F475674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 318 | 1386 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300046689|Ga0495613_0000251|Ga0495613_0000251_32869_33960 |
| Length | 363 |
| Sequence | MRLNAHAIHNPSLPLPAMGRKQSYMDRNRPVGGYVTPRPTQRPLGVLVSEHEPVLAPELVSLLAPEPGQTAVDCTFGGGGHARQVAELIGPEGTLIGIDRDPAAEERFARFAAEAPCRTLFVGADFAAGLRALKGEGIRPDMVYMDLGMSSMQVDARERGFSYSYDAPLDMRMDTRQQFTAADLVNEWPEARIAQVLRRFGEERFAGGIAREIVRRRPLATTAELVEAIKAGMPASARFGAGHPAKRSFQAIRIAVNGELEALEEALPLAWSQLKVGGRFAAISFHSLEDRPVKQFLAAKARGCICPPELPVCVCGHEPEAELLTRRAIAPGAEEAERNPRSRSAHLRAALKIAEEQPVGEAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.02 |
| Nodule | 0 |
| Rhizoplane | 9.52 |
| Rhizosphere | 84.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495613_0000251 | 3300046689 | Bacteria | 50730 |
| 2 | JGI25407J50210_10014216 | 3300003373 | Bacteria | 2051 |
| 3 | JGI25404J52841_10000793 | 3300003659 | Bacteria | 5002 |
| 4 | Ga0070658_10039217 | 3300005327 | Bacteria | 3821 |
| 5 | Ga0070683_100000304 | 3300005329 | Bacteria | 33703 |
| 6 | Ga0070683_100113586 | 3300005329 | Bacteria | 2556 |
| 7 | Ga0070683_100249286 | 3300005329 | Bacteria | 1689 |
| 8 | Ga0070670_100019350 | 3300005331 | Bacteria | 5841 |
| 9 | Ga0070677_10000080 | 3300005333 | Bacteria | 30587 |
| 10 | Ga0070666_10192570 | 3300005335 | Bacteria | 1433 |
| 11 | Ga0070682_100000049 | 3300005337 | Bacteria | 127229 |
| 12 | Ga0070682_100028493 | 3300005337 | Bacteria | 3359 |
| 13 | Ga0068868_100000026 | 3300005338 | Bacteria | 81980 |
| 14 | Ga0068868_100009074 | 3300005338 | Bacteria | 7141 |
| 15 | Ga0070691_10000001 | 3300005341 | Bacteria | 94744 |
| 16 | Ga0070691_10033797 | 3300005341 | Bacteria | 2407 |
| 17 | Ga0070687_100073204 | 3300005343 | Bacteria | 1846 |
| 18 | Ga0070687_100098069 | 3300005343 | Bacteria | 1635 |
| 19 | Ga0070661_100000199 | 3300005344 | Bacteria | 49733 |
| 20 | Ga0070661_100144462 | 3300005344 | Bacteria | 1795 |
| 21 | Ga0070692_10026326 | 3300005345 | Bacteria | 2874 |
| 22 | Ga0070692_10170329 | 3300005345 | Bacteria | 1255 |
| 23 | Ga0070668_100029394 | 3300005347 | Bacteria | 4174 |
| 24 | Ga0070668_100031712 | 3300005347 | Bacteria | 4021 |
| 25 | Ga0070675_100000025 | 3300005354 | Bacteria | 115134 |
| 26 | Ga0070675_100074129 | 3300005354 | Bacteria | 2827 |
| 27 | Ga0070674_100000017 | 3300005356 | Bacteria | 90884 |
| 28 | Ga0070674_100000036 | 3300005356 | Bacteria | 60112 |
| 29 | Ga0070674_100043648 | 3300005356 | Bacteria | 3051 |
| 30 | Ga0070673_100002732 | 3300005364 | Bacteria | 10833 |
| 31 | Ga0070688_100000099 | 3300005365 | Bacteria | 44288 |
| 32 | Ga0070688_100000149 | 3300005365 | Bacteria | 37792 |
| 33 | Ga0070688_100146351 | 3300005365 | Bacteria | 1610 |
| 34 | Ga0070659_100000450 | 3300005366 | Bacteria | 30693 |
| 35 | Ga0070659_100006552 | 3300005366 | Bacteria | 8408 |
| 36 | Ga0070667_100004045 | 3300005367 | Bacteria | 12401 |
| 37 | Ga0070667_100035781 | 3300005367 | Bacteria | 4160 |
| 38 | Ga0070714_100027127 | 3300005435 | Bacteria | 4739 |
| 39 | Ga0070714_100204417 | 3300005435 | Bacteria | 1808 |
| 40 | Ga0070713_100000092 | 3300005436 | Bacteria | 57390 |
| 41 | Ga0070713_100055786 | 3300005436 | Bacteria | 3285 |
| 42 | Ga0070711_100024080 | 3300005439 | Bacteria | 3967 |
| 43 | Ga0070711_100025475 | 3300005439 | Bacteria | 3871 |
| 44 | Ga0070705_100199020 | 3300005440 | Bacteria | 1372 |
| 45 | Ga0070700_100003404 | 3300005441 | Bacteria | 8198 |
| 46 | Ga0070694_100098851 | 3300005444 | Bacteria | 2061 |
| 47 | Ga0070708_100032920 | 3300005445 | Bacteria | 4500 |
| 48 | Ga0070678_100007668 | 3300005456 | Bacteria | 6416 |
| 49 | Ga0070678_100011965 | 3300005456 | Bacteria | 5374 |
| 50 | Ga0070678_100016370 | 3300005456 | Bacteria | 4743 |
| 51 | Ga0070678_100046920 | 3300005456 | Bacteria | 3101 |
| 52 | Ga0070678_100078790 | 3300005456 | Bacteria | 2490 |
| 53 | Ga0070662_100000009 | 3300005457 | Bacteria | 142979 |
| 54 | Ga0068867_100000373 | 3300005459 | Bacteria | 29787 |
| 55 | Ga0068867_100077428 | 3300005459 | Bacteria | 2499 |
| 56 | Ga0070685_10000024 | 3300005466 | Bacteria | 101602 |
| 57 | Ga0070685_10000025 | 3300005466 | Bacteria | 100621 |
| 58 | Ga0070685_10065267 | 3300005466 | Bacteria | 2142 |
| 59 | Ga0070685_10080213 | 3300005466 | Bacteria | 1955 |
| 60 | Ga0070706_100137280 | 3300005467 | Bacteria | 2282 |
| 61 | Ga0070698_100050694 | 3300005471 | Bacteria | 4230 |
| 62 | Ga0070699_100475488 | 3300005518 | Bacteria | 1134 |
| 63 | Ga0070679_100000245 | 3300005530 | Bacteria | 45408 |
| 64 | Ga0070679_100005505 | 3300005530 | Bacteria | 11738 |
| 65 | Ga0070679_100205506 | 3300005530 | Bacteria | 1934 |
| 66 | Ga0070684_100002617 | 3300005535 | Bacteria | 13300 |
| 67 | Ga0070684_100109965 | 3300005535 | Bacteria | 2470 |
| 68 | Ga0070684_100409092 | 3300005535 | Bacteria | 1251 |
| 69 | Ga0070697_100009241 | 3300005536 | Bacteria | 7704 |
| 70 | Ga0070697_100110454 | 3300005536 | Bacteria | 2291 |
| 71 | Ga0068853_100157698 | 3300005539 | Bacteria | 2046 |
| 72 | Ga0068853_100159919 | 3300005539 | Bacteria | 2032 |
| 73 | Ga0070672_100000025 | 3300005543 | Bacteria | 67313 |
| 74 | Ga0070672_100002648 | 3300005543 | Bacteria | 11432 |
| 75 | Ga0070686_100010578 | 3300005544 | Bacteria | 5208 |
| 76 | Ga0070686_100264468 | 3300005544 | Bacteria | 1262 |
| 77 | Ga0070695_100091180 | 3300005545 | Bacteria | 2035 |
| 78 | Ga0070693_100001584 | 3300005547 | Bacteria | 10241 |
| 79 | Ga0070693_100040032 | 3300005547 | Bacteria | 2629 |
| 80 | Ga0070665_100000138 | 3300005548 | Bacteria | 136562 |
| 81 | Ga0070665_100003670 | 3300005548 | Bacteria | 16268 |
| 82 | Ga0070665_100148648 | 3300005548 | Bacteria | 2346 |
| 83 | Ga0070664_100115870 | 3300005564 | Bacteria | 2342 |
| 84 | Ga0070664_100244154 | 3300005564 | Bacteria | 1612 |
| 85 | Ga0068857_100386196 | 3300005577 | Bacteria | 1301 |
| 86 | Ga0068854_100005748 | 3300005578 | Bacteria | 7847 |
| 87 | Ga0068854_100061027 | 3300005578 | Bacteria | 2730 |
| 88 | Ga0068856_100000635 | 3300005614 | Bacteria | 38196 |
| 89 | Ga0068856_100021194 | 3300005614 | Bacteria | 6312 |
| 90 | Ga0068856_100048107 | 3300005614 | Bacteria | 4202 |
| 91 | Ga0068856_100049917 | 3300005614 | Bacteria | 4124 |
| 92 | Ga0070702_100005226 | 3300005615 | Bacteria | 6016 |
| 93 | Ga0070702_100023449 | 3300005615 | Bacteria | 3279 |
| 94 | Ga0068852_100000006 | 3300005616 | Bacteria | 159569 |
| 95 | Ga0068852_100006354 | 3300005616 | Bacteria | 8532 |
| 96 | Ga0068864_100000031 | 3300005618 | Bacteria | 215331 |
| 97 | Ga0068864_100140195 | 3300005618 | Bacteria | 2180 |
| 98 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 99 | Ga0068866_10002691 | 3300005718 | Bacteria | 7335 |
| 100 | Ga0068861_100010447 | 3300005719 | Bacteria | 6444 |
| 101 | Ga0068851_10002288 | 3300005834 | Bacteria | 8417 |
| 102 | Ga0068863_100000170 | 3300005841 | Bacteria | 70180 |
| 103 | Ga0068863_100032980 | 3300005841 | Bacteria | 4934 |
| 104 | Ga0068863_100144131 | 3300005841 | Bacteria | 2278 |
| 105 | Ga0068863_100426104 | 3300005841 | Bacteria | 1300 |
| 106 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 107 | Ga0068858_100000284 | 3300005842 | Bacteria | 54715 |
| 108 | Ga0068858_100046395 | 3300005842 | Bacteria | 4028 |
| 109 | Ga0068858_100066379 | 3300005842 | Bacteria | 3340 |
| 110 | Ga0068860_100067471 | 3300005843 | Bacteria | 3399 |
| 111 | Ga0068862_100001788 | 3300005844 | Bacteria | 19447 |
| 112 | Ga0068862_100221212 | 3300005844 | Bacteria | 1714 |
| 113 | Ga0081455_10011165 | 3300005937 | Bacteria | 9042 |
| 114 | Ga0081455_10037916 | 3300005937 | Bacteria | 4271 |
| 115 | Ga0081455_10062272 | 3300005937 | Bacteria | 3136 |
| 116 | Ga0081455_10068115 | 3300005937 | Bacteria | 2964 |
| 117 | Ga0081455_10077985 | 3300005937 | Bacteria | 2723 |
| 118 | Ga0081455_10136608 | 3300005937 | Bacteria | 1910 |
| 119 | Ga0081455_10264495 | 3300005937 | Bacteria | 1251 |
| 120 | Ga0081538_10001175 | 3300005981 | Bacteria | 27654 |
| 121 | Ga0081538_10027244 | 3300005981 | Bacteria | 3968 |
| 122 | Ga0081540_1001221 | 3300005983 | Bacteria | 22444 |
| 123 | Ga0081540_1005597 | 3300005983 | Bacteria | 9351 |
| 124 | Ga0081540_1048652 | 3300005983 | Bacteria | 2121 |
| 125 | Ga0081539_10001019 | 3300005985 | Bacteria | 51621 |
| 126 | Ga0081539_10003364 | 3300005985 | Bacteria | 19793 |
