F475668

General Info

Members Datasets Scaffolds Average Seq Length
693 203 693 247

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0056198|Ga0466963_0056198_882_1697
Length 271
Sequence LTIEIRVDARARAPDAPNKGGIGMSRVLSLLFAIVCYAIFFATFLYLIAFVGDIMVPKTIDAPPSSLAPLPAAAIDVALIALFGLQHSIMARPGFKRAWTRLISPAIERSIFVLFASIALLILFWFWQPIDMRVWQVSPNARWLSEILWVMFWGGFGIVLVSTFLINHFELFGLQQAWFNLQGRELPAPELREPLFYRWVAHPLYAGFFLAFWATPHMTVGHLLLAIALSIYMLIAIRYEEHDLAGIFGDDYRRYREHVGMLWPRFRRRSA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4.76
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1027078 3300001904 Bacteria 889
2 JGI24741J21665_1005952 3300001915 Bacteria 2496
3 JGI24741J21665_1015401 3300001915 Bacteria 1262
4 JGI24740J21852_10010639 3300001979 Bacteria 3533
5 JGI24740J21852_10011240 3300001979 Bacteria 3415
6 JGI24739J22299_10028206 3300001989 Bacteria 1958
7 JGI24739J22299_10031542 3300001989 Bacteria 1830
8 JGI24737J22298_10013867 3300001990 Unclassified 2621
9 JGI24737J22298_10026699 3300001990 Bacteria 1823
10 JGI24737J22298_10077473 3300001990 Bacteria 991
11 JGI24735J21928_10010334 3300002067 Bacteria 2979
12 JGI24735J21928_10021837 3300002067 Bacteria 1952
13 JGI24735J21928_10028930 3300002067 Bacteria 1653
14 JGI24735J21928_10069807 3300002067 Bacteria 1007
15 JGI24744J21845_10000550 3300002077 Bacteria 6750
16 Ga0065715_10361050 3300005293 Bacteria 928
17 Ga0070658_10010002 3300005327 Bacteria 7618
18 Ga0070658_10012293 3300005327 Bacteria 6873
19 Ga0070658_10070206 3300005327 Bacteria 2867
20 Ga0070658_10080963 3300005327 Bacteria 2667
21 Ga0070658_10089528 3300005327 Bacteria 2534
22 Ga0070658_10130345 3300005327 Bacteria 2095
23 Ga0070658_10157115 3300005327 Bacteria 1907
24 Ga0070658_10203398 3300005327 Bacteria 1671
25 Ga0070658_10231805 3300005327 Bacteria 1563
26 Ga0070658_10245839 3300005327 Bacteria 1517
27 Ga0070658_10495075 3300005327 Bacteria 1055
28 Ga0070683_100004410 3300005329 Bacteria 11593
29 Ga0070683_100024152 3300005329 Bacteria 5441
30 Ga0070683_100125212 3300005329 Bacteria 2429
31 Ga0070683_100174155 3300005329 Bacteria 2043
32 Ga0070690_100004711 3300005330 Bacteria 7603
33 Ga0070690_100014947 3300005330 Bacteria 4618
34 Ga0070670_100010428 3300005331 Bacteria 7930
35 Ga0070670_100090737 3300005331 Bacteria 2626
36 Ga0070670_100789609 3300005331 Bacteria 857
37 Ga0070677_10217798 3300005333 Bacteria 931
38 Ga0068869_100064347 3300005334 Bacteria 2697
39 Ga0068869_100156979 3300005334 Bacteria 1768
40 Ga0070666_10000753 3300005335 Bacteria 19635
41 Ga0070666_10014487 3300005335 Bacteria 5022
42 Ga0070666_10015349 3300005335 Bacteria 4884
43 Ga0070680_100000683 3300005336 Bacteria 23493
44 Ga0070680_100002724 3300005336 Bacteria 13103
45 Ga0070680_100030548 3300005336 Bacteria 4328
46 Ga0070680_100088510 3300005336 Bacteria 2561
47 Ga0070680_100102190 3300005336 Bacteria 2380
48 Ga0070680_100468479 3300005336 Bacteria 1076
49 Ga0070682_100021462 3300005337 Bacteria 3811
50 Ga0070682_100074382 3300005337 Unclassified 2182
51 Ga0070682_100134859 3300005337 Bacteria 1676
52 Ga0068868_100015820 3300005338 Bacteria 5588
53 Ga0068868_100025829 3300005338 Bacteria 4471
54 Ga0068868_100076475 3300005338 Bacteria 2676
55 Ga0068868_100172603 3300005338 Bacteria 1790
56 Ga0068868_100771039 3300005338 Bacteria 866
57 Ga0070660_100017677 3300005339 Bacteria 5198
58 Ga0070660_100026442 3300005339 Bacteria 4320
59 Ga0070660_100026526 3300005339 Bacteria 4314
60 Ga0070660_100051584 3300005339 Bacteria 3168
61 Ga0070660_100121414 3300005339 Bacteria 2085
62 Ga0070660_100123766 3300005339 Bacteria 2065
63 Ga0070660_100139168 3300005339 Bacteria 1946
64 Ga0070660_100200870 3300005339 Bacteria 1617
65 Ga0070691_10028952 3300005341 Bacteria 2590
66 Ga0070661_100017688 3300005344 Bacteria 5059
67 Ga0070661_100028711 3300005344 Bacteria 4014
68 Ga0070661_100136456 3300005344 Bacteria 1846
69 Ga0070661_100194531 3300005344 Bacteria 1548
70 Ga0070661_100326998 3300005344 Bacteria 1198
71 Ga0070692_10007183 3300005345 Bacteria 4890
72 Ga0070692_10076955 3300005345 Bacteria 1789
73 Ga0070692_10151236 3300005345 Bacteria 1322
74 Ga0070692_10191333 3300005345 Bacteria 1192
75 Ga0070692_10197524 3300005345 Bacteria 1176
76 Ga0070668_100253873 3300005347 Bacteria 1460
77 Ga0070669_100124771 3300005353 Bacteria 1969
78 Ga0070669_100263121 3300005353 Bacteria 1377
79 Ga0070675_100061581 3300005354 Bacteria 3099
80 Ga0070675_100109026 3300005354 Bacteria 2339
81 Ga0070675_100186770 3300005354 Bacteria 1794
82 Ga0070671_100005658 3300005355 Bacteria 9948
83 Ga0070671_100008324 3300005355 Bacteria 8304
84 Ga0070671_100028479 3300005355 Bacteria 4600
85 Ga0070671_100059547 3300005355 Bacteria 3178
86 Ga0070671_100061989 3300005355 Bacteria 3114
87 Ga0070671_100075750 3300005355 Bacteria 2811
88 Ga0070671_100147609 3300005355 Bacteria 1985
89 Ga0070674_100009008 3300005356 Bacteria 5965
90 Ga0070674_100016218 3300005356 Bacteria 4668
91 Ga0070674_100105223 3300005356 Bacteria 2063
92 Ga0070674_100259599 3300005356 Bacteria 1368
93 Ga0070673_100013891 3300005364 Bacteria 5590
94 Ga0070673_100016122 3300005364 Bacteria 5273
