ga0501031_0148467
1113 Ga0501032_0001239
1114 Ga0501032_0025536
1115 Ga0501032_0137800
1116 Ga0501033_0002504
1117 Ga0501033_0010769
1118 Ga0501033_0035903
1119 Ga0501033_0047540
1120 Ga0501033_0060116
1121 Ga0501034_0020900
1122 Ga0501034_0040056
1123 Ga0501034_0151943
1124 Ga0501036_0001565
1125 Ga0501036_0006697
1126 Ga0501036_0014835
1127 Ga0501036_0027966
1128 Ga0501036_0089965
1129 Ga0501037_0001404
1130 Ga0501037_0007220
1131 Ga0501037_0022824
1132 Ga0501037_0040004
1133 Ga0501037_0056013
1134 Ga0501038_0000759
1135 Ga0501038_0005500
1136 Ga0501038_0033630
1137 Ga0501038_0040129
1138 Ga0501038_0066724
1139 Ga0501038_0220572
1140 Ga0501039_0007615
1141 Ga0501039_0018712
1142 Ga0501039_0030825
1143 Ga0501039_0035639
1144 Ga0501039_0040960
1145 Ga0501039_0080671
1146 Ga0501040_0102619
1147 Ga0501041_0002636
1148 Ga0501041_0048720
1149 Ga0501042_0001495
1150 Ga0501042_0039624
1151 Ga0501043_0000624
1152 Ga0501043_0016151
1153 Ga0501043_0069284
1154 Ga0501043_0078026
1155 Ga0501043_0096957
1156 Ga0501046_0000631
1157 Ga0501046_0000920
1158 Ga0501046_0007616
1159 Ga0501046_0031704
1160 Ga0501046_0055119
1161 Ga0501046_0133426
1162 Ga0501047_0034015
1163 Ga0501047_0076786
1164 Ga0501048_0002943
1165 Ga0501048_0006530
1166 Ga0501048_0012120
1167 Ga0501048_0085034
1168 Ga0501067_0018587
1169 Ga0501068_0006582
1170 Ga0501069_0011639
1171 Ga0501069_0052190
1172 Ga0501070_0009017
1173 Ga0501070_0010359
1174 Ga0501070_0028564
1175 Ga0501071_0036560
1176 Ga0501071_0056139
1177 Ga0501072_0001887
1178 Ga0501072_0041382
1179 Ga0501072_0074093
1180 Ga0501072_0084608
1181 Ga0501072_0193991
1182 Ga0501073_0000422
1183 Ga0501073_0035097
1184 Ga0501074_0000674
1185 Ga0501074_0007013
1186 Ga0501074_0059395
1187 Ga0501075_0024325
1188 Ga0501076_0005878
1189 Ga0501079_0101469
1190 Ga0501080_0025172
1191 Ga0501080_0109627
1192 Ga0501081_0011385
1193 Ga0501081_0080793
1194 Ga0501083_0009150
1195 Ga0501035_0027681
1196 Ga0501035_0100940
1197 Ga0501035_0202727
1198 Ga0501044_0003731
1199 Ga0501044_0013107
1200 Ga0501044_0038403
1201 Ga0501044_0045128
1202 Ga0501044_0061479
1203 Ga0501044_0062611
1204 Ga0501044_0075689
1205 Ga0501044_0076210
1206 Ga0501044_0243157
1207 Ga0501044_0322330
1208 Ga0501045_0024744
1209 Ga0501045_0057388
1210 nmdc:mga00v17_30928_c1
1211 nmdc:mga00v17_8044_c1
1212 nmdc:mga00v17_94361_c2
1213 nmdc:mga0yw44_165044_c1
1214 nmdc:mga0yw44_19236_c1
1215 nmdc:mga0yw44_41809_c1
1216 nmdc:mga0yw44_72443_c1
1217 nmdc:mga0yw44_889_c1
1218 nmdc:mga06z11_7115_c1
1219 nmdc:mga04h51_2660_c1
1220 nmdc:mga07m45_20395_c1
1221 nmdc:mga07m45_40255_c1
1222 nmdc:mga05p37_14632_c1
1223 nmdc:mga05p37_6897_c1
1224 nmdc:mga09592_2052_c1
1225 nmdc:mga09592_3497_c1
1226 nmdc:mga0qj67_21466_c1
1227 nmdc:mga0qj67_9107_c1
1228 nmdc:mga06r32_2152_c1
1229 nmdc:mga06r32_657_c1
1230 Ga0495619_0014384
1231 Ga0495619_0023279
1232 Ga0500556_0000498
1233 Ga0500572_018800
1234 Ga0500593_000073
1235 Ga0500616_0002468
1236 Ga0500634_0050445
1237 Ga0501084_0002400
1238 Ga0501084_0049460
1239 Ga0501084_0054959
1240 Ga0501082_0028110
1241 Ga0501082_0209351
1242 Ga0466962_0000132
1243 Ga0466962_0007121
1244 Ga0530510_0119076
1245 2644447324
1246 2515853467
1247 2547406085
1248 2554257524
1249 2585298466
1250 2585305769
1251 2585314553
1252 2616700356
1253 2616702148
1254 2616904202
1255 2643763141
1256 2643827091
1257 2643852023
1258 2643891100
1259 2643900154
1260 2643947908
1261 2643960156
1262 2644018196
1263 2644035105
1264 2644084480
1265 2644092350
1266 2644101219
1267 2644119375
1268 2644136544
1269 2644174234
1270 2644322153
1271 2644390654
1272 2644405622
1273 2644433774
1274 2644443085
1275 2644463989
1276 2644504288
1277 2644524185
1278 2644534444
1279 2644627103
1280 2644667097
1281 2644668284
1282 2676476242
1283 2729909446
1284 2731906329
1285 2738694421
1286 2738868856
1287 2739323897
1288 2739606812
1289 2760305300
1290 2760620892
1291 2774395494
1292 2784589026
1293 2785342821
1294 2785369982
1295 2804846350
1296 2808842476
1297 2808872181
1298 2808920982
1299 2809025677
1300 2809193671
1301 2809232629
1302 2810365967
1303 2811845747
1304 2812330266
1305 2812348400
1306 2812357625
1307 2812363224
1308 2812480145
1309 2816422170
1310 2819697309
1311 2819741603
1312 2827634073
1313 2835190844
1314 2837271804
1315 2839987377
1316 2852637297
1317 2856742563
1318 2857486169
1319 2862178944
1320 2862286080
1321 2862291389
1322 2862390462
1323 2862578835
1324 2863412710
1325 2867372470
1326 2867436428
1327 2867480430
1328 2868089949
1329 2873155323
1330 2875395176
1331 2877680645
1332 2883822341
1333 2884997538
1334 2887445199
1335 2891404150
1336 2891557232
1337 2891565058
1338 2891973865
1339 2905929976
1340 2912719360
1341 2912731426
1342 2918505148
1343 2919448574
1344 2919471860
1345 2932434060
1346 2935893626
1347 2946006374
1348 2946049479
1349 2946068231
1350 2946076366
1351 2947228692
1352 2954715776
1353 2954725713
1354 2954736087
1355 2954744667
1356 2954754947
1357 2966602107
1358 2966924527
1359 2990061623
1360 2995468739
1361 2997459035
1362 2997604669
1363 3001889909
1364 3006399589
1365 3006425746
1366 3006488476
1367 3006499407
1368 8004022992
1369 8004027201
1370 8008566818
1371 8023630516
1372 8025419892
1373 8025484246
1374 8025534435
1375 8047897583
1376 8048129619
1377 8048361287
1378 8048374570
1379 8048383652
1380 8048411529
1381 8054167443
1382 8056062490
1383 8056450059
1384 8056580224
1385 8056671979
1386 8056838043