| 127 | Ga0075365_10000650 | 3300006038 | Bacteria | 13823 |
| 128 | Ga0075365_10001126 | 3300006038 | Bacteria | 11685 |
| 129 | Ga0075365_10073744 | 3300006038 | Bacteria | 2301 |
| 130 | Ga0075365_10203332 | 3300006038 | Bacteria | 1388 |
| 131 | Ga0075363_100005236 | 3300006048 | Bacteria | 5748 |
| 132 | Ga0075364_10006399 | 3300006051 | Bacteria | 6924 |
| 133 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 134 | Ga0070712_100005336 | 3300006175 | Bacteria | 7957 |
| 135 | Ga0070712_100018647 | 3300006175 | Bacteria | 4511 |
| 136 | Ga0070712_100026979 | 3300006175 | Bacteria | 3832 |
| 137 | Ga0070712_100148942 | 3300006175 | Bacteria | 1794 |
| 138 | Ga0097621_100012319 | 3300006237 | Bacteria | 6333 |
| 139 | Ga0068871_100015248 | 3300006358 | Bacteria | 5748 |
| 140 | Ga0068871_100368322 | 3300006358 | Bacteria | 1274 |
| 141 | Ga0075428_100121143 | 3300006844 | Bacteria | 2849 |
| 142 | Ga0075428_100305686 | 3300006844 | Bacteria | 1710 |
| 143 | Ga0075430_100011635 | 3300006846 | Bacteria | 7485 |
| 144 | Ga0075430_100034624 | 3300006846 | Bacteria | 4287 |
| 145 | Ga0075431_100002057 | 3300006847 | Bacteria | 19215 |
| 146 | Ga0075431_100010590 | 3300006847 | Bacteria | 9273 |
| 147 | Ga0075431_100061735 | 3300006847 | Bacteria | 3867 |
| 148 | Ga0075431_100111215 | 3300006847 | Bacteria | 2827 |
| 149 | Ga0075433_10000851 | 3300006852 | Bacteria | 21420 |
| 150 | Ga0075433_10001372 | 3300006852 | Bacteria | 17884 |
| 151 | Ga0075433_10463043 | 3300006852 | Bacteria | 1117 |
| 152 | Ga0075434_100112519 | 3300006871 | Bacteria | 2734 |
| 153 | Ga0075429_100011779 | 3300006880 | Bacteria | 7582 |
| 154 | Ga0068865_100000034 | 3300006881 | Bacteria | 84043 |
| 155 | Ga0068865_100066436 | 3300006881 | Bacteria | 2544 |
| 156 | Ga0111539_10154863 | 3300009094 | Bacteria | 2682 |
| 157 | Ga0105245_10000020 | 3300009098 | Bacteria | 181774 |
| 158 | Ga0105245_10000135 | 3300009098 | Bacteria | 70480 |
| 159 | Ga0105245_10000179 | 3300009098 | Bacteria | 60347 |
| 160 | Ga0105245_10006638 | 3300009098 | Bacteria | 10160 |
| 161 | Ga0105245_10270586 | 3300009098 | Bacteria | 1657 |
| 162 | Ga0105247_10001358 | 3300009101 | Bacteria | 17785 |
| 163 | Ga0105247_10010658 | 3300009101 | Bacteria | 5549 |
| 164 | Ga0105247_10095423 | 3300009101 | Bacteria | 1894 |
| 165 | Ga0105247_10123172 | 3300009101 | Bacteria | 1682 |
| 166 | Ga0114129_10046738 | 3300009147 | Bacteria | 6083 |
| 167 | Ga0105243_10009674 | 3300009148 | Bacteria | 7339 |
| 168 | Ga0105243_10038569 | 3300009148 | Bacteria | 3721 |
| 169 | Ga0105243_10073144 | 3300009148 | Bacteria | 2777 |
| 170 | Ga0105241_10240882 | 3300009174 | Bacteria | 1529 |
| 171 | Ga0105241_10394818 | 3300009174 | Bacteria | 1212 |
| 172 | Ga0105242_10000397 | 3300009176 | Bacteria | 34573 |
| 173 | Ga0105242_10002932 | 3300009176 | Bacteria | 13333 |
| 174 | Ga0105242_10013726 | 3300009176 | Bacteria | 6270 |
| 175 | Ga0105242_10032714 | 3300009176 | Bacteria | 4160 |
| 176 | Ga0105242_10273450 | 3300009176 | Bacteria | 1531 |
| 177 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 178 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 179 | Ga0105249_10000080 | 3300009553 | Bacteria | 138080 |
| 180 | Ga0105249_10000957 | 3300009553 | Bacteria | 25542 |
| 181 | Ga0105249_10007538 | 3300009553 | Bacteria | 9493 |
| 182 | Ga0105239_10071769 | 3300010375 | Bacteria | 3804 |
| 183 | Ga0105239_10417218 | 3300010375 | Bacteria | 1520 |
| 184 | Ga0157371_10044208 | 3300013102 | Bacteria | 3172 |
| 185 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 186 | Ga0157374_10015508 | 3300013296 | Bacteria | 6684 |
| 187 | Ga0157374_10203702 | 3300013296 | Bacteria | 1938 |
| 188 | Ga0157374_10474835 | 3300013296 | Bacteria | 1253 |
| 189 | Ga0157378_10001054 | 3300013297 | Bacteria | 25233 |
| 190 | Ga0157378_10015848 | 3300013297 | Bacteria | 6600 |
| 191 | Ga0157375_10001512 | 3300013308 | Bacteria | 19993 |
| 192 | Ga0157375_10009995 | 3300013308 | Bacteria | 8340 |
| 193 | Ga0157375_10011379 | 3300013308 | Bacteria | 7854 |
| 194 | Ga0163163_10051500 | 3300014325 | Bacteria | 4060 |
| 195 | Ga0157380_10000037 | 3300014326 | Bacteria | 80856 |
| 196 | Ga0157380_10016506 | 3300014326 | Bacteria | 5447 |
| 197 | Ga0157380_10021928 | 3300014326 | Bacteria | 4797 |
| 198 | Ga0157377_10002154 | 3300014745 | Bacteria | 8644 |
| 199 | Ga0157379_10003237 | 3300014968 | Bacteria | 13807 |
| 200 | Ga0157379_10019863 | 3300014968 | Bacteria | 5935 |
| 201 | Ga0157379_10050430 | 3300014968 | Bacteria | 3715 |
| 202 | Ga0157379_10152892 | 3300014968 | Bacteria | 2082 |
| 203 | Ga0157376_10005772 | 3300014969 | Bacteria | 8671 |
| 204 | Ga0157376_10458771 | 3300014969 | Bacteria | 1245 |
| 205 | Ga0163161_10000021 | 3300017792 | Bacteria | 208779 |
| 206 | Ga0163161_10215864 | 3300017792 | Bacteria | 1483 |
| 207 | Ga0163161_10232353 | 3300017792 | Bacteria | 1431 |
| 208 | Ga0213873_10015585 | 3300021358 | Bacteria | 1705 |
| 209 | Ga0213874_10002024 | 3300021377 | Bacteria | 4283 |
| 210 | Ga0213876_10076534 | 3300021384 | Bacteria | 1767 |
| 211 | Ga0213875_10053685 | 3300021388 | Bacteria | 1887 |
| 212 | Ga0213875_10087969 | 3300021388 | Bacteria | 1449 |
| 213 | Ga0207656_10000433 | 3300025321 | Bacteria | 14013 |
| 214 | Ga0207656_10008200 | 3300025321 | Bacteria | 3834 |
| 215 | Ga0207682_10000045 | 3300025893 | Bacteria | 51744 |
| 216 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 217 | Ga0207642_10010260 | 3300025899 | Bacteria | 3294 |
| 218 | Ga0207642_10197191 | 3300025899 | Bacteria | 1109 |
| 219 | Ga0207710_10000180 | 3300025900 | Bacteria | 63999 |
| 220 | Ga0207710_10012329 | 3300025900 | Bacteria | 3596 |
| 221 | Ga0207680_10055600 | 3300025903 | Bacteria | 2386 |
| 222 | Ga0207680_10148506 | 3300025903 | Bacteria | 1561 |
| 223 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 224 | Ga0207685_10001653 | 3300025905 | Bacteria | 4789 |
| 225 | Ga0207699_10134105 | 3300025906 | Bacteria | 1619 |
| 226 | Ga0207645_10259290 | 3300025907 | Bacteria | 1151 |
| 227 | Ga0207654_10140098 | 3300025911 | Bacteria | 1541 |
| 228 | Ga0207671_10207320 | 3300025914 | Bacteria | 1532 |
| 229 | Ga0207693_10001859 | 3300025915 | Bacteria | 18493 |
| 230 | Ga0207693_10009829 | 3300025915 | Bacteria | 7784 |
| 231 | Ga0207693_10034785 | 3300025915 | Bacteria | 3973 |
| 232 | Ga0207663_10017369 | 3300025916 | Bacteria | 4008 |
| 233 | Ga0207663_10044354 | 3300025916 | Bacteria | 2729 |
| 234 | Ga0207663_10114985 | 3300025916 | Bacteria | 1833 |
| 235 | Ga0207657_10000904 | 3300025919 | Bacteria | 31337 |
| 236 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 237 | Ga0207649_10011457 | 3300025920 | Bacteria | 4890 |
| 238 | Ga0207652_10000773 | 3300025921 | Bacteria | 30640 |
| 239 | Ga0207652_10000930 | 3300025921 | Bacteria | 27515 |
| 240 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 241 | Ga0207659_10000033 | 3300025926 | Bacteria | 113729 |
| 242 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 243 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 244 | Ga0207687_10005615 | 3300025927 | Bacteria | 8292 |
| 245 | Ga0207687_10156353 | 3300025927 | Bacteria | 1745 |
| 246 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 247 | Ga0207700_10014296 | 3300025928 | Bacteria | 5197 |
| 248 | Ga0207664_10014592 | 3300025929 | Bacteria | 5680 |
| 249 | Ga0207664_10112675 | 3300025929 | Bacteria | 2265 |
| 250 | Ga0207664_10143802 | 3300025929 | Bacteria | 2021 |
| 251 | Ga0207664_10181813 | 3300025929 | Bacteria | 1805 |
| 252 | Ga0207644_10173154 | 3300025931 | Bacteria | 1687 |
| 253 | Ga0207690_10004725 | 3300025932 | Bacteria | 8045 |
| 254 | Ga0207690_10009017 | 3300025932 | Bacteria | 5921 |
| 255 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 256 | Ga0207706_10003574 | 3300025933 | Bacteria | 14847 |
| 257 | Ga0207686_10000252 | 3300025934 | Bacteria | 40825 |
| 258 | Ga0207686_10000580 | 3300025934 | Bacteria | 22945 |
| 259 | Ga0207686_10012562 | 3300025934 | Bacteria | 4658 |
| 260 | Ga0207686_10111262 | 3300025934 | Bacteria | 1848 |
| 261 | Ga0207709_10002134 | 3300025935 | Bacteria | 12691 |
| 262 | Ga0207709_10008995 | 3300025935 | Bacteria | 5505 |
| 263 | Ga0207709_10025574 | 3300025935 | Bacteria | 3381 |
| 264 | Ga0207709_10074131 | 3300025935 | Bacteria | 2171 |
| 265 | Ga0207670_10075841 | 3300025936 | Bacteria | 2338 |