95 Ga0070673_100023632 3300005364 Bacteria 4493
96 Ga0070673_100052110 3300005364 Bacteria 3209
97 Ga0070673_100127015 3300005364 Bacteria 2135
98 Ga0070673_100129701 3300005364 Bacteria 2114
99 Ga0070673_100354990 3300005364 Bacteria 1302
100 Ga0070659_100002531 3300005366 Bacteria 12994
101 Ga0070659_100023365 3300005366 Bacteria 4730
102 Ga0070659_100030921 3300005366 Bacteria 4145
103 Ga0070659_100032659 3300005366 Bacteria 4039
104 Ga0070659_100084394 3300005366 Bacteria 2540
105 Ga0070659_100099415 3300005366 Bacteria 2340
106 Ga0070659_100103667 3300005366 Bacteria 2291
107 Ga0070659_100139330 3300005366 Bacteria 1974
108 Ga0070659_100153824 3300005366 Bacteria 1877
109 Ga0070659_100179363 3300005366 Bacteria 1738
110 Ga0070659_100212652 3300005366 Bacteria 1594
111 Ga0070659_100242839 3300005366 Bacteria 1491
112 Ga0070659_100293063 3300005366 Bacteria 1355
113 Ga0070659_100674401 3300005366 Bacteria 892
114 Ga0070667_100004843 3300005367 Bacteria 11279
115 Ga0070667_100010621 3300005367 Bacteria 7602
116 Ga0070667_100053782 3300005367 Bacteria 3398
117 Ga0070667_100157027 3300005367 Bacteria 2001
118 Ga0070714_100103378 3300005435 Bacteria 2513
119 Ga0070714_100111177 3300005435 Bacteria 2426
120 Ga0070714_100158992 3300005435 Bacteria 2042
121 Ga0070714_100187374 3300005435 Bacteria 1886
122 Ga0070713_100416355 3300005436 Bacteria 1257
123 Ga0070663_100020724 3300005455 Bacteria 4356
124 Ga0070663_100024430 3300005455 Bacteria 4068
125 Ga0070663_100047615 3300005455 Bacteria 3037
126 Ga0070663_100068894 3300005455 Bacteria 2569
127 Ga0070663_100082758 3300005455 Bacteria 2362
128 Ga0070663_100130835 3300005455 Bacteria 1905
129 Ga0070678_100006559 3300005456 Bacteria 6839
130 Ga0070678_100008022 3300005456 Bacteria 6295
131 Ga0070678_100320353 3300005456 Bacteria 1324
132 Ga0070678_100371378 3300005456 Bacteria 1235
133 Ga0070662_100003219 3300005457 Bacteria 10152
134 Ga0070662_100038748 3300005457 Bacteria 3386
135 Ga0070662_100041402 3300005457 Bacteria 3286
136 Ga0070662_100090724 3300005457 Bacteria 2294
137 Ga0070662_100116066 3300005457 Bacteria 2046
138 Ga0070681_10081440 3300005458 Bacteria 3193
139 Ga0070681_10145066 3300005458 Bacteria 2303
140 Ga0070681_10434345 3300005458 Bacteria 1225
141 Ga0070681_10510786 3300005458 Bacteria 1115
142 Ga0068867_100007760 3300005459 Bacteria 7587
143 Ga0068867_100024893 3300005459 Bacteria 4291
144 Ga0068867_100047780 3300005459 Bacteria 3147
145 Ga0068867_100094307 3300005459 Bacteria 2276
146 Ga0070685_10014719 3300005466 Bacteria 4146
147 Ga0070685_10088397 3300005466 Bacteria 1871
148 Ga0070679_100317833 3300005530 Bacteria 1506
149 Ga0070679_100337957 3300005530 Bacteria 1454
150 Ga0070679_100342349 3300005530 Bacteria 1443
151 Ga0070679_100365315 3300005530 Bacteria 1391
152 Ga0070684_100013261 3300005535 Bacteria 6640
153 Ga0070684_100115223 3300005535 Bacteria 2413
154 Ga0070684_100147618 3300005535 Bacteria 2129
155 Ga0070684_100220175 3300005535 Bacteria 1732
156 Ga0068853_100035125 3300005539 Bacteria 4257
157 Ga0068853_100111764 3300005539 Unclassified 2427
158 Ga0068853_100182981 3300005539 Bacteria 1901
159 Ga0068853_100364729 3300005539 Bacteria 1346
160 Ga0070672_100003732 3300005543 Bacteria 9912
161 Ga0070672_100012806 3300005543 Bacteria 5905
162 Ga0070672_100268806 3300005543 Bacteria 1439
163 Ga0070686_100082749 3300005544 Bacteria 2129
164 Ga0070693_100056962 3300005547 Bacteria 2257
165 Ga0070665_100045702 3300005548 Bacteria 4397
166 Ga0070665_100430022 3300005548 Bacteria 1329
167 Ga0068855_100044189 3300005563 Bacteria 5273
168 Ga0068855_100104982 3300005563 Bacteria 3249
169 Ga0068855_100321669 3300005563 Bacteria 1710
170 Ga0068855_100371987 3300005563 Bacteria 1571
171 Ga0068855_100659876 3300005563 Bacteria 1122
172 Ga0070664_100014495 3300005564 Bacteria 6428
173 Ga0070664_100026954 3300005564 Bacteria 4773
174 Ga0070664_100123868 3300005564 Bacteria 2265
175 Ga0070664_100157203 3300005564 Bacteria 2009
176 Ga0070664_100179137 3300005564 Bacteria 1883
177 Ga0070664_100217941 3300005564 Bacteria 1707
178 Ga0070664_100260110 3300005564 Bacteria 1562
179 Ga0070664_100368008 3300005564 Bacteria 1310
180 Ga0068857_100048554 3300005577 Bacteria 3768
181 Ga0068857_100055560 3300005577 Bacteria 3513
182 Ga0068857_100150724 3300005577 Bacteria 2106
183 Ga0068857_100166876 3300005577 Bacteria 2000
184 Ga0068857_100237125 3300005577 Bacteria 1669
185 Ga0068854_100002329 3300005578 Bacteria 11711
186 Ga0068854_100012239 3300005578 Bacteria 5615
187 Ga0068854_100017667 3300005578 Bacteria 4777
188 Ga0068854_100058080 3300005578 Bacteria 2791
189 Ga0068854_100131098 3300005578 Bacteria 1914
190 Ga0068854_100153295 3300005578 Bacteria 1778
191 Ga0068854_100212652 3300005578 Bacteria 1526
192 Ga0068854_100317673 3300005578 Bacteria 1265
193 Ga0068854_100464349 3300005578 Bacteria 1060
194 Ga0068856_100037313 3300005614 Bacteria 4768
195 Ga0068856_100039087 3300005614 Bacteria 4659
196 Ga0068856_100047342 3300005614 Bacteria 4235
197 Ga0068856_100110001 3300005614 Bacteria 2752
198 Ga0068856_100133321 3300005614 Bacteria 2489