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

79

239

0.99

PF01554

MatE

MatE

297

456

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7php-assembly1.cif.gz_A structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em 0.8976 3 404
7dqk-assembly1.cif.gz_A a nicotine mate transporter, nicotiana tabacum mate2 (ntmate2) 0.8948 4 403
6z70-assembly1.cif.gz_A structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.8924 4 399
4mlb-assembly1.cif.gz_C reverse polarity of binding pocket suggests different function of a mop superfamily transporter from pyrococcus furiosus vc1 (dsm3638) 0.8799 2 399
7php-assembly1.cif.gz_A structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em 0.8788 3 404
ID Description Score Start End Superfamily
af_P71616_19_179_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9802 15 171 1.20.1250.20
af_Q4DPE2_262_423_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.955 15 170 1.10.1760.20
af_I1LJ83_112_274_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9543 15 170 1.20.1250.20
af_U3Q0C3_281_442_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9515 15 163 1.20.1250.20
af_Q86VL8_297_458_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9504 15 165 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6C9EEC3-F1-model_v4 MATE family efflux transporter 0.9766 5 256 GO:0005886
GO:0015297
GO:0042910
AF-A0A6N9Y0U4-F1-model_v4 deleted 0.9661 17 251
AF-A0A7K2EE20-F1-model_v4 MATE family efflux transporter 0.9654 5 253 GO:0005886
GO:0015297
GO:0042910
AF-A0A382LGR4-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9621 27 224 GO:0005886
GO:0015297
GO:0042910
AF-A0A3M1DXV0-F1-model_v4 MATE family efflux transporter 0.9613 2 208 GO:0005886
GO:0015297
GO:0042910

Map