| 266 | Ga0207670_10314560 | 3300025936 | Bacteria | 1230 |
| 267 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 268 | Ga0207669_10000049 | 3300025937 | Bacteria | 60278 |
| 269 | Ga0207704_10000059 | 3300025938 | Bacteria | 76643 |
| 270 | Ga0207704_10041470 | 3300025938 | Bacteria | 2700 |
| 271 | Ga0207665_10011176 | 3300025939 | Bacteria | 5892 |
| 272 | Ga0207691_10000135 | 3300025940 | Bacteria | 67302 |
| 273 | Ga0207691_10004548 | 3300025940 | Bacteria | 13426 |
| 274 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 275 | Ga0207661_10000056 | 3300025944 | Bacteria | 85250 |
| 276 | Ga0207661_10000986 | 3300025944 | Bacteria | 18816 |
| 277 | Ga0207661_10031274 | 3300025944 | Bacteria | 4109 |
| 278 | Ga0207661_10122391 | 3300025944 | Bacteria | 2217 |
| 279 | Ga0207661_10145743 | 3300025944 | Bacteria | 2042 |
| 280 | Ga0207679_10011340 | 3300025945 | Bacteria | 5766 |
| 281 | Ga0207679_10053168 | 3300025945 | Bacteria | 2974 |
| 282 | Ga0207667_10200913 | 3300025949 | Bacteria | 2045 |
| 283 | Ga0207651_10001434 | 3300025960 | Bacteria | 10856 |
| 284 | Ga0207712_10439388 | 3300025961 | Bacteria | 1104 |
| 285 | Ga0207668_10071877 | 3300025972 | Bacteria | 2473 |
| 286 | Ga0207668_10135295 | 3300025972 | Bacteria | 1888 |
| 287 | Ga0207668_10157367 | 3300025972 | Bacteria | 1766 |
| 288 | Ga0207640_10000151 | 3300025981 | Bacteria | 50644 |
| 289 | Ga0207640_10052291 | 3300025981 | Bacteria | 2660 |
| 290 | Ga0207640_10058835 | 3300025981 | Bacteria | 2534 |
| 291 | Ga0207658_10023437 | 3300025986 | Bacteria | 4308 |
| 292 | Ga0207677_10000106 | 3300026023 | Bacteria | 68108 |
| 293 | Ga0207677_10036116 | 3300026023 | Bacteria | 3217 |
| 294 | Ga0207677_10071148 | 3300026023 | Bacteria | 2454 |
| 295 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 296 | Ga0207703_10000207 | 3300026035 | Bacteria | 68866 |
| 297 | Ga0207703_10205014 | 3300026035 | Bacteria | 1754 |
| 298 | Ga0207639_10117831 | 3300026041 | Bacteria | 2176 |
| 299 | Ga0207639_10136690 | 3300026041 | Bacteria | 2037 |
| 300 | Ga0207678_10042291 | 3300026067 | Bacteria | 3948 |
| 301 | Ga0207708_10007274 | 3300026075 | Bacteria | 8185 |
| 302 | Ga0207708_10299209 | 3300026075 | Bacteria | 1308 |
| 303 | Ga0207702_10000360 | 3300026078 | Bacteria | 52006 |
| 304 | Ga0207702_10006968 | 3300026078 | Bacteria | 9679 |
| 305 | Ga0207641_10000301 | 3300026088 | Bacteria | 61780 |
| 306 | Ga0207641_10008098 | 3300026088 | Bacteria | 8706 |
| 307 | Ga0207641_10445341 | 3300026088 | Bacteria | 1251 |
| 308 | Ga0207648_10000630 | 3300026089 | Bacteria | 39502 |
| 309 | Ga0207648_10022306 | 3300026089 | Bacteria | 5688 |
| 310 | Ga0207648_10069224 | 3300026089 | Bacteria | 3075 |
| 311 | Ga0207676_10000031 | 3300026095 | Bacteria | 215877 |
| 312 | Ga0207675_100036553 | 3300026118 | Bacteria | 4581 |
| 313 | Ga0207683_10000767 | 3300026121 | Bacteria | 29194 |
| 314 | Ga0207683_10024270 | 3300026121 | Bacteria | 5220 |
| 315 | Ga0207683_10045765 | 3300026121 | Bacteria | 3827 |
| 316 | Ga0207683_10087361 | 3300026121 | Bacteria | 2773 |
| 317 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 318 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 319 | Ga0268266_10000247 | 3300028379 | Bacteria | 91489 |
| 320 | Ga0268266_10002714 | 3300028379 | Bacteria | 18561 |
| 321 | Ga0268266_10161069 | 3300028379 | Bacteria | 2030 |
| 322 | Ga0268266_10237044 | 3300028379 | Bacteria | 1682 |
| 323 | Ga0268266_10350007 | 3300028379 | Bacteria | 1388 |
| 324 | Ga0268265_10230115 | 3300028380 | Bacteria | 1629 |
| 325 | Ga0268264_10004510 | 3300028381 | Bacteria | 11878 |
| 326 | Ga0268264_10040469 | 3300028381 | Bacteria | 3851 |
| 327 | Ga0265337_1000011 | 3300028556 | Bacteria | 87087 |
| 328 | Ga0265326_10000066 | 3300028558 | Bacteria | 59893 |
| 329 | Ga0265319_1004499 | 3300028563 | Bacteria | 6887 |
| 330 | Ga0265334_10008873 | 3300028573 | Bacteria | 4269 |
| 331 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 332 | Ga0265336_10009682 | 3300028666 | Bacteria | 3326 |
| 333 | Ga0265336_10062032 | 3300028666 | Bacteria | 1121 |
| 334 | Ga0265338_10002303 | 3300028800 | Bacteria | 29010 |
| 335 | Ga0307511_10063461 | 3300030521 | Bacteria | 2790 |
| 336 | Ga0265332_10008057 | 3300031238 | Bacteria | 4742 |
| 337 | Ga0265328_10000527 | 3300031239 | Bacteria | 17837 |
| 338 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 339 | Ga0265320_10022793 | 3300031240 | Bacteria | 3343 |
| 340 | Ga0265325_10035510 | 3300031241 | Bacteria | 2647 |
| 341 | Ga0265329_10006798 | 3300031242 | Bacteria | 4498 |
| 342 | Ga0265339_10018899 | 3300031249 | Bacteria | 4054 |
| 343 | Ga0265331_10069122 | 3300031250 | Bacteria | 1655 |
| 344 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 345 | Ga0265316_10027016 | 3300031344 | Bacteria | 4763 |
| 346 | Ga0265316_10096267 | 3300031344 | Bacteria | 2254 |
| 347 | Ga0265314_10000726 | 3300031711 | Bacteria | 39827 |
| 348 | Ga0265314_10034352 | 3300031711 | Bacteria | 3707 |
| 349 | Ga0307413_10061245 | 3300031824 | Bacteria | 2321 |
| 350 | Ga0307406_10359763 | 3300031901 | Bacteria | 1140 |
| 351 | Ga0373937_0014366 | 3300036401 | Bacteria | 6990 |
| 352 | Ga0373937_0023066 | 3300036401 | Bacteria | 5600 |
| 353 | Ga0316584_0035780 | 3300036712 | Bacteria | 3684 |
| 354 | Ga0395898_0000631 | 3300037466 | Bacteria | 64382 |
| 355 | Ga0436364_0827185 | 3300037853 | Bacteria | 1890 |
| 356 | Ga0436365_0029559 | 3300039437 | Bacteria | 1641 |
| 357 | Ga0436365_0329260 | 3300039437 | Bacteria | 3690 |
| 358 | Ga0436365_0577046 | 3300039437 | Bacteria | 8056 |
| 359 | Ga0436363_0185144 | 3300039450 | Bacteria | 2203 |
| 360 | Ga0436363_0500250 | 3300039450 | Bacteria | 2757 |
| 361 | Ga0436363_0736430 | 3300039450 | Bacteria | 18930 |
| 362 | Ga0436363_1264088 | 3300039450 | Bacteria | 2186 |
| 363 | Ga0436363_1357047 | 3300039450 | Unclassified | 1707 |
| 364 | Ga0436362_0716588 | 3300039453 | Bacteria | 3148 |
| 365 | Ga0466969_0022365 | 3300044656 | Bacteria | 3264 |
| 366 | Ga0466972_0068713 | 3300044658 | Bacteria | 1692 |
| 367 | Ga0466965_0066454 | 3300044683 | Bacteria | 1808 |
| 368 | Ga0466966_0045956 | 3300044684 | Bacteria | 2790 |
| 369 | Ga0466966_0067064 | 3300044684 | Bacteria | 2255 |
| 370 | Ga0466966_0112910 | 3300044684 | Bacteria | 1674 |
| 371 | Ga0466961_0003650 | 3300044693 | Bacteria | 9596 |
| 372 | Ga0466961_0007158 | 3300044693 | Bacteria | 7098 |
| 373 | Ga0466963_0000067 | 3300044694 | Bacteria | 35973 |
| 374 | Ga0466963_0002060 | 3300044694 | Bacteria | 11091 |
| 375 | Ga0466963_0016290 | 3300044694 | Bacteria | 4620 |
| 376 | Ga0466963_0016909 | 3300044694 | Bacteria | 4543 |
| 377 | Ga0466963_0097464 | 3300044694 | Bacteria | 2009 |
| 378 | Ga0466963_0218589 | 3300044694 | Bacteria | 1334 |
| 379 | Ga0466968_0071940 | 3300044735 | Bacteria | 1507 |
| 380 | Ga0466968_0105701 | 3300044735 | Bacteria | 1261 |
| 381 | Ga0466970_0017739 | 3300044765 | Bacteria | 3681 |
| 382 | Ga0466957_0037810 | 3300044842 | Bacteria | 2906 |
| 383 | Ga0466957_0079011 | 3300044842 | Bacteria | 2046 |
| 384 | Ga0466957_0094133 | 3300044842 | Bacteria | 1881 |
| 385 | Ga0466957_0106350 | 3300044842 | Bacteria | 1774 |
| 386 | Ga0466957_0110853 | 3300044842 | Bacteria | 1740 |
| 387 | Ga0466959_0002580 | 3300045049 | Bacteria | 11632 |
| 388 | Ga0466959_0078189 | 3300045049 | Bacteria | 2386 |
| 389 | Ga0466959_0271191 | 3300045049 | Bacteria | 1166 |
| 390 | Ga0466959_0273657 | 3300045049 | Bacteria | 1160 |
| 391 | Ga0466958_0042899 | 3300045836 | Bacteria | 2723 |
| 392 | Ga0466958_0059927 | 3300045836 | Bacteria | 2316 |
| 393 | Ga0466958_0071542 | 3300045836 | Bacteria | 2124 |
| 394 | Ga0466958_0089284 | 3300045836 | Bacteria | 1905 |
| 395 | Ga0466958_0091238 | 3300045836 | Bacteria | 1886 |
| 396 | Ga0466958_0093905 | 3300045836 | Bacteria | 1858 |
| 397 | Ga0466958_0178629 | 3300045836 | Bacteria | 1346 |
| 398 | Ga0466967_0000038 | 3300045976 | Bacteria | 49163 |
| 399 | Ga0466967_0037191 | 3300045976 | Bacteria | 4163 |
| 400 | Ga0495592_0015306 | 3300046454 | Bacteria | 5820 |
| 401 | Ga0495592_0059345 | 3300046454 | Bacteria | 2818 |
| 402 | Ga0495592_0068929 | 3300046454 | Bacteria | 2580 |
| 403 | Ga0495603_0000258 | 3300046455 | Bacteria | 27900 |
| 404 | Ga0495603_0002143 | 3300046455 | Bacteria | 11616 |
| 405 | Ga0495603_0026490 | 3300046455 | Bacteria | 3502 |