199 Ga0068852_100000992 3300005616 Bacteria 18727
200 Ga0068852_100014616 3300005616 Bacteria 6051
201 Ga0068852_100017959 3300005616 Bacteria 5563
202 Ga0068852_100044650 3300005616 Bacteria 3766
203 Ga0068852_100048730 3300005616 Bacteria 3621
204 Ga0068852_100245707 3300005616 Bacteria 1712
205 Ga0068852_100249983 3300005616 Bacteria 1698
206 Ga0068852_100279994 3300005616 Bacteria 1607
207 Ga0068859_100098596 3300005617 Bacteria 2976
208 Ga0068864_100020538 3300005618 Bacteria 5526
209 Ga0068864_100038673 3300005618 Bacteria 4075
210 Ga0068866_10032261 3300005718 Bacteria 2531
211 Ga0068866_10043558 3300005718 Bacteria 2241
212 Ga0068851_10034066 3300005834 Bacteria 2541
213 Ga0068851_10164608 3300005834 Bacteria 1220
214 Ga0068863_100026373 3300005841 Bacteria 5544
215 Ga0068863_100037237 3300005841 Bacteria 4632
216 Ga0068858_100018345 3300005842 Bacteria 6552
217 Ga0068858_100027855 3300005842 Bacteria 5249
218 Ga0068858_100178836 3300005842 Bacteria 2002
219 Ga0068858_100191433 3300005842 Bacteria 1933
220 Ga0068860_100081612 3300005843 Bacteria 3075
221 Ga0097621_100013809 3300006237 Bacteria 6029
222 Ga0097621_100030354 3300006237 Bacteria 4278
223 Ga0097621_100362096 3300006237 Bacteria 1292
224 Ga0097621_100770025 3300006237 Bacteria 890
225 Ga0068871_100019859 3300006358 Bacteria 5136
226 Ga0068871_100073340 3300006358 Bacteria 2821
227 Ga0075434_100000249 3300006871 Bacteria 37720
228 Ga0068865_100067256 3300006881 Bacteria 2530
229 Ga0097620_100098598 3300006931 Bacteria 2976
230 Ga0105240_10079294 3300009093 Bacteria 4041
231 Ga0105240_10096990 3300009093 Bacteria 3592
232 Ga0105240_10122400 3300009093 Bacteria 3131
233 Ga0105240_10126571 3300009093 Bacteria 3070
234 Ga0105240_10254026 3300009093 Bacteria 2031
235 Ga0105245_10013595 3300009098 Bacteria 7091
236 Ga0105245_10044859 3300009098 Bacteria 3946
237 Ga0105245_10254925 3300009098 Bacteria 1706
238 Ga0105245_10501425 3300009098 Bacteria 1230
239 Ga0105243_10051458 3300009148 Bacteria 3258
240 Ga0105241_10070244 3300009174 Bacteria 2717
241 Ga0105241_10226945 3300009174 Bacteria 1573
242 Ga0105241_10399448 3300009174 Bacteria 1205
243 Ga0105242_10022015 3300009176 Bacteria 5009
244 Ga0105242_10709164 3300009176 Bacteria 985
245 Ga0105248_10011642 3300009177 Bacteria 9692
246 Ga0105248_10025655 3300009177 Bacteria 6554
247 Ga0105248_10051957 3300009177 Bacteria 4599
248 Ga0105248_10095943 3300009177 Bacteria 3339
249 Ga0105248_10322128 3300009177 Bacteria 1741
250 Ga0105248_10447874 3300009177 Bacteria 1455
251 Ga0105237_10056171 3300009545 Bacteria 3941
252 Ga0105237_10143831 3300009545 Bacteria 2379
253 Ga0105238_10043379 3300009551 Bacteria 4551
254 Ga0105238_10047590 3300009551 Bacteria 4323
255 Ga0105238_10047987 3300009551 Bacteria 4304
256 Ga0105238_10195702 3300009551 Bacteria 1997
257 Ga0105239_10031979 3300010375 Bacteria 5782
258 Ga0105246_10168820 3300011119 Bacteria 1674
259 Ga0105246_10622320 3300011119 Bacteria 936
260 Ga0157373_10006944 3300013100 Bacteria 8430
261 Ga0157373_10016085 3300013100 Bacteria 5461
262 Ga0157373_10042678 3300013100 Bacteria 3241
263 Ga0157373_10066079 3300013100 Bacteria 2559
264 Ga0157373_10073636 3300013100 Bacteria 2410
265 Ga0157373_10129930 3300013100 Bacteria 1771
266 Ga0157373_10180324 3300013100 Bacteria 1487
267 Ga0157373_10273457 3300013100 Bacteria 1196
268 Ga0157371_10009986 3300013102 Bacteria 7430
269 Ga0157371_10017317 3300013102 Bacteria 5357
270 Ga0157371_10056390 3300013102 Bacteria 2787
271 Ga0157371_10069129 3300013102 Bacteria 2500
272 Ga0157371_10080497 3300013102 Bacteria 2307
273 Ga0157371_10102969 3300013102 Bacteria 2026
274 Ga0157371_10127075 3300013102 Bacteria 1813
275 Ga0157371_10161793 3300013102 Bacteria 1599
276 Ga0157371_10191993 3300013102 Bacteria 1462
277 Ga0157371_10257272 3300013102 Bacteria 1258
278 Ga0157371_10311490 3300013102 Bacteria 1141
279 Ga0157370_10122831 3300013104 Bacteria 2425
280 Ga0157370_10148397 3300013104 Bacteria 2183
281 Ga0157370_10158100 3300013104 Bacteria 2108
282 Ga0157370_10161998 3300013104 Bacteria 2081
283 Ga0157370_10201109 3300013104 Bacteria 1848
284 Ga0157370_10688470 3300013104 Bacteria 933
285 Ga0157369_10062548 3300013105 Bacteria 4010
286 Ga0157369_10092040 3300013105 Bacteria 3236
287 Ga0157369_10221541 3300013105 Bacteria 1980
288 Ga0157369_10240855 3300013105 Bacteria 1889
289 Ga0157369_10522635 3300013105 Bacteria 1228
290 Ga0157374_10011026 3300013296 Bacteria 7805
291 Ga0157374_10051583 3300013296 Bacteria 3828
292 Ga0157374_10070953 3300013296 Bacteria 3283
293 Ga0157374_10173181 3300013296 Bacteria 2106
294 Ga0157378_10038607 3300013297 Bacteria 4233
295 Ga0157378_10069268 3300013297 Bacteria 3164
296 Ga0157378_10387971 3300013297 Bacteria 1373
297 Ga0163162_10008489 3300013306 Bacteria 10023
298 Ga0163162_10053795 3300013306 Bacteria 4046
299 Ga0163162_10481227 3300013306 Bacteria 1373
300 Ga0157372_10008481 3300013307 Bacteria 10908
301 Ga0157372_10092526 3300013307 Bacteria 3440
302 Ga0157372_10129321 3300013307 Bacteria 2904
303 Ga0157372_10162635 3300013307 Bacteria 2580
304 Ga0157372_10194622 3300013307 Bacteria 2349
305 Ga0157372_10609867 3300013307 Bacteria 1272
306 Ga0157372_10891420 3300013307 Bacteria 1032
307 Ga0157375_10009672 3300013308 Bacteria 8477
308 Ga0157375_10079159 3300013308 Bacteria 3321
309 Ga0157375_10125442 3300013308 Bacteria 2681
310 Ga0157375_10722023 3300013308 Bacteria 1149
311 Ga0163163_10003869 3300014325 Bacteria 12754
312 Ga0163163_10017657 3300014325 Bacteria 6661
313 Ga0157377_10023993 3300014745 Bacteria 3239
314 Ga0157377_10097190 3300014745 Bacteria 1748
315 Ga0157379_10017522 3300014968 Bacteria 6304
316 Ga0157376_10023310 3300014969 Bacteria 4842
317 Ga0157376_10145098 3300014969 Bacteria 2134
318 Ga0206353_10060407 3300020082 Bacteria 1127
319 Ga0206353_10496975 3300020082 Bacteria 2497
320 Ga0207697_10012116 3300025315 Bacteria 3628
321 Ga0207697_10051789 3300025315 Bacteria 1697
322 Ga0207697_10059364 3300025315 Unclassified 1590
323 Ga0207697_10079698 3300025315 Bacteria 1379
324 Ga0207656_10008586 3300025321 Bacteria 3765
325 Ga0207656_10033202 3300025321 Bacteria 2148
326 Ga0207682_10064759 3300025893 Bacteria 1537
327 Ga0207682_10171992 3300025893 Bacteria 986
328 Ga0207688_10116128 3300025901 Bacteria 1558
329 Ga0207680_10002819 3300025903 Bacteria 8141
330 Ga0207680_10123373 3300025903 Bacteria 1697
331 Ga0207647_10007320 3300025904 Bacteria 7984
332 Ga0207647_10023562 3300025904 Bacteria 4070
333 Ga0207647_10032914 3300025904 Bacteria 3325
334 Ga0207647_10039292 3300025904 Bacteria 2986
335 Ga0207647_10062277 3300025904 Bacteria 2273
336 Ga0207647_10091309 3300025904 Bacteria 1816
337 Ga0207647_10123794 3300025904 Unclassified 1523
338 Ga0207647_10173446 3300025904 Bacteria 1255
339 Ga0207647_10175312 3300025904 Bacteria 1247
340 Ga0207645_10019263 3300025907 Bacteria 4475
341 Ga0207645_10048966 3300025907 Bacteria 2699
342 Ga0207645_10186465 3300025907 Bacteria 1362
343 Ga0207643_10227947 3300025908 Bacteria 1142
344 Ga0207705_10000030 3300025909 Bacteria 239341
345 Ga0207705_10014792 3300025909 Bacteria 5610
346 Ga0207705_10053709 3300025909 Bacteria 2903
347 Ga0207705_10071502 3300025909 Bacteria 2515
348 Ga0207705_10103080 3300025909 Bacteria 2101
349 Ga0207705_10158479 3300025909 Bacteria 1699
350 Ga0207705_10184883 3300025909 Bacteria 1574
351 Ga0207707_10164391 3300025912 Bacteria 1940
352 Ga0207707_10189917 3300025912 Bacteria 1792
353 Ga0207695_10008696 3300025913 Bacteria 12665
354 Ga0207695_10065597 3300025913 Bacteria 3733
355 Ga0207671_10320936 3300025914 Bacteria 1226
356 Ga0207660_10000438 3300025917 Bacteria 27496
357 Ga0207660_10000522 3300025917 Bacteria 25663
358 Ga0207660_10040305 3300025917 Bacteria 3270
359 Ga0207660_10055818 3300025917 Bacteria 2824
360 Ga0207660_10069032 3300025917 Bacteria 2565
361 Ga0207657_10006672 3300025919 Bacteria 11938
362 Ga0207657_10011457 3300025919 Bacteria 8804
363 Ga0207657_10014835 3300025919 Bacteria 7585
364 Ga0207657_10020788 3300025919 Bacteria 6195
365 Ga0207657_10023453 3300025919 Bacteria 5745
366 Ga0207657_10031434 3300025919 Bacteria 4809
367 Ga0207657_10032552 3300025919 Bacteria 4709
368 Ga0207657_10100863 3300025919 Bacteria 2396
369 Ga0207657_10120334 3300025919 Unclassified 2160
370 Ga0207657_10234284 3300025919 Bacteria 1467
371 Ga0207657_10284744 3300025919 Unclassified 1311
372 Ga0207657_10454192 3300025919 Bacteria 1005
373 Ga0207649_10001000 3300025920 Bacteria 17495
374 Ga0207649_10010472 3300025920 Bacteria 5096
375 Ga0207649_10014726 3300025920 Bacteria 4385
376 Ga0207649_10037336 3300025920 Bacteria 2934
377 Ga0207649_10134267 3300025920 Bacteria 1685
378 Ga0207649_10275994 3300025920 Bacteria 1220
379 Ga0207652_10037733 3300025921 Bacteria 4090
380 Ga0207652_10079314 3300025921 Bacteria 2868
381 Ga0207652_10091999 3300025921 Bacteria 2667
382 Ga0207652_10172448 3300025921 Bacteria 1941
383 Ga0207652_10211101 3300025921 Bacteria 1748
384 Ga0207681_10249655 3300025923 Bacteria 1385
385 Ga0207694_10014383 3300025924 Bacteria 5964
386 Ga0207694_10052961 3300025924 Bacteria 3146
387 Ga0207694_10267142 3300025924 Bacteria 1402
388 Ga0207694_10469002 3300025924 Bacteria 1052
389 Ga0207650_10410401 3300025925 Bacteria 1122
390 Ga0207650_10425561 3300025925 Bacteria 1102
391 Ga0207659_10011691 3300025926 Bacteria 5554
392 Ga0207659_10100135 3300025926 Bacteria 2183
393 Ga0207659_10562210 3300025926 Bacteria 970
394 Ga0207687_10024032 3300025927 Bacteria 4066
395 Ga0207687_10367602 3300025927 Bacteria 1175
396 Ga0207664_10129522 3300025929 Bacteria 2122
397 Ga0207664_10139560 3300025929 Bacteria 2048
398 Ga0207644_10000243 3300025931 Bacteria 37412
399 Ga0207644_10003259 3300025931 Bacteria 10480
400 Ga0207644_10004423 3300025931 Bacteria 9121
401 Ga0207644_10066054 3300025931 Bacteria 2632
402 Ga0207644_10160076 3300025931 Bacteria 1749
403 Ga0207644_10186645 3300025931 Bacteria 1628
404 Ga0207644_10468584 3300025931 Bacteria 1036
405 Ga0207690_10003400 3300025932 Bacteria 9509
406 Ga0207690_10005651 3300025932 Bacteria 7390
407 Ga0207690_10009186 3300025932 Bacteria 5869
408 Ga0207690_10018027 3300025932 Bacteria 4323
409 Ga0207690_10114978 3300025932 Bacteria 1944