| 406 | Ga0495603_0102924 | 3300046455 | Bacteria | 1667 |
| 407 | Ga0495629_0000145 | 3300046459 | Bacteria | 61915 |
| 408 | Ga0495629_0005376 | 3300046459 | Bacteria | 9559 |
| 409 | Ga0495629_0037344 | 3300046459 | Bacteria | 3424 |
| 410 | Ga0495629_0040071 | 3300046459 | Bacteria | 3296 |
| 411 | Ga0495629_0154081 | 3300046459 | Bacteria | 1597 |
| 412 | Ga0495641_0000029 | 3300046461 | Bacteria | 97259 |
| 413 | Ga0495641_0017175 | 3300046461 | Bacteria | 3780 |
| 414 | Ga0495651_0044196 | 3300046462 | Bacteria | 3453 |
| 415 | Ga0495651_0064630 | 3300046462 | Bacteria | 2796 |
| 416 | Ga0495653_0037024 | 3300046463 | Bacteria | 3838 |
| 417 | Ga0495653_0083103 | 3300046463 | Bacteria | 2362 |
| 418 | Ga0495582_0000004 | 3300046473 | Bacteria | 168322 |
| 419 | Ga0495639_0047087 | 3300046475 | Bacteria | 1953 |
| 420 | Ga0495662_0000421 | 3300046476 | Bacteria | 18951 |
| 421 | Ga0495662_0009449 | 3300046476 | Bacteria | 4781 |
| 422 | Ga0495664_0065078 | 3300046477 | Bacteria | 2173 |
| 423 | Ga0495594_0000010 | 3300046499 | Bacteria | 118481 |
| 424 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 425 | Ga0495608_0000023 | 3300046511 | Bacteria | 160090 |
| 426 | Ga0495608_0000080 | 3300046511 | Bacteria | 71060 |
| 427 | Ga0495608_0037255 | 3300046511 | Bacteria | 3270 |
| 428 | Ga0495618_0000008 | 3300046514 | Bacteria | 204578 |
| 429 | Ga0495618_0121378 | 3300046514 | Bacteria | 1674 |
| 430 | Ga0495620_0000820 | 3300046515 | Bacteria | 19163 |
| 431 | Ga0495628_0000165 | 3300046516 | Bacteria | 57669 |
| 432 | Ga0495628_0048885 | 3300046516 | Bacteria | 3350 |
| 433 | Ga0495628_0078535 | 3300046516 | Bacteria | 2567 |
| 434 | Ga0495628_0148037 | 3300046516 | Bacteria | 1789 |
| 435 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 436 | Ga0495630_0000145 | 3300046517 | Bacteria | 54974 |
| 437 | Ga0495630_0007281 | 3300046517 | Bacteria | 7896 |
| 438 | Ga0495652_0001047 | 3300046529 | Bacteria | 31506 |
| 439 | Ga0495640_0042435 | 3300046533 | Bacteria | 3174 |
| 440 | Ga0495640_0073823 | 3300046533 | Bacteria | 2283 |
| 441 | Ga0495586_0002129 | 3300046535 | Bacteria | 10767 |
| 442 | Ga0495587_0006985 | 3300046536 | Bacteria | 7331 |
| 443 | Ga0495621_0045101 | 3300046539 | Bacteria | 1560 |
| 444 | Ga0495645_0002645 | 3300046543 | Bacteria | 12187 |
| 445 | Ga0495645_0053939 | 3300046543 | Bacteria | 2921 |
| 446 | Ga0495622_0000104 | 3300046557 | Bacteria | 73828 |
| 447 | Ga0495667_0000047 | 3300046559 | Bacteria | 117718 |
| 448 | Ga0495667_0030795 | 3300046559 | Bacteria | 3605 |
| 449 | Ga0495667_0134520 | 3300046559 | Bacteria | 1594 |
| 450 | Ga0495656_0000210 | 3300046615 | Bacteria | 20852 |
| 451 | Ga0495634_0000034 | 3300046642 | Bacteria | 106338 |
| 452 | Ga0495634_0001103 | 3300046642 | Bacteria | 25051 |
| 453 | Ga0495634_0042297 | 3300046642 | Bacteria | 3091 |
| 454 | Ga0495634_0043409 | 3300046642 | Bacteria | 3047 |
| 455 | Ga0495634_0105594 | 3300046642 | Bacteria | 1816 |
| 456 | Ga0495625_0011117 | 3300046660 | Bacteria | 7372 |
| 457 | Ga0495625_0115489 | 3300046660 | Bacteria | 1832 |
| 458 | Ga0495635_0000034 | 3300046663 | Bacteria | 96408 |
| 459 | Ga0495635_0160634 | 3300046663 | Bacteria | 1529 |
| 460 | Ga0495588_0000244 | 3300046674 | Bacteria | 45880 |
| 461 | Ga0495588_0078187 | 3300046674 | Bacteria | 1726 |
| 462 | Ga0495588_0179644 | 3300046674 | Bacteria | 1118 |
| 463 | Ga0495657_0000020 | 3300046675 | Bacteria | 160089 |
| 464 | Ga0495657_0016735 | 3300046675 | Bacteria | 5335 |
| 465 | Ga0495647_0000017 | 3300046681 | Bacteria | 83387 |
| 466 | Ga0495647_0000098 | 3300046681 | Bacteria | 21789 |
| 467 | Ga0495647_0007586 | 3300046681 | Bacteria | 3641 |
| 468 | Ga0495647_0037691 | 3300046681 | Bacteria | 1826 |
| 469 | Ga0495658_0000004 | 3300046683 | Bacteria | 173598 |
| 470 | Ga0495658_0002109 | 3300046683 | Bacteria | 10095 |
| 471 | Ga0495658_0065104 | 3300046683 | Bacteria | 2102 |
| 472 | Ga0495669_0000030 | 3300046684 | Bacteria | 102988 |
| 473 | Ga0495613_0000124 | 3300046689 | Bacteria | 75971 |
| 474 | Ga0495613_0032679 | 3300046689 | Bacteria | 3866 |
| 475 | Ga0495624_0000060 | 3300046690 | Bacteria | 69512 |
| 476 | Ga0495624_0000354 | 3300046690 | Bacteria | 36299 |
| 477 | Ga0495649_0010473 | 3300046694 | Bacteria | 5469 |
| 478 | Ga0495600_0023302 | 3300046809 | Bacteria | 3982 |
| 479 | Ga0495600_0064060 | 3300046809 | Bacteria | 2403 |
| 480 | Ga0495600_0304159 | 3300046809 | Bacteria | 1005 |
| 481 | Ga0495604_0000106 | 3300047317 | Bacteria | 69765 |
| 482 | Ga0495604_0000126 | 3300047317 | Bacteria | 63992 |
| 483 | Ga0495604_0003919 | 3300047317 | Bacteria | 11849 |
| 484 | Ga0495604_0053916 | 3300047317 | Bacteria | 3105 |
| 485 | Ga0495674_0000029 | 3300047319 | Bacteria | 118854 |
| 486 | Ga0495674_0112043 | 3300047319 | Bacteria | 2312 |
| 487 | Ga0495672_0050941 | 3300047320 | Bacteria | 2441 |
| 488 | Ga0495676_0001467 | 3300047321 | Bacteria | 20355 |
| 489 | Ga0495676_0013174 | 3300047321 | Bacteria | 7438 |
| 490 | Ga0495676_0039599 | 3300047321 | Bacteria | 3902 |
| 491 | Ga0495676_0100061 | 3300047321 | Bacteria | 2147 |
| 492 | Ga0495680_0000183 | 3300047322 | Bacteria | 66401 |
| 493 | Ga0495680_0000447 | 3300047322 | Bacteria | 46180 |
| 494 | Ga0495680_0007280 | 3300047322 | Bacteria | 10183 |
| 495 | Ga0495680_0132097 | 3300047322 | Bacteria | 1833 |
| 496 | Ga0495680_0148540 | 3300047322 | Bacteria | 1710 |
| 497 | Ga0495675_0000506 | 3300047444 | Bacteria | 25254 |
| 498 | Ga0495679_009601 | 3300047446 | Bacteria | 3859 |
| 499 | Ga0495685_003693 | 3300047447 | Bacteria | 4895 |
| 500 | Ga0495684_0129527 | 3300047471 | Bacteria | 1896 |
| 501 | Ga0495602_0000142 | 3300048088 | Bacteria | 66941 |
| 502 | Ga0495602_0008098 | 3300048088 | Bacteria | 10980 |
| 503 | Ga0495602_0043661 | 3300048088 | Bacteria | 4073 |
| 504 | Ga0495602_0250922 | 3300048088 | Bacteria | 1319 |
| 505 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 506 | Ga0496100_0000010 | 3300048903 | Bacteria | 205204 |
| 507 | Ga0496100_0020677 | 3300048903 | Bacteria | 3951 |
| 508 | Ga0496101_0000022 | 3300048904 | Bacteria | 216728 |
| 509 | Ga0496101_0000025 | 3300048904 | Bacteria | 205204 |
| 510 | Ga0496101_0054218 | 3300048904 | Bacteria | 2894 |
| 511 | Ga0496101_0058067 | 3300048904 | Bacteria | 2800 |
| 512 | Ga0496102_0000572 | 3300048905 | Bacteria | 39087 |
| 513 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 514 | Ga0496103_0002895 | 3300048906 | Bacteria | 10649 |
| 515 | Ga0496103_0046626 | 3300048906 | Bacteria | 2676 |
| 516 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 517 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 518 | Ga0496104_0019394 | 3300048907 | Bacteria | 6221 |
| 519 | Ga0496104_0077545 | 3300048907 | Bacteria | 3166 |
| 520 | Ga0496104_0143427 | 3300048907 | Bacteria | 2294 |
| 521 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 522 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 523 | Ga0496105_0006840 | 3300048908 | Bacteria | 8772 |
| 524 | Ga0496105_0018541 | 3300048908 | Bacteria | 5598 |
| 525 | Ga0496105_0251550 | 3300048908 | Bacteria | 1431 |
| 526 | Ga0496106_0000012 | 3300048909 | Bacteria | 205158 |
| 527 | Ga0496106_0000041 | 3300048909 | Bacteria | 107155 |
| 528 | Ga0496106_0001128 | 3300048909 | Bacteria | 19755 |
| 529 | Ga0496106_0017233 | 3300048909 | Bacteria | 5347 |
| 530 | Ga0496106_0049004 | 3300048909 | Bacteria | 3181 |
| 531 | Ga0496107_0000010 | 3300048910 | Bacteria | 205188 |
| 532 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 533 | Ga0496107_0007784 | 3300048910 | Bacteria | 7400 |
| 534 | Ga0496107_0042642 | 3300048910 | Bacteria | 3259 |
| 535 | Ga0496107_0055902 | 3300048910 | Bacteria | 2850 |
| 536 | Ga0496107_0060312 | 3300048910 | Bacteria | 2746 |
| 537 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 538 | Ga0496108_0000026 | 3300048911 | Bacteria | 172399 |
| 539 | Ga0496108_0002235 | 3300048911 | Bacteria | 15513 |
| 540 | Ga0496108_0011320 | 3300048911 | Bacteria | 7247 |
| 541 | Ga0496108_0329430 | 3300048911 | Bacteria | 1331 |
| 542 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 543 | Ga0496109_0000060 | 3300048912 | Bacteria | 115800 |
| 544 | Ga0496109_0000075 | 3300048912 | Bacteria | 105050 |
| 545 | Ga0496109_0001590 | 3300048912 | Bacteria | 18943 |