410 Ga0207690_10133972 3300025932 Bacteria 1817
411 Ga0207690_10189646 3300025932 Bacteria 1554
412 Ga0207690_10197901 3300025932 Bacteria 1524
413 Ga0207690_10358681 3300025932 Bacteria 1154
414 Ga0207706_10000614 3300025933 Bacteria 37833
415 Ga0207706_10012750 3300025933 Bacteria 7650
416 Ga0207706_10017400 3300025933 Bacteria 6476
417 Ga0207706_10029145 3300025933 Bacteria 4929
418 Ga0207706_10031954 3300025933 Bacteria 4690
419 Ga0207706_10044628 3300025933 Bacteria 3929
420 Ga0207706_10058768 3300025933 Bacteria 3386
421 Ga0207706_10059934 3300025933 Bacteria 3352
422 Ga0207706_10234872 3300025933 Bacteria 1603
423 Ga0207686_10096963 3300025934 Bacteria 1960
424 Ga0207669_10005421 3300025937 Bacteria 5723
425 Ga0207669_10016552 3300025937 Bacteria 3750
426 Ga0207669_10195538 3300025937 Bacteria 1463
427 Ga0207704_10022279 3300025938 Bacteria 3391
428 Ga0207704_10167204 3300025938 Bacteria 1572
429 Ga0207691_10008543 3300025940 Bacteria 9832
430 Ga0207691_10026627 3300025940 Bacteria 5425
431 Ga0207691_10277372 3300025940 Bacteria 1443
432 Ga0207711_10001208 3300025941 Bacteria 24465
433 Ga0207711_10004361 3300025941 Bacteria 12073
434 Ga0207711_10039055 3300025941 Bacteria 4037
435 Ga0207711_10110682 3300025941 Bacteria 2442
436 Ga0207711_10218744 3300025941 Bacteria 1741
437 Ga0207689_10019180 3300025942 Bacteria 5766
438 Ga0207689_10417576 3300025942 Bacteria 1119
439 Ga0207689_10547702 3300025942 Bacteria 972
440 Ga0207661_10213608 3300025944 Bacteria 1701
441 Ga0207661_10488674 3300025944 Bacteria 1124
442 Ga0207679_10069214 3300025945 Bacteria 2655
443 Ga0207679_10106066 3300025945 Bacteria 2208
444 Ga0207679_10108555 3300025945 Bacteria 2185
445 Ga0207679_10128221 3300025945 Bacteria 2031
446 Ga0207679_10208977 3300025945 Bacteria 1635
447 Ga0207679_10233828 3300025945 Bacteria 1553
448 Ga0207679_10852542 3300025945 Bacteria 832
449 Ga0207667_10007585 3300025949 Bacteria 13014
450 Ga0207667_10056324 3300025949 Bacteria 4130
451 Ga0207667_10167647 3300025949 Bacteria 2257
452 Ga0207667_10239442 3300025949 Bacteria 1857
453 Ga0207667_10253451 3300025949 Bacteria 1800
454 Ga0207651_10004605 3300025960 Bacteria 6982
455 Ga0207651_10007284 3300025960 Bacteria 5880
456 Ga0207651_10018623 3300025960 Bacteria 4138
457 Ga0207651_10020708 3300025960 Bacteria 3977
458 Ga0207651_10043587 3300025960 Bacteria 2996
459 Ga0207651_10221539 3300025960 Bacteria 1529
460 Ga0207640_10005014 3300025981 Bacteria 7199
461 Ga0207640_10010452 3300025981 Bacteria 5228
462 Ga0207640_10043563 3300025981 Bacteria 2869
463 Ga0207640_10059719 3300025981 Bacteria 2518
464 Ga0207640_10178042 3300025981 Bacteria 1592
465 Ga0207658_10002850 3300025986 Bacteria 12385
466 Ga0207658_10008745 3300025986 Bacteria 6879
467 Ga0207658_10022779 3300025986 Bacteria 4363
468 Ga0207658_10558145 3300025986 Bacteria 1025
469 Ga0207677_10000529 3300026023 Bacteria 24143
470 Ga0207677_10011520 3300026023 Bacteria 5047
471 Ga0207677_10109180 3300026023 Bacteria 2056
472 Ga0207703_10003391 3300026035 Bacteria 13382
473 Ga0207703_10012417 3300026035 Bacteria 6639
474 Ga0207703_10499086 3300026035 Bacteria 1142
475 Ga0207639_10006339 3300026041 Bacteria 8033
476 Ga0207639_10110332 3300026041 Bacteria 2241
477 Ga0207639_10187095 3300026041 Bacteria 1766
478 Ga0207639_10283602 3300026041 Bacteria 1457
479 Ga0207678_10007662 3300026067 Bacteria 9536
480 Ga0207678_10011032 3300026067 Bacteria 7936
481 Ga0207678_10012837 3300026067 Bacteria 7354
482 Ga0207678_10016026 3300026067 Bacteria 6585
483 Ga0207678_10031229 3300026067 Bacteria 4647
484 Ga0207678_10042935 3300026067 Bacteria 3914
485 Ga0207678_10101379 3300026067 Bacteria 2458
486 Ga0207702_10004609 3300026078 Bacteria 12211
487 Ga0207702_10017653 3300026078 Bacteria 5904
488 Ga0207702_10030325 3300026078 Bacteria 4506
489 Ga0207702_10104553 3300026078 Bacteria 2506
490 Ga0207702_10322584 3300026078 Unclassified 1471
491 Ga0207702_10392627 3300026078 Bacteria 1336
492 Ga0207641_10027657 3300026088 Bacteria 4684
493 Ga0207641_10104078 3300026088 Bacteria 2505
494 Ga0207648_10011459 3300026089 Bacteria 8349
495 Ga0207648_10015863 3300026089 Bacteria 6907
496 Ga0207648_10035351 3300026089 Bacteria 4401
497 Ga0207648_10040779 3300026089 Bacteria 4079
498 Ga0207676_10045412 3300026095 Bacteria 3394
499 Ga0207674_10001687 3300026116 Bacteria 28359
500 Ga0207674_10025523 3300026116 Bacteria 6300
501 Ga0207674_10031516 3300026116 Bacteria 5569
502 Ga0207674_10038234 3300026116 Bacteria 4985
503 Ga0207674_10049173 3300026116 Bacteria 4314
504 Ga0207674_10068656 3300026116 Bacteria 3567
505 Ga0207674_10647790 3300026116 Bacteria 1020
506 Ga0207683_10000846 3300026121 Bacteria 28093
507 Ga0207683_10003293 3300026121 Bacteria 14080
508 Ga0207683_10004238 3300026121 Bacteria 12379
509 Ga0207683_10013463 3300026121 Bacteria 6978
510 Ga0207683_10440000 3300026121 Bacteria 1202
511 Ga0207698_10000739 3300026142 Bacteria 18966
512 Ga0207698_10009108 3300026142 Bacteria 6309
513 Ga0207698_10027136 3300026142 Bacteria 4062
514 Ga0207698_10042442 3300026142 Bacteria 3398
515 Ga0207698_10049263 3300026142 Bacteria 3205