| 546 | Ga0496109_0056090 | 3300048912 | Bacteria | 3595 |
| 547 | Ga0496109_0057718 | 3300048912 | Bacteria | 3544 |
| 548 | Ga0496109_0099647 | 3300048912 | Bacteria | 2695 |
| 549 | Ga0496110_0000240 | 3300048913 | Bacteria | 35546 |
| 550 | Ga0496110_0008872 | 3300048913 | Bacteria | 8105 |
| 551 | Ga0496110_0039321 | 3300048913 | Bacteria | 4118 |
| 552 | Ga0496110_0047374 | 3300048913 | Bacteria | 3764 |
| 553 | Ga0496110_0109318 | 3300048913 | Bacteria | 2483 |
| 554 | Ga0496111_0000355 | 3300048914 | Bacteria | 22710 |
| 555 | Ga0496111_0002488 | 3300048914 | Bacteria | 11107 |
| 556 | Ga0496111_0043365 | 3300048914 | Bacteria | 3233 |
| 557 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 558 | Ga0496112_0177362 | 3300048915 | Bacteria | 2095 |
| 559 | Ga0496113_0000090 | 3300048916 | Bacteria | 39733 |
| 560 | Ga0496113_0177433 | 3300048916 | Bacteria | 1688 |
| 561 | Ga0496113_0439943 | 3300048916 | Bacteria | 1047 |
| 562 | Ga0496114_0000074 | 3300048917 | Bacteria | 71312 |
| 563 | Ga0496114_0003914 | 3300048917 | Bacteria | 11485 |
| 564 | Ga0496114_0153941 | 3300048917 | Bacteria | 1995 |
| 565 | Ga0496114_0367828 | 3300048917 | Bacteria | 1272 |
| 566 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 567 | Ga0496115_0000367 | 3300048918 | Bacteria | 37531 |
| 568 | Ga0496115_0008102 | 3300048918 | Bacteria | 7763 |
| 569 | Ga0496115_0026454 | 3300048918 | Bacteria | 4528 |
| 570 | Ga0496115_0143372 | 3300048918 | Bacteria | 1971 |
| 571 | Ga0496116_0001163 | 3300048919 | Bacteria | 31040 |
| 572 | Ga0496117_0012727 | 3300048920 | Bacteria | 7387 |
| 573 | Ga0496118_0004659 | 3300048921 | Bacteria | 16084 |
| 574 | Ga0496119_0011579 | 3300048922 | Bacteria | 7278 |
| 575 | Ga0496119_0018513 | 3300048922 | Bacteria | 5178 |
| 576 | Ga0496119_0018627 | 3300048922 | Bacteria | 5156 |
| 577 | Ga0496119_0057880 | 3300048922 | Bacteria | 2339 |
| 578 | Ga0496120_0009319 | 3300048923 | Bacteria | 6982 |
| 579 | Ga0496121_0017049 | 3300048924 | Bacteria | 7450 |
| 580 | Ga0496121_0044796 | 3300048924 | Bacteria | 3810 |
| 581 | Ga0496124_0163200 | 3300048927 | Bacteria | 1734 |
| 582 | Ga0496125_0033767 | 3300048928 | Bacteria | 4521 |
| 583 | Ga0496126_0036775 | 3300048929 | Bacteria | 4575 |
| 584 | Ga0496126_0056200 | 3300048929 | Bacteria | 3558 |
| 585 | Ga0496126_0184148 | 3300048929 | Bacteria | 1772 |
| 586 | Ga0501031_0003390 | 3300049568 | Bacteria | 10228 |
| 587 | Ga0501032_0004519 | 3300049569 | Bacteria | 10465 |
| 588 | Ga0501033_0001807 | 3300049570 | Bacteria | 18685 |
| 589 | Ga0501034_0097878 | 3300049571 | Bacteria | 2929 |
| 590 | Ga0501034_0122762 | 3300049571 | Bacteria | 2583 |
| 591 | Ga0501034_0279218 | 3300049571 | Bacteria | 1610 |
| 592 | Ga0501034_0298179 | 3300049571 | Bacteria | 1549 |
| 593 | Ga0501036_0005104 | 3300049572 | Bacteria | 10616 |
| 594 | Ga0501037_0001787 | 3300049573 | Bacteria | 15606 |
| 595 | Ga0501038_0001925 | 3300049574 | Bacteria | 19168 |
| 596 | Ga0501039_0014176 | 3300049575 | Bacteria | 6104 |
| 597 | Ga0501039_0115352 | 3300049575 | Bacteria | 2102 |
| 598 | Ga0501042_0075335 | 3300049578 | Bacteria | 2415 |
| 599 | Ga0501042_0144221 | 3300049578 | Bacteria | 1717 |
| 600 | Ga0501043_0005269 | 3300049579 | Bacteria | 10452 |
| 601 | Ga0501043_0214766 | 3300049579 | Bacteria | 1490 |
| 602 | Ga0501046_0006207 | 3300049580 | Bacteria | 10609 |
| 603 | Ga0501047_0001893 | 3300049581 | Bacteria | 20103 |
| 604 | Ga0501047_0016768 | 3300049581 | Bacteria | 7000 |
| 605 | Ga0501047_0057261 | 3300049581 | Bacteria | 3769 |
| 606 | Ga0501047_0513445 | 3300049581 | Bacteria | 1024 |
| 607 | Ga0501048_0004823 | 3300049582 | Bacteria | 10281 |
| 608 | Ga0501067_0051988 | 3300049583 | Bacteria | 2270 |
| 609 | Ga0501068_0039098 | 3300049584 | Bacteria | 2844 |
| 610 | Ga0501069_0004954 | 3300049585 | Bacteria | 6909 |
| 611 | Ga0501069_0050844 | 3300049585 | Bacteria | 2305 |
| 612 | Ga0501069_0064477 | 3300049585 | Bacteria | 2047 |
| 613 | Ga0501069_0074502 | 3300049585 | Bacteria | 1905 |
| 614 | Ga0501070_0005706 | 3300049586 | Bacteria | 10614 |
| 615 | Ga0501070_0015982 | 3300049586 | Bacteria | 6308 |
| 616 | Ga0501070_0044170 | 3300049586 | Bacteria | 3708 |
| 617 | Ga0501071_0081985 | 3300049587 | Bacteria | 2361 |
| 618 | Ga0501071_0178584 | 3300049587 | Bacteria | 1590 |
| 619 | Ga0501071_0185487 | 3300049587 | Bacteria | 1559 |
| 620 | Ga0501072_0013570 | 3300049588 | Bacteria | 6235 |
| 621 | Ga0501072_0045391 | 3300049588 | Bacteria | 3455 |
| 622 | Ga0501072_0050414 | 3300049588 | Bacteria | 3278 |
| 623 | Ga0501072_0093640 | 3300049588 | Bacteria | 2387 |
| 624 | Ga0501072_0142203 | 3300049588 | Bacteria | 1913 |
| 625 | Ga0501073_0015435 | 3300049589 | Bacteria | 5540 |
| 626 | Ga0501074_0025223 | 3300049590 | Bacteria | 4319 |
| 627 | Ga0501074_0031040 | 3300049590 | Bacteria | 3872 |
| 628 | Ga0501074_0047210 | 3300049590 | Bacteria | 3113 |
| 629 | Ga0501075_0031379 | 3300049591 | Bacteria | 3944 |
| 630 | Ga0501075_0031617 | 3300049591 | Bacteria | 3929 |
| 631 | Ga0501075_0075414 | 3300049591 | Bacteria | 2550 |
| 632 | Ga0501076_0024125 | 3300049592 | Bacteria | 4697 |
| 633 | Ga0501076_0037165 | 3300049592 | Bacteria | 3817 |
| 634 | Ga0501076_0098239 | 3300049592 | Bacteria | 2358 |
| 635 | Ga0501076_0103209 | 3300049592 | Bacteria | 2300 |
| 636 | Ga0501079_0005283 | 3300049741 | Bacteria | 9607 |
| 637 | Ga0501079_0033198 | 3300049741 | Bacteria | 3969 |
| 638 | Ga0501079_0053611 | 3300049741 | Bacteria | 3111 |
| 639 | Ga0501081_0038139 | 3300049743 | Bacteria | 3281 |
| 640 | Ga0501081_0145200 | 3300049743 | Bacteria | 1702 |
| 641 | Ga0501081_0200468 | 3300049743 | Bacteria | 1447 |
| 642 | Ga0501081_0302956 | 3300049743 | Bacteria | 1172 |
| 643 | Ga0501083_0004003 | 3300049744 | Bacteria | 10354 |
| 644 | Ga0501083_0050166 | 3300049744 | Bacteria | 2809 |
| 645 | Ga0501083_0126861 | 3300049744 | Bacteria | 1673 |
| 646 | Ga0501035_0001433 | 3300049822 | Bacteria | 24443 |
| 647 | Ga0501044_0001917 | 3300049823 | Bacteria | 24075 |
| 648 | Ga0501044_0016666 | 3300049823 | Bacteria | 7890 |
| 649 | Ga0501044_0068631 | 3300049823 | Bacteria | 3611 |
| 650 | Ga0501044_0210184 | 3300049823 | Bacteria | 1900 |
| 651 | Ga0501045_0001477 | 3300049824 | Bacteria | 15625 |
| 652 | Ga0501045_0029794 | 3300049824 | Bacteria | 3947 |
| 653 | nmdc:mga03n38_63656_c1 | 3300050490 | Bacteria | 1686 |
| 654 | nmdc:mga00v17_45459_c1 | 3300050491 | Bacteria | 2653 |
| 655 | nmdc:mga0yw44_25645_c1 | 3300050492 | Bacteria | 3356 |
| 656 | nmdc:mga0yw44_37108_c1 | 3300050492 | Bacteria | 2876 |
| 657 | nmdc:mga0yw44_4043_c1 | 3300050492 | Bacteria | 6637 |
| 658 | nmdc:mga05p37_36964_c1 | 3300050507 | Bacteria | 5989 |
| 659 | nmdc:mga0qj67_29365_c1 | 3300050509 | Bacteria | 4271 |
| 660 | nmdc:mga0qj67_59068_c1 | 3300050509 | Bacteria | 3041 |
| 661 | nmdc:mga06r32_24414_c1 | 3300050510 | Bacteria | 5611 |
| 662 | nmdc:mga06r32_39918_c1 | 3300050510 | Bacteria | 4455 |
| 663 | nmdc:mga06r32_6813_c1 | 3300050510 | Bacteria | 10271 |
| 664 | nmdc:mga08y16_66487_c1 | 3300050511 | Bacteria | 3762 |
| 665 | nmdc:mga0n895_157688_c1 | 3300050512 | Bacteria | 2301 |
| 666 | nmdc:mga0a205_141251_c1 | 3300050515 | Bacteria | 2308 |
| 667 | nmdc:mga0a205_30840_c1 | 3300050515 | Bacteria | 5135 |
| 668 | nmdc:mga0a205_6_c1 | 3300050515 | Bacteria | 129758 |
| 669 | Ga0495601_0000027 | 3300053077 | Bacteria | 116790 |
| 670 | Ga0495601_0011991 | 3300053077 | Bacteria | 5193 |
| 671 | Ga0495601_0014207 | 3300053077 | Bacteria | 4799 |
| 672 | Ga0495612_0000022 | 3300053078 | Bacteria | 119126 |
| 673 | Ga0495612_0008735 | 3300053078 | Bacteria | 4110 |
| 674 | Ga0495612_0009045 | 3300053078 | Bacteria | 4039 |
| 675 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 676 | Ga0495595_0000022 | 3300053084 | Bacteria | 110598 |
| 677 | Ga0495595_0000107 | 3300053084 | Bacteria | 38201 |
| 678 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 679 | Ga0495619_0000077 | 3300053085 | Bacteria | 73017 |
| 680 | Ga0495619_0000152 | 3300053085 | Bacteria | 51090 |
| 681 | Ga0495619_0000222 | 3300053085 | Bacteria | 41071 |
| 682 | Ga0495619_0002672 | 3300053085 | Bacteria | 11664 |
| 683 | Ga0495619_0057700 | 3300053085 | Bacteria | 2576 |
| 684 | Ga0500566_0076600 | 3300053094 | Bacteria | 1869 |
| 685 | Ga0500614_003276 | 3300053123 | Bacteria | 3499 |