516 Ga0207698_10276171 3300026142 Bacteria 1552
517 Ga0207698_10326628 3300026142 Bacteria 1439
518 Ga0209974_10035446 3300027876 Unclassified 1657
519 Ga0268266_10032066 3300028379 Bacteria 4463
520 Ga0268266_10357130 3300028379 Bacteria 1374
521 Ga0268264_10070538 3300028381 Bacteria 2958
522 Ga0307517_10046543 3300028786 Bacteria 4521
523 Ga0316182_1087467 3300030745 Unclassified 1066
524 Ga0316182_1092649 3300030745 Bacteria 1973
525 Ga0307408_100016656 3300031548 Bacteria 4911
526 Ga0307408_100033445 3300031548 Bacteria 3592
527 Ga0307408_100316316 3300031548 Bacteria 1313
528 Ga0307405_10009331 3300031731 Bacteria 5024
529 Ga0307405_10017649 3300031731 Bacteria 3922
530 Ga0307405_10099537 3300031731 Bacteria 1946
531 Ga0307405_10163476 3300031731 Bacteria 1580
532 Ga0307413_10002633 3300031824 Bacteria 7345
533 Ga0307413_10026191 3300031824 Bacteria 3210
534 Ga0307410_10008532 3300031852 Bacteria 5688
535 Ga0307410_10045089 3300031852 Bacteria 2933
536 Ga0307410_10335885 3300031852 Bacteria 1203
537 Ga0307410_10518455 3300031852 Bacteria 983
538 Ga0307406_10005210 3300031901 Bacteria 7104
539 Ga0307406_10006066 3300031901 Bacteria 6641
540 Ga0307406_10036445 3300031901 Bacteria 3031
541 Ga0307407_10007325 3300031903 Bacteria 4988
542 Ga0307407_10061866 3300031903 Bacteria 2190
543 Ga0307407_10069924 3300031903 Bacteria 2085
544 Ga0307412_10024284 3300031911 Bacteria 3741
545 Ga0307412_10150465 3300031911 Bacteria 1717
546 Ga0307409_100004995 3300031995 Bacteria 7552
547 Ga0307409_100057300 3300031995 Bacteria 3018
548 Ga0307416_100001470 3300032002 Bacteria 12838
549 Ga0307416_100086559 3300032002 Bacteria 2672
550 Ga0307416_100138581 3300032002 Bacteria 2206
551 Ga0307416_100218924 3300032002 Bacteria 1824
552 Ga0307416_100558895 3300032002 Bacteria 1219
553 Ga0307416_100606253 3300032002 Bacteria 1175
554 Ga0307416_100866184 3300032002 Bacteria 1002
555 Ga0307414_10024082 3300032004 Bacteria 3875
556 Ga0307411_10005177 3300032005 Bacteria 6375
557 Ga0307411_10006005 3300032005 Bacteria 6034
558 Ga0307411_10021236 3300032005 Bacteria 3794
559 Ga0307415_100000898 3300032126 Bacteria 13619
560 Ga0307415_100008028 3300032126 Bacteria 5823
561 Ga0307415_100204911 3300032126 Bacteria 1568
562 Ga0373932_0049454 3300035112 Bacteria 1243
563 Ga0373931_0339761 3300035691 Bacteria 937
564 Ga0395899_0007795 3300037312 Bacteria 8256
565 Ga0395899_0068769 3300037312 Bacteria 2595
566 Ga0395899_0105000 3300037312 Bacteria 2036
567 Ga0395899_0167088 3300037312 Bacteria 1551
568 Ga0395899_0179320 3300037312 Bacteria 1488
569 Ga0395899_0246502 3300037312 Bacteria 1227
570 Ga0395900_0039490 3300037418 Bacteria 4863
571 Ga0395900_0044753 3300037418 Bacteria 4560
572 Ga0395900_0046474 3300037418 Bacteria 4470
573 Ga0395900_0046853 3300037418 Bacteria 4451
574 Ga0395900_0054284 3300037418 Bacteria 4125
575 Ga0395900_0057224 3300037418 Bacteria 4013
576 Ga0395900_0076977 3300037418 Bacteria 3427
577 Ga0395900_0088680 3300037418 Bacteria 3180
578 Ga0395900_0102787 3300037418 Bacteria 2935
579 Ga0395900_0114450 3300037418 Bacteria 2768
580 Ga0395900_0205261 3300037418 Bacteria 1992
581 Ga0395900_0218827 3300037418 Bacteria 1920
582 Ga0395900_0225118 3300037418 Bacteria 1889
583 Ga0395900_0255616 3300037418 Bacteria 1751
584 Ga0395900_0336332 3300037418 Bacteria 1486
585 Ga0395900_0413624 3300037418 Bacteria 1310
586 Ga0395900_0466753 3300037418 Bacteria 1216
587 Ga0395900_0640887 3300037418 Bacteria 1000
588 Ga0395900_0741115 3300037418 Bacteria 913
589 Ga0395898_0037311 3300037466 Bacteria 4822
590 Ga0395898_0138450 3300037466 Bacteria 2330
591 Ga0395898_0152257 3300037466 Bacteria 2212
592 Ga0395898_0157882 3300037466 Bacteria 2169
593 Ga0395898_0235509 3300037466 Bacteria 1746
594 Ga0395898_0264936 3300037466 Bacteria 1639
595 Ga0395905_0000226 3300037471 Bacteria 85938
596 Ga0395905_0005143 3300037471 Bacteria 13426
597 Ga0395905_0005435 3300037471 Bacteria 13014
598 Ga0395905_0016861 3300037471 Bacteria 6941
599 Ga0395905_0028576 3300037471 Bacteria 5256
600 Ga0395905_0029552 3300037471 Bacteria 5164
601 Ga0395905_0043361 3300037471 Bacteria 4220
602 Ga0395905_0048262 3300037471 Bacteria 3990
603 Ga0395905_0096105 3300037471 Bacteria 2781
604 Ga0395905_0132699 3300037471 Bacteria 2342
605 Ga0395905_0188134 3300037471 Bacteria 1937
606 Ga0395905_0404044 3300037471 Bacteria 1261
607 Ga0395905_0449963 3300037471 Bacteria 1186
608 Ga0395905_0594126 3300037471 Bacteria 1009
609 Ga0395905_0684623 3300037471 Bacteria 928
610 Ga0395901_0000516 3300038443 Bacteria 44694
611 Ga0395901_0019225 3300038443 Bacteria 6983
612 Ga0395901_0036450 3300038443 Bacteria 5084
613 Ga0395901_0063228 3300038443 Bacteria 3852
614 Ga0395901_0083516 3300038443 Bacteria 3338
615 Ga0395901_0131118 3300038443 Bacteria 2634
616 Ga0395901_0420783 3300038443 Bacteria 1370
617 Ga0395901_0530839 3300038443 Bacteria 1194
618 Ga0451791_1947175 3300041451 Bacteria 2460
619 Ga0451797_1305776 3300041453 Bacteria 1381
620 Ga0451807_0169169 3300041486 Bacteria 1174
621 Ga0451853_3172401 3300041512 Bacteria 1810
622 Ga0439442_074015 3300042002 Bacteria 726
623 Ga0439445_0000271 3300042004 Bacteria 10008
624 Ga0466963_0001244 3300044694 Bacteria 13468
625 Ga0466963_0031748 3300044694 Bacteria 3415
626 Ga0466963_0056198 3300044694 Bacteria 2618
627 Ga0466963_0097060 3300044694 Bacteria 2013
628 Ga0466963_0097762 3300044694 Bacteria 2006
629 Ga0466963_0171420 3300044694 Unclassified 1513
630 Ga0466957_0027232 3300044842 Bacteria 3396
631 Ga0466957_0139358 3300044842 Unclassified 1562
632 Ga0466957_0273344 3300044842 Bacteria 1129
633 Ga0466957_0310496 3300044842 Unclassified 1062
634 Ga0466959_0169896 3300045049 Bacteria 1529
635 Ga0466958_0025271 3300045836 Unclassified 3500
636 Ga0466958_0157946 3300045836 Bacteria 1431
637 Ga0466958_0240217 3300045836 Bacteria 1158
638 Ga0466967_0003821 3300045976 Bacteria 9965
639 Ga0466967_0014645 3300045976 Bacteria 6119
640 Ga0466967_0092625 3300045976 Bacteria 2748
641 Ga0466967_0094828 3300045976 Bacteria 2718
642 Ga0466967_0102570 3300045976 Bacteria 2617
643 Ga0466967_0157795 3300045976 Bacteria 2127
644 Ga0495580_0365298 3300046472 Bacteria 976
645 Ga0495616_0001887 3300046513 Bacteria 14157
646 Ga0495663_0049186 3300046525 Bacteria 1301
647 Ga0495598_0007096 3300046537 Bacteria 2556
648 Ga0495621_0014562 3300046539 Bacteria 2491
649 Ga0495633_0024554 3300046558 Bacteria 2977
650 Ga0495669_0007001 3300046684 Bacteria 4721
651 Ga0495669_0025351 3300046684 Bacteria 2586
652 Ga0495669_0029398 3300046684 Bacteria 2409
653 Ga0495670_0026037 3300046691 Bacteria 2895
654 Ga0495670_0047286 3300046691 Bacteria 2150
655 Ga0496100_0000774 3300048903 Bacteria 15222
656 Ga0496100_0012042 3300048903 Bacteria 4945
657 Ga0496101_0000256 3300048904 Bacteria 37912
658 Ga0496101_0009833 3300048904 Bacteria 6301
659 Ga0496102_0095370 3300048905 Bacteria 2757
660 Ga0496103_0006781 3300048906 Bacteria 6833
661 Ga0496103_0175434 3300048906 Bacteria 1377
662 Ga0496104_0028310 3300048907 Bacteria 5194
663 Ga0496105_0041939 3300048908 Bacteria 3772
664 Ga0496106_0053723 3300048909 Bacteria 3043
665 Ga0496106_0076790 3300048909 Bacteria 2561
666 Ga0496106_0092637 3300048909 Bacteria 2334
667 Ga0496107_0001584 3300048910 Bacteria 14147
668 Ga0496107_0008008 3300048910 Bacteria 7293
669 Ga0496108_0000673 3300048911 Bacteria 26408
670 Ga0496108_0004508 3300048911 Bacteria 11220
671 Ga0496109_0005202 3300048912 Bacteria 10866
672 Ga0496109_0022324 3300048912 Bacteria 5604
673 Ga0496110_0001683 3300048913 Bacteria 16224
674 Ga0496110_0026844 3300048913 Bacteria 4931
675 Ga0496111_0000420 3300048914 Bacteria 21379
676 Ga0496111_0034917 3300048914 Bacteria 3591
677 Ga0496112_0061448 3300048915 Bacteria 3703
678 Ga0496112_0349300 3300048915 Unclassified 1421
679 Ga0496112_0417348 3300048915 Bacteria 1281
680 Ga0496113_0000242 3300048916 Bacteria 25756
681 Ga0496114_0000016 3300048917 Bacteria 274656
682 Ga0496114_0032733 3300048917 Bacteria 4281
683 Ga0496114_0170287 3300048917 Bacteria 1897
684 Ga0496115_0069416 3300048918 Bacteria 2854
685 Ga0501068_0149480 3300049584 Bacteria 1467
686 Ga0501070_0105959 3300049586 Bacteria 2324
687 Ga0501074_0186257 3300049590 Unclassified 1480
688 Ga0501209_118276 3300049656 Bacteria 785
689 nmdc:mga0n895_1016_c1 3300050512 Bacteria 20401
690 nmdc:mga0rr50_906_c2 3300050513 Bacteria 4995
691 nmdc:mga08x19_114437_c1 3300050514 Bacteria 1802
692 Ga0500643_000004 3300053087 Bacteria 857484
693 Ga0466962_0164313 3300061719 Bacteria 1080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042002 Ga0439442_074015 Ga0439442_074015_90_716 194
2 3300025315 Ga0207697_10059364 Ga0207697_100593642 207
3 3300013105 Ga0157369_10522635 Ga0157369_105226352 213
4 3300030745 Ga0316182_1087467 Ga0316182_10874672 213
5 3300005327 Ga0070658_10203398 Ga0070658_102033982 218
6 3300005336 Ga0070680_100468479 Ga0070680_1004684791 218
7 3300005339 Ga0070660_100139168 Ga0070660_1001391684 218
8 3300005344 Ga0070661_100194531 Ga0070661_1001945313 218
9 3300013100 Ga0157373_10129930 Ga0157373_101299302 218
10 3300013102 Ga0157371_10161793 Ga0157371_101617932 218
11 3300013104 Ga0157370_10201109 Ga0157370_102011092 218
12 3300013105 Ga0157369_10092040 Ga0157369_100920405 218
13 3300025909 Ga0207705_10158479 Ga0207705_101584792 218
14 3300025920 Ga0207649_10037336 Ga0207649_100373362 218
15 3300005577 Ga0068857_100048554 Ga0068857_1000485542 221
16 3300005617 Ga0068859_100098596 Ga0068859_1000985962 221
17 3300006931 Ga0097620_100098598 Ga0097620_1000985982 221
18 3300026116 Ga0207674_10038234 Ga0207674_100382345 221
19 3300037418 Ga0395900_0225118 Ga0395900_0225118_453_1202 221
20 3300038443 Ga0395901_0420783 Ga0395901_0420783_559_1308 221
21 3300005366 Ga0070659_100179363 Ga0070659_1001793632 223
22 3300037418 Ga0395900_0102787 Ga0395900_0102787_1607_2353 223
23 3300037466 Ga0395898_0157882 Ga0395898_0157882_734_1480 223
24 3300038443 Ga0395901_0530839 Ga0395901_0530839_401_1147 223
25 3300037471 Ga0395905_0029552 Ga0395905_0029552_923_1663 224
26 3300049656 Ga0501209_118276 Ga0501209_118276_24_746 224
27 3300031548 Ga0307408_100016656 Ga0307408_1000166563 225
28 3300031824 Ga0307413_10026191 Ga0307413_100261913 225