| 686 | Ga0500628_001454 | 3300053129 | Bacteria | 4052 |
| 687 | Ga0501084_0001269 | 3300054114 | Bacteria | 19906 |
| 688 | Ga0590074_003908 | 3300059423 | Bacteria | 2465 |
| 689 | Ga0501082_0006205 | 3300060353 | Bacteria | 10375 |
| 690 | Ga0501082_0008124 | 3300060353 | Bacteria | 9055 |
| 691 | Ga0466962_0063478 | 3300061719 | Bacteria | 1763 |
| 692 | Ga0530510_0000884 | 3300061734 | Bacteria | 19759 |
| 693 | Ga0530510_0110154 | 3300061734 | Bacteria | 2016 |
| 694 | Ga0495613_0000251 | |||
| 695 | JGI25407J50210_10014216 | |||
| 696 | JGI25404J52841_10000793 | |||
| 697 | Ga0070658_10039217 | |||
| 698 | Ga0070683_100000304 | |||
| 699 | Ga0070683_100113586 | |||
| 700 | Ga0070683_100249286 | |||
| 701 | Ga0070670_100019350 | |||
| 702 | Ga0070677_10000080 | |||
| 703 | Ga0070666_10192570 | |||
| 704 | Ga0070682_100000049 | |||
| 705 | Ga0070682_100028493 | |||
| 706 | Ga0068868_100000026 | |||
| 707 | Ga0068868_100009074 | |||
| 708 | Ga0070691_10000001 | |||
| 709 | Ga0070691_10033797 | |||
| 710 | Ga0070687_100073204 | |||
| 711 | Ga0070687_100098069 | |||
| 712 | Ga0070661_100000199 | |||
| 713 | Ga0070661_100144462 | |||
| 714 | Ga0070692_10026326 | |||
| 715 | Ga0070692_10170329 | |||
| 716 | Ga0070668_100029394 | |||
| 717 | Ga0070668_100031712 | |||
| 718 | Ga0070675_100000025 | |||
| 719 | Ga0070675_100074129 | |||
| 720 | Ga0070674_100000017 | |||
| 721 | Ga0070674_100000036 | |||
| 722 | Ga0070674_100043648 | |||
| 723 | Ga0070673_100002732 | |||
| 724 | Ga0070688_100000099 | |||
| 725 | Ga0070688_100000149 | |||
| 726 | Ga0070688_100146351 | |||
| 727 | Ga0070659_100000450 | |||
| 728 | Ga0070659_100006552 | |||
| 729 | Ga0070667_100004045 | |||
| 730 | Ga0070667_100035781 | |||
| 731 | Ga0070714_100027127 | |||
| 732 | Ga0070714_100204417 | |||
| 733 | Ga0070713_100000092 | |||
| 734 | Ga0070713_100055786 | |||
| 735 | Ga0070711_100024080 | |||
| 736 | Ga0070711_100025475 | |||
| 737 | Ga0070705_100199020 | |||
| 738 | Ga0070700_100003404 | |||
| 739 | Ga0070694_100098851 | |||
| 740 | Ga0070708_100032920 | |||
| 741 | Ga0070678_100007668 | |||
| 742 | Ga0070678_100011965 | |||
| 743 | Ga0070678_100016370 | |||
| 744 | Ga0070678_100046920 | |||
| 745 | Ga0070678_100078790 | |||
| 746 | Ga0070662_100000009 | |||
| 747 | Ga0068867_100000373 | |||
| 748 | Ga0068867_100077428 | |||
| 749 | Ga0070685_10000024 | |||
| 750 | Ga0070685_10000025 | |||
| 751 | Ga0070685_10065267 | |||
| 752 | Ga0070685_10080213 | |||
| 753 | Ga0070706_100137280 | |||
| 754 | Ga0070698_100050694 | |||
| 755 | Ga0070699_100475488 | |||
| 756 | Ga0070679_100000245 | |||
| 757 | Ga0070679_100005505 | |||
| 758 | Ga0070679_100205506 | |||
| 759 | Ga0070684_100002617 | |||
| 760 | Ga0070684_100109965 | |||
| 761 | Ga0070684_100409092 | |||
| 762 | Ga0070697_100009241 | |||
| 763 | Ga0070697_100110454 | |||
| 764 | Ga0068853_100157698 | |||
| 765 | Ga0068853_100159919 | |||
| 766 | Ga0070672_100000025 | |||
| 767 | Ga0070672_100002648 | |||
| 768 | Ga0070686_100010578 | |||
| 769 | Ga0070686_100264468 | |||
| 770 | Ga0070695_100091180 | |||
| 771 | Ga0070693_100001584 | |||
| 772 | Ga0070693_100040032 | |||
| 773 | Ga0070665_100000138 | |||
| 774 | Ga0070665_100003670 | |||
| 775 | Ga0070665_100148648 | |||
| 776 | Ga0070664_100115870 | |||
| 777 | Ga0070664_100244154 | |||
| 778 | Ga0068857_100386196 | |||
| 779 | Ga0068854_100005748 | |||
| 780 | Ga0068854_100061027 | |||
| 781 | Ga0068856_100000635 | |||
| 782 | Ga0068856_100021194 | |||
| 783 | Ga0068856_100048107 | |||
| 784 | Ga0068856_100049917 | |||
| 785 | Ga0070702_100005226 | |||
| 786 | Ga0070702_100023449 | |||
| 787 | Ga0068852_100000006 | |||
| 788 | Ga0068852_100006354 | |||
| 789 | Ga0068864_100000031 | |||
| 790 | Ga0068864_100140195 | |||
| 791 | Ga0068866_10000001 | |||
| 792 | Ga0068866_10002691 | |||
| 793 | Ga0068861_100010447 | |||
| 794 | Ga0068851_10002288 | |||
| 795 | Ga0068863_100000170 | |||
| 796 | Ga0068863_100032980 | |||
| 797 | Ga0068863_100144131 | |||
| 798 | Ga0068863_100426104 | |||
| 799 | Ga0068858_100000009 | |||
| 800 | Ga0068858_100000284 | |||
| 801 | Ga0068858_100046395 | |||
| 802 | Ga0068858_100066379 | |||
| 803 | Ga0068860_100067471 | |||
| 804 | Ga0068862_100001788 | |||
| 805 | Ga0068862_100221212 | |||
| 806 | Ga0081455_10011165 | |||
| 807 | Ga0081455_10037916 | |||
| 808 | Ga0081455_10062272 | |||
| 809 | Ga0081455_10068115 | |||
| 810 | Ga0081455_10077985 | |||
| 811 | Ga0081455_10136608 | |||
| 812 | Ga0081455_10264495 | |||
| 813 | Ga0081538_10001175 | |||
| 814 | Ga0081538_10027244 | |||
| 815 | Ga0081540_1001221 | |||
| 816 | Ga0081540_1005597 | |||
| 817 | Ga0081540_1048652 | |||
| 818 | Ga0081539_10001019 | |||
| 819 | Ga0081539_10003364 | |||
| 820 | Ga0075365_10000650 | |||
| 821 | Ga0075365_10001126 | |||
| 822 | Ga0075365_10073744 | |||
| 823 | Ga0075365_10203332 | |||
| 824 | Ga0075363_100005236 | |||
| 825 | Ga0075364_10006399 | |||
| 826 | Ga0070715_10000001 | |||
| 827 | Ga0070712_100005336 | |||
| 828 | Ga0070712_100018647 | |||
| 829 | Ga0070712_100026979 | |||
| 830 | Ga0070712_100148942 | |||
| 831 | Ga0097621_100012319 | |||
| 832 | Ga0068871_100015248 | |||
| 833 | Ga0068871_100368322 | |||
| 834 | Ga0075428_100121143 | |||
| 835 | Ga0075428_100305686 | |||
| 836 | Ga0075430_100011635 | |||
| 837 | Ga0075430_100034624 | |||
| 838 | Ga0075431_100002057 | |||
| 839 | Ga0075431_100010590 | |||
| 840 | Ga0075431_100061735 | |||
| 841 | Ga0075431_100111215 | |||
| 842 | Ga0075433_10000851 | |||
| 843 | Ga0075433_10001372 | |||
| 844 | Ga0075433_10463043 | |||
| 845 | Ga0075434_100112519 | |||
| 846 | Ga0075429_100011779 | |||
| 847 | Ga0068865_100000034 | |||
| 848 | Ga0068865_100066436 | |||
| 849 | Ga0111539_10154863 | |||
| 850 | Ga0105245_10000020 | |||
| 851 | Ga0105245_10000135 | |||
| 852 | Ga0105245_10000179 | |||
| 853 | Ga0105245_10006638 | |||
| 854 | Ga0105245_10270586 | |||
| 855 | Ga0105247_10001358 | |||
| 856 | Ga0105247_10010658 | |||
| 857 | Ga0105247_10095423 | |||
| 858 | Ga0105247_10123172 | |||
| 859 | Ga0114129_10046738 | |||
| 860 | Ga0105243_10009674 | |||
| 861 | Ga0105243_10038569 | |||
| 862 | Ga0105243_10073144 | |||
| 863 | Ga0105241_10240882 | |||
| 864 | Ga0105241_10394818 | |||
| 865 | Ga0105242_10000397 | |||
| 866 | Ga0105242_10002932 | |||
| 867 | Ga0105242_10013726 | |||
| 868 | Ga0105242_10032714 | |||
| 869 | Ga0105242_10273450 | |||
| 870 | Ga0105248_10000008 | |||
| 871 | Ga0105238_10000009 | |||
| 872 | Ga0105249_10000080 | |||
| 873 | Ga0105249_10000957 | |||
| 874 | Ga0105249_10007538 | |||
| 875 | Ga0105239_10071769 | |||
| 876 | Ga0105239_10417218 | |||
| 877 | Ga0157371_10044208 | |||
| 878 | Ga0157369_10000020 | |||
| 879 | Ga0157374_10015508 | |||
| 880 | Ga0157374_10203702 | |||
| 881 | Ga0157374_10474835 | |||
| 882 | Ga0157378_10001054 | |||
| 883 | Ga0157378_10015848 | |||
| 884 | Ga0157375_10001512 | |||
| 885 | Ga0157375_10009995 | |||
| 886 | Ga0157375_10011379 | |||
| 887 | Ga0163163_10051500 | |||
| 888 | Ga0157380_10000037 | |||
| 889 | Ga0157380_10016506 | |||
| 890 | Ga0157380_10021928 | |||
| 891 | Ga0157377_10002154 | |||
| 892 | Ga0157379_10003237 | |||
| 893 | Ga0157379_10019863 | |||
| 894 | Ga0157379_10050430 | |||
| 895 | Ga0157379_10152892 | |||
| 896 | Ga0157376_10005772 | |||
| 897 | Ga0157376_10458771 | |||
| 898 | Ga0163161_10000021 | |||
| 899 | Ga0163161_10215864 | |||
| 900 | Ga0163161_10232353 | |||
| 901 | Ga0213873_10015585 | |||
| 902 | Ga0213874_10002024 | |||
| 903 | Ga0213876_10076534 | |||
| 904 | Ga0213875_10053685 | |||
| 905 | Ga0213875_10087969 | |||
| 906 | Ga0207656_10000433 | |||
| 907 | Ga0207656_10008200 | |||
| 908 | Ga0207682_10000045 | |||
| 909 | Ga0207642_10000002 | |||
| 910 | Ga0207642_10010260 | |||
| 911 | Ga0207642_10197191 | |||
| 912 | Ga0207710_10000180 | |||
| 913 | Ga0207710_10012329 | |||
| 914 | Ga0207680_10055600 | |||
| 915 | Ga0207680_10148506 | |||
| 916 | Ga0207685_10000005 | |||
| 917 | Ga0207685_10001653 | |||
| 918 | Ga0207699_10134105 | |||
| 919 | Ga0207645_10259290 | |||
| 920 | Ga0207654_10140098 | |||
| 921 | Ga0207671_10207320 | |||
| 922 | Ga0207693_10001859 | |||
| 923 | Ga0207693_10009829 | |||
| 924 | Ga0207693_10034785 | |||
| 925 | Ga0207663_10017369 | |||
| 926 | Ga0207663_10044354 | |||
| 927 | Ga0207663_10114985 | |||
| 928 | Ga0207657_10000904 | |||
| 929 | Ga0207649_10000009 | |||
| 930 | Ga0207649_10011457 | |||
| 931 | Ga0207652_10000773 | |||
| 932 | Ga0207652_10000930 | |||
| 933 | Ga0207694_10000004 | |||
| 934 | Ga0207659_10000033 | |||
| 935 | Ga0207687_10000007 | |||
| 936 | Ga0207687_10000013 | |||
| 937 | Ga0207687_10005615 | |||
| 938 | Ga0207687_10156353 | |||
| 939 | Ga0207700_10000007 | |||
| 940 | Ga0207700_10014296 | |||
| 941 | Ga0207664_10014592 | |||
| 942 | Ga0207664_10112675 | |||
| 943 | Ga0207664_10143802 | |||
| 944 | Ga0207664_10181813 | |||
| 945 | Ga0207644_10173154 | |||
| 946 | Ga0207690_10004725 | |||
| 947 | Ga0207690_10009017 | |||
| 948 | Ga0207706_10000001 | |||
| 949 | Ga0207706_10003574 | |||
| 950 | Ga0207686_10000252 | |||
| 951 | Ga0207686_10000580 | |||
| 952 | Ga0207686_10012562 | |||
| 953 | Ga0207686_10111262 | |||
| 954 | Ga0207709_10002134 | |||
| 955 | Ga0207709_10008995 | |||
| 956 | Ga0207709_10025574 | |||
| 957 | Ga0207709_10074131 | |||
| 958 | Ga0207670_10075841 | |||
| 959 | Ga0207670_10314560 | |||
| 960 | Ga0207669_10000001 | |||
| 961 | Ga0207669_10000049 | |||
| 962 | Ga0207704_10000059 | |||
| 963 | Ga0207704_10041470 | |||
| 964 | Ga0207665_10011176 | |||
| 965 | Ga0207691_10000135 | |||
| 966 | Ga0207691_10004548 | |||
| 967 | Ga0207711_10000006 | |||
| 968 | Ga0207661_10000056 | |||
| 969 | Ga0207661_10000986 | |||
| 970 | Ga0207661_10031274 | |||
| 971 | Ga0207661_10122391 | |||
| 972 | Ga0207661_10145743 | |||
| 973 | Ga0207679_10011340 | |||
| 974 | Ga0207679_10053168 | |||
| 975 | Ga0207667_10200913 | |||
| 976 | Ga0207651_10001434 | |||
| 977 | Ga0207712_10439388 | |||
| 978 | Ga0207668_10071877 | |||
| 979 | Ga0207668_10135295 | |||
| 980 | Ga0207668_10157367 | |||
| 981 | Ga0207640_10000151 | |||
| 982 | Ga0207640_10052291 | |||
| 983 | Ga0207640_10058835 | |||
| 984 | Ga0207658_10023437 | |||
| 985 | Ga0207677_10000106 | |||
| 986 | Ga0207677_10036116 | |||
| 987 | Ga0207677_10071148 | |||
| 988 | Ga0207703_10000018 | |||
| 989 | Ga0207703_10000207 | |||
| 990 | Ga0207703_10205014 | |||
| 991 | Ga0207639_10117831 | |||
| 992 | Ga0207639_10136690 | |||
| 993 | Ga0207678_10042291 | |||
| 994 | Ga0207708_10007274 | |||
| 995 | Ga0207708_10299209 | |||
| 996 | Ga0207702_10000360 | |||
| 997 | Ga0207702_10006968 | |||
| 998 | Ga0207641_10000301 | |||
| 999 | Ga0207641_10008098 | |||
| 1000 | Ga0207641_10445341 | |||
| 1001 | Ga0207648_10000630 | |||
| 1002 | Ga0207648_10022306 | |||
| 1003 | Ga0207648_10069224 | |||
| 1004 | Ga0207676_10000031 | |||
| 1005 | Ga0207675_100036553 | |||
| 1006 | Ga0207683_10000767 | |||
| 1007 | Ga0207683_10024270 | |||
| 1008 | Ga0207683_10045765 | |||
| 1009 | Ga0207683_10087361 | |||
| 1010 | Ga0207698_10000013 | |||
| 1011 | Ga0268266_10000047 | |||
| 1012 | Ga0268266_10000247 | |||
| 1013 | Ga0268266_10002714 | |||
| 1014 | Ga0268266_10161069 | |||
| 1015 | Ga0268266_10237044 | |||
| 1016 | Ga0268266_10350007 | |||
| 1017 | Ga0268265_10230115 | |||
| 1018 | Ga0268264_10004510 | |||
| 1019 | Ga0268264_10040469 | |||
| 1020 | Ga0265337_1000011 | |||
| 1021 | Ga0265326_10000066 | |||
| 1022 | Ga0265319_1004499 | |||
| 1023 | Ga0265334_10008873 | |||
| 1024 | Ga0265322_10000001 | |||
| 1025 | Ga0265336_10009682 | |||
| 1026 | Ga0265336_10062032 | |||
| 1027 | Ga0265338_10002303 | |||
| 1028 | Ga0307511_10063461 | |||
| 1029 | Ga0265332_10008057 | |||
| 1030 | Ga0265328_10000527 | |||
| 1031 | Ga0265320_10000002 | |||
| 1032 | Ga0265320_10022793 | |||
| 1033 | Ga0265325_10035510 | |||
| 1034 | Ga0265329_10006798 | |||
| 1035 | Ga0265339_10018899 | |||
| 1036 | Ga0265331_10069122 | |||
| 1037 | Ga0265327_10000011 | |||
| 1038 | Ga0265316_10027016 | |||
| 1039 | Ga0265316_10096267 | |||
| 1040 | Ga0265314_10000726 | |||
| 1041 | Ga0265314_10034352 | |||
| 1042 | Ga0307413_10061245 | |||
| 1043 | Ga0307406_10359763 | |||
| 1044 | Ga0373937_0014366 | |||
| 1045 | Ga0373937_0023066 | |||
| 1046 | Ga0316584_0035780 | |||
| 1047 | Ga0395898_0000631 | |||
| 1048 | Ga0436364_0827185 | |||
| 1049 | Ga0436365_0029559 | |||
| 1050 | Ga0436365_0329260 | |||
| 1051 | Ga0436365_0577046 | |||
| 1052 | Ga0436363_0185144 | |||
| 1053 | Ga0436363_0500250 | |||
| 1054 | Ga0436363_0736430 | |||
| 1055 | Ga0436363_1264088 | |||
| 1056 | Ga0436363_1357047 | |||
| 1057 | Ga0436362_0716588 | |||
| 1058 | Ga0466969_0022365 | |||
| 1059 | Ga0466972_0068713 | |||
| 1060 | Ga0466965_0066454 | |||
| 1061 | Ga0466966_0045956 | |||
| 1062 | Ga0466966_0067064 | |||
| 1063 | Ga0466966_0112910 | |||
| 1064 | Ga0466961_0003650 | |||
| 1065 | Ga0466961_0007158 | |||
| 1066 | Ga0466963_0000067 | |||
| 1067 | Ga0466963_0002060 | |||
| 1068 | Ga0466963_0016290 | |||
| 1069 | Ga0466963_0016909 | |||
| 1070 | Ga0466963_0097464 | |||
| 1071 | Ga0466963_0218589 | |||
| 1072 | Ga0466968_0071940 | |||
| 1073 | Ga0466968_0105701 | |||
| 1074 | Ga0466970_0017739 | |||
| 1075 | Ga0466957_0037810 | |||
| 1076 | Ga0466957_0079011 | |||
| 1077 | Ga0466957_0094133 | |||
| 1078 | Ga0466957_0106350 | |||
| 1079 | Ga0466957_0110853 | |||
| 1080 | Ga0466959_0002580 | |||
| 1081 | Ga0466959_0078189 | |||
| 1082 | Ga0466959_0271191 | |||
| 1083 | Ga0466959_0273657 | |||
| 1084 | Ga0466958_0042899 | |||
| 1085 | Ga0466958_0059927 | |||
| 1086 | Ga0466958_0071542 | |||
| 1087 | Ga0466958_0089284 | |||
| 1088 | Ga0466958_0091238 | |||
| 1089 | Ga0466958_0093905 | |||
| 1090 | Ga0466958_0178629 | |||
| 1091 | Ga0466967_0000038 | |||
| 1092 | Ga0466967_0037191 | |||
| 1093 | Ga0495592_0015306 | |||
| 1094 | Ga0495592_0059345 | |||
| 1095 | Ga0495592_0068929 | |||
| 1096 | Ga0495603_0000258 | |||
| 1097 | Ga0495603_0002143 | |||
| 1098 | Ga0495603_0026490 | |||
| 1099 | Ga0495603_0102924 | |||
| 1100 | Ga0495629_0000145 | |||
| 1101 | Ga0495629_0005376 | |||
| 1102 | Ga0495629_0037344 | |||
| 1103 | Ga0495629_0040071 | |||
| 1104 | Ga0495629_0154081 | |||
| 1105 | Ga0495641_0000029 | |||
| 1106 | Ga0495641_0017175 | |||
| 1107 | Ga0495651_0044196 | |||
| 1108 | Ga0495651_0064630 | |||
| 1109 | Ga0495653_0037024 | |||
| 1110 | Ga0495653_0083103 | |||
| 1111 | Ga0495582_0000004 | |||
| 1112 | Ga0495639_0047087 | |||
| 1113 | Ga0495662_0000421 | |||
| 1114 | Ga0495662_0009449 | |||
| 1115 | Ga0495664_0065078 | |||
| 1116 | Ga0495594_0000010 | |||
| 1117 | Ga0495606_0000072 | |||
| 1118 | Ga0495608_0000023 | |||
| 1119 | Ga0495608_0000080 | |||
| 1120 | Ga0495608_0037255 | |||
| 1121 | Ga0495618_0000008 | |||
| 1122 | Ga0495618_0121378 | |||
| 1123 | Ga0495620_0000820 | |||
| 1124 | Ga0495628_0000165 | |||
| 1125 | Ga0495628_0048885 | |||
| 1126 | Ga0495628_0078535 | |||
| 1127 | Ga0495628_0148037 | |||
| 1128 | Ga0495630_0000012 | |||
| 1129 | Ga0495630_0000145 | |||
| 1130 | Ga0495630_0007281 | |||
| 1131 | Ga0495652_0001047 | |||
| 1132 | Ga0495640_0042435 | |||
| 1133 | Ga0495640_0073823 | |||
| 1134 | Ga0495586_0002129 | |||
| 1135 | Ga0495587_0006985 | |||
| 1136 | Ga0495621_0045101 | |||
| 1137 | Ga0495645_0002645 | |||
| 1138 | Ga0495645_0053939 | |||
| 1139 | Ga0495622_0000104 | |||
| 1140 | Ga0495667_0000047 | |||
| 1141 | Ga0495667_0030795 | |||
| 1142 | Ga0495667_0134520 | |||
| 1143 | Ga0495656_0000210 | |||
| 1144 | Ga0495634_0000034 | |||
| 1145 | Ga0495634_0001103 | |||
| 1146 | Ga0495634_0042297 | |||
| 1147 | Ga0495634_0043409 | |||
| 1148 | Ga0495634_0105594 | |||
| 1149 | Ga0495625_0011117 | |||
| 1150 | Ga0495625_0115489 | |||
| 1151 | Ga0495635_0000034 | |||
| 1152 | Ga0495635_0160634 | |||
| 1153 | Ga0495588_0000244 | |||
| 1154 | Ga0495588_0078187 | |||
| 1155 | Ga0495588_0179644 | |||
| 1156 | Ga0495657_0000020 | |||
| 1157 | Ga0495657_0016735 | |||
| 1158 | Ga0495647_0000017 | |||
| 1159 | Ga0495647_0000098 | |||
| 1160 | Ga0495647_0007586 | |||
| 1161 | Ga0495647_0037691 | |||
| 1162 | Ga0495658_0000004 | |||
| 1163 | Ga0495658_0002109 | |||
| 1164 | Ga0495658_0065104 | |||
| 1165 | Ga0495669_0000030 | |||
| 1166 | Ga0495613_0000124 | |||
| 1167 | Ga0495613_0032679 | |||
| 1168 | Ga0495624_0000060 | |||
| 1169 | Ga0495624_0000354 | |||
| 1170 | Ga0495649_0010473 | |||
| 1171 | Ga0495600_0023302 | |||
| 1172 | Ga0495600_0064060 | |||
| 1173 | Ga0495600_0304159 | |||
| 1174 | Ga0495604_0000106 | |||
| 1175 | Ga0495604_0000126 | |||
| 1176 | Ga0495604_0003919 | |||
| 1177 | Ga0495604_0053916 | |||
| 1178 | Ga0495674_0000029 | |||
| 1179 | Ga0495674_0112043 | |||
| 1180 | Ga0495672_0050941 | |||
| 1181 | Ga0495676_0001467 | |||
| 1182 | Ga0495676_0013174 | |||
| 1183 | Ga0495676_0039599 | |||
| 1184 | Ga0495676_0100061 | |||
| 1185 | Ga0495680_0000183 | |||
| 1186 | Ga0495680_0000447 | |||
| 1187 | Ga0495680_0007280 | |||
| 1188 | Ga0495680_0132097 | |||
| 1189 | Ga0495680_0148540 | |||
| 1190 | Ga0495675_0000506 | |||
| 1191 | Ga0495679_009601 | |||
| 1192 | Ga0495685_003693 | |||
| 1193 | Ga0495684_0129527 | |||
| 1194 | Ga0495602_0000142 | |||
| 1195 | Ga0495602_0008098 | |||
| 1196 | Ga0495602_0043661 | |||
| 1197 | Ga0495602_0250922 | |||
| 1198 | Ga0496100_0000005 | |||
| 1199 | Ga0496100_0000010 | |||
| 1200 | Ga0496100_0020677 | |||
| 1201 | Ga0496101_0000022 | |||
| 1202 | Ga0496101_0000025 | |||
| 1203 | Ga0496101_0054218 | |||
| 1204 | Ga0496101_0058067 | |||
| 1205 | Ga0496102_0000572 | |||
| 1206 | Ga0496103_0000008 | |||
| 1207 | Ga0496103_0002895 | |||
| 1208 | Ga0496103_0046626 | |||
| 1209 | Ga0496104_0000004 | |||
| 1210 | Ga0496104_0000009 | |||
| 1211 | Ga0496104_0019394 | |||
| 1212 | Ga0496104_0077545 | |||
| 1213 | Ga0496104_0143427 | |||
| 1214 | Ga0496105_0000001 | |||
| 1215 | Ga0496105_0000007 | |||
| 1216 | Ga0496105_0006840 | |||
| 1217 | Ga0496105_0018541 | |||
| 1218 | Ga0496105_0251550 | |||
| 1219 | Ga0496106_0000012 | |||
| 1220 | Ga0496106_0000041 | |||
| 1221 | Ga0496106_0001128 | |||
| 1222 | Ga0496106_0017233 | |||
| 1223 | Ga0496106_0049004 | |||
| 1224 | Ga0496107_0000010 | |||
| 1225 | Ga0496107_0000011 | |||
| 1226 | Ga0496107_0007784 | |||
| 1227 | Ga0496107_0042642 | |||
| 1228 | Ga0496107_0055902 | |||
| 1229 | Ga0496107_0060312 | |||
| 1230 | Ga0496108_0000001 | |||
| 1231 | Ga0496108_0000026 | |||
| 1232 | Ga0496108_0002235 | |||
| 1233 | Ga0496108_0011320 | |||
| 1234 | Ga0496108_0329430 | |||
| 1235 | Ga0496109_0000004 | |||
| 1236 | Ga0496109_0000060 | |||
| 1237 | Ga0496109_0000075 | |||
| 1238 | Ga0496109_0001590 | |||
| 1239 | Ga0496109_0056090 | |||
| 1240 | Ga0496109_0057718 | |||
| 1241 | Ga0496109_0099647 | |||
| 1242 | Ga0496110_0000240 | |||
| 1243 | Ga0496110_0008872 | |||
| 1244 | Ga0496110_0039321 | |||
| 1245 | Ga0496110_0047374 | |||
| 1246 | Ga0496110_0109318 | |||
| 1247 | Ga0496111_0000355 | |||
| 1248 | Ga0496111_0002488 | |||
| 1249 | Ga0496111_0043365 | |||
| 1250 | Ga0496112_0000013 | |||
| 1251 | Ga0496112_0177362 | |||
| 1252 | Ga0496113_0000090 | |||
| 1253 | Ga0496113_0177433 | |||
| 1254 | Ga0496113_0439943 | |||
| 1255 | Ga0496114_0000074 | |||
| 1256 | Ga0496114_0003914 | |||
| 1257 | Ga0496114_0153941 | |||
| 1258 | Ga0496114_0367828 | |||
| 1259 | Ga0496115_0000003 | |||
| 1260 | Ga0496115_0000367 | |||
| 1261 | Ga0496115_0008102 | |||
| 1262 | Ga0496115_0026454 | |||
| 1263 | Ga0496115_0143372 | |||
| 1264 | Ga0496116_0001163 | |||
| 1265 | Ga0496117_0012727 | |||
| 1266 | Ga0496118_0004659 | |||
| 1267 | Ga0496119_0011579 | |||
| 1268 | Ga0496119_0018513 | |||
| 1269 | Ga0496119_0018627 | |||
| 1270 | Ga0496119_0057880 | |||
| 1271 | Ga0496120_0009319 | |||
| 1272 | Ga0496121_0017049 | |||
| 1273 | Ga0496121_0044796 | |||
| 1274 | Ga0496124_0163200 | |||
| 1275 | Ga0496125_0033767 | |||
| 1276 | Ga0496126_0036775 | |||
| 1277 | Ga0496126_0056200 | |||
| 1278 | Ga0496126_0184148 | |||
| 1279 | Ga0501031_0003390 | |||
| 1280 | Ga0501032_0004519 | |||
| 1281 | Ga0501033_0001807 | |||
| 1282 | Ga0501034_0097878 | |||
| 1283 | Ga0501034_0122762 | |||
| 1284 | Ga0501034_0279218 | |||
| 1285 | Ga0501034_0298179 | |||
| 1286 | Ga0501036_0005104 | |||
| 1287 | Ga0501037_0001787 | |||
| 1288 | Ga0501038_0001925 | |||
| 1289 | Ga0501039_0014176 | |||
| 1290 | Ga0501039_0115352 | |||
| 1291 | Ga0501042_0075335 | |||
| 1292 | Ga0501042_0144221 | |||
| 1293 | Ga0501043_0005269 | |||
| 1294 | Ga0501043_0214766 | |||
| 1295 | Ga0501046_0006207 | |||
| 1296 | Ga0501047_0001893 | |||
| 1297 | Ga0501047_0016768 | |||
| 1298 | Ga0501047_0057261 | |||
| 1299 | Ga0501047_0513445 | |||
| 1300 | Ga0501048_0004823 | |||
| 1301 | Ga0501067_0051988 | |||
| 1302 | Ga0501068_0039098 | |||
| 1303 | Ga0501069_0004954 | |||
| 1304 | Ga0501069_0050844 | |||
| 1305 | Ga0501069_0064477 | |||
| 1306 | Ga0501069_0074502 | |||
| 1307 | Ga0501070_0005706 | |||
| 1308 | Ga0501070_0015982 | |||
| 1309 | Ga0501070_0044170 | |||
| 1310 | Ga0501071_0081985 | |||
| 1311 | Ga0501071_0178584 | |||
| 1312 | Ga0501071_0185487 | |||
| 1313 | Ga0501072_0013570 | |||
| 1314 | Ga0501072_0045391 | |||
| 1315 | Ga0501072_0050414 | |||
| 1316 | Ga0501072_0093640 | |||
| 1317 | Ga0501072_0142203 | |||
| 1318 | Ga0501073_0015435 | |||
| 1319 | Ga0501074_0025223 | |||
| 1320 | Ga0501074_0031040 | |||
| 1321 | Ga0501074_0047210 | |||
| 1322 | Ga0501075_0031379 | |||
| 1323 | Ga0501075_0031617 | |||
| 1324 | Ga0501075_0075414 | |||
| 1325 | Ga0501076_0024125 | |||
| 1326 | Ga0501076_0037165 | |||
| 1327 | Ga0501076_0098239 | |||
| 1328 | Ga0501076_0103209 | |||
| 1329 | Ga0501079_0005283 | |||
| 1330 | Ga0501079_0033198 | |||
| 1331 | Ga0501079_0053611 | |||
| 1332 | Ga0501081_0038139 | |||
| 1333 | Ga0501081_0145200 | |||
| 1334 | Ga0501081_0200468 | |||
| 1335 | Ga0501081_0302956 | |||
| 1336 | Ga0501083_0004003 | |||
| 1337 | Ga0501083_0050166 | |||
| 1338 | Ga0501083_0126861 | |||
| 1339 | Ga0501035_0001433 | |||
| 1340 | Ga0501044_0001917 | |||
| 1341 | Ga0501044_0016666 | |||
| 1342 | Ga0501044_0068631 | |||
| 1343 | Ga0501044_0210184 | |||
| 1344 | Ga0501045_0001477 | |||
| 1345 | Ga0501045_0029794 | |||
| 1346 | nmdc:mga03n38_63656_c1 | |||
| 1347 | nmdc:mga00v17_45459_c1 | |||
| 1348 | nmdc:mga0yw44_25645_c1 | |||
| 1349 | nmdc:mga0yw44_37108_c1 | |||
| 1350 | nmdc:mga0yw44_4043_c1 | |||
| 1351 | nmdc:mga05p37_36964_c1 | |||
| 1352 | nmdc:mga0qj67_29365_c1 | |||
| 1353 | nmdc:mga0qj67_59068_c1 | |||
| 1354 | nmdc:mga06r32_24414_c1 | |||
| 1355 | nmdc:mga06r32_39918_c1 | |||
| 1356 | nmdc:mga06r32_6813_c1 | |||
| 1357 | nmdc:mga08y16_66487_c1 | |||
| 1358 | nmdc:mga0n895_157688_c1 | |||
| 1359 | nmdc:mga0a205_141251_c1 | |||
| 1360 | nmdc:mga0a205_30840_c1 | |||
| 1361 | nmdc:mga0a205_6_c1 | |||
| 1362 | Ga0495601_0000027 | |||
| 1363 | Ga0495601_0011991 | |||
| 1364 | Ga0495601_0014207 | |||
| 1365 | Ga0495612_0000022 | |||
| 1366 | Ga0495612_0008735 | |||
| 1367 | Ga0495612_0009045 | |||
| 1368 | Ga0495655_0000001 | |||
| 1369 | Ga0495595_0000022 | |||
| 1370 | Ga0495595_0000107 | |||
| 1371 | Ga0495619_0000008 | |||
| 1372 | Ga0495619_0000077 | |||
| 1373 | Ga0495619_0000152 | |||
| 1374 | Ga0495619_0000222 | |||
| 1375 | Ga0495619_0002672 | |||
| 1376 | Ga0495619_0057700 | |||
| 1377 | Ga0500566_0076600 | |||
| 1378 | Ga0500614_003276 | |||
| 1379 | Ga0500628_001454 | |||
| 1380 | Ga0501084_0001269 | |||
| 1381 | Ga0590074_003908 | |||
| 1382 | Ga0501082_0006205 | |||
| 1383 | Ga0501082_0008124 | |||
| 1384 | Ga0466962_0063478 | |||
| 1385 | Ga0530510_0000884 | |||
| 1386 | Ga0530510_0110154 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9364 | 7 | 312 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9311 | 5 | 312 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9298 | 4 | 313 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9279 | 5 | 312 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9268 | 7 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9703 | 112 | 216 | 1.10.150.170 |
| af_P60393_12_309_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9471 | 14 | 310 | 3.40.50.1000 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9417 | 112 | 216 | 1.10.150.170 |
| af_P9WJP1_66_380_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9415 | 6 | 312 | 3.40.50.150 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9395 | 7 | 312 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0PZV2-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) | 0.9794 | 1 | 160 |
GO:0003723
GO:0005737 GO:0070475 GO:0071424 |
| AF-A0A1Q6XIU7-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9783 | 17 | 312 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A2J0KW62-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9774 | 3 | 312 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A538GF30-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH | 0.9749 | 1 | 266 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A1Q6XIU7-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9718 | 17 | 312 |
GO:0005737
GO:0070475 GO:0071424 |