29 3300031852 Ga0307410_10045089 Ga0307410_100450894 225
30 3300031901 Ga0307406_10006066 Ga0307406_100060662 225
31 3300031903 Ga0307407_10061866 Ga0307407_100618665 225
32 3300032005 Ga0307411_10005177 Ga0307411_100051776 225
33 3300032126 Ga0307415_100008028 Ga0307415_1000080282 225
34 3300009177 Ga0105248_10011642 Ga0105248_100116425 226
35 3300048903 Ga0496100_0012042 Ga0496100_0012042_2072_2833 226
36 3300048904 Ga0496101_0009833 Ga0496101_0009833_1947_2708 226
37 3300048909 Ga0496106_0092637 Ga0496106_0092637_119_880 226
38 3300048910 Ga0496107_0008008 Ga0496107_0008008_661_1422 226
39 3300048917 Ga0496114_0032733 Ga0496114_0032733_1574_2335 226
40 3300048918 Ga0496115_0069416 Ga0496115_0069416_961_1722 226
41 3300001915 JGI24741J21665_1015401 JGI24741J21665_10154013 227
42 3300001979 JGI24740J21852_10011240 JGI24740J21852_100112406 227
43 3300002067 JGI24735J21928_10010334 JGI24735J21928_100103341 227
44 3300002067 JGI24735J21928_10028930 JGI24735J21928_100289302 227
45 3300005327 Ga0070658_10130345 Ga0070658_101303452 227
46 3300005329 Ga0070683_100004410 Ga0070683_1000044105 227
47 3300005336 Ga0070680_100102190 Ga0070680_1001021902 227
48 3300005337 Ga0070682_100021462 Ga0070682_1000214625 227
49 3300005341 Ga0070691_10028952 Ga0070691_100289524 227
50 3300005344 Ga0070661_100017688 Ga0070661_1000176883 227
51 3300005366 Ga0070659_100293063 Ga0070659_1002930632 227
52 3300005535 Ga0070684_100147618 Ga0070684_1001476182 227
53 3300005539 Ga0068853_100035125 Ga0068853_1000351254 227
54 3300005564 Ga0070664_100014495 Ga0070664_1000144954 227
55 3300005578 Ga0068854_100002329 Ga0068854_1000023294 227
56 3300005616 Ga0068852_100245707 Ga0068852_1002457073 227
57 3300005834 Ga0068851_10034066 Ga0068851_100340662 227
58 3300009093 Ga0105240_10126571 Ga0105240_101265715 227
59 3300009545 Ga0105237_10056171 Ga0105237_100561712 227
60 3300013297 Ga0157378_10387971 Ga0157378_103879713 227
61 3300013307 Ga0157372_10008481 Ga0157372_1000848112 227
62 3300025904 Ga0207647_10007320 Ga0207647_100073206 227
63 3300025909 Ga0207705_10014792 Ga0207705_100147924 227
64 3300025913 Ga0207695_10008696 Ga0207695_100086964 227
65 3300025914 Ga0207671_10320936 Ga0207671_103209362 227
66 3300025917 Ga0207660_10040305 Ga0207660_100403054 227
67 3300025919 Ga0207657_10006672 Ga0207657_100066724 227
68 3300025920 Ga0207649_10010472 Ga0207649_100104724 227
69 3300025924 Ga0207694_10014383 Ga0207694_100143835 227
70 3300025932 Ga0207690_10009186 Ga0207690_100091865 227
71 3300025933 Ga0207706_10234872 Ga0207706_102348721 227
72 3300025945 Ga0207679_10128221 Ga0207679_101282214 227
73 3300025949 Ga0207667_10007585 Ga0207667_1000758511 227
74 3300025981 Ga0207640_10010452 Ga0207640_100104522 227
75 3300026041 Ga0207639_10006339 Ga0207639_100063396 227
76 3300026078 Ga0207702_10004609 Ga0207702_1000460914 227
77 3300026116 Ga0207674_10001687 Ga0207674_1000168713 227
78 3300026142 Ga0207698_10009108 Ga0207698_100091085 227
79 3300037312 Ga0395899_0167088 Ga0395899_0167088_34_783 227
80 3300037418 Ga0395900_0046474 Ga0395900_0046474_431_1180 227
81 3300006871 Ga0075434_100000249 Ga0075434_10000024919 228
82 3300009093 Ga0105240_10096990 Ga0105240_100969902 228
83 3300009148 Ga0105243_10051458 Ga0105243_100514582 228
84 3300009176 Ga0105242_10022015 Ga0105242_100220152 228
85 3300009177 Ga0105248_10095943 Ga0105248_100959432 228
86 3300009551 Ga0105238_10047590 Ga0105238_100475907 228
87 3300010375 Ga0105239_10031979 Ga0105239_100319794 228
88 3300011119 Ga0105246_10622320 Ga0105246_106223202 228
89 3300013100 Ga0157373_10066079 Ga0157373_100660795 228
90 3300013102 Ga0157371_10102969 Ga0157371_101029693 228
91 3300013104 Ga0157370_10688470 Ga0157370_106884701 228
92 3300013296 Ga0157374_10070953 Ga0157374_100709535 228
93 3300013296 Ga0157374_10173181 Ga0157374_101731812 228
94 3300013297 Ga0157378_10038607 Ga0157378_100386072 228
95 3300013306 Ga0163162_10053795 Ga0163162_100537952 228
96 3300013307 Ga0157372_10092526 Ga0157372_100925264 228
97 3300013307 Ga0157372_10891420 Ga0157372_108914201 228
98 3300013308 Ga0157375_10079159 Ga0157375_100791592 228
99 3300014325 Ga0163163_10017657 Ga0163163_100176575 228
100 3300014745 Ga0157377_10023993 Ga0157377_100239931 228
101 3300014968 Ga0157379_10017522 Ga0157379_100175222 228
102 3300014969 Ga0157376_10023310 Ga0157376_100233105 228
103 3300035112 Ga0373932_0049454 Ga0373932_0049454_391_1119 228
104 3300044694 Ga0466963_0097762 Ga0466963_0097762_19_750 228
105 3300048903 Ga0496100_0000774 Ga0496100_0000774_10491_11219 228
106 3300048904 Ga0496101_0000256 Ga0496101_0000256_3220_3948 228
107 3300048905 Ga0496102_0095370 Ga0496102_0095370_1131_1859 228
108 3300048906 Ga0496103_0006781 Ga0496103_0006781_1979_2707 228
109 3300048907 Ga0496104_0028310 Ga0496104_0028310_710_1438 228
110 3300048908 Ga0496105_0041939 Ga0496105_0041939_427_1155 228
111 3300048909 Ga0496106_0053723 Ga0496106_0053723_2080_2808 228
112 3300048910 Ga0496107_0001584 Ga0496107_0001584_11081_11809 228
113 3300048911 Ga0496108_0000673 Ga0496108_0000673_25258_25986 228
114 3300048912 Ga0496109_0022324 Ga0496109_0022324_498_1226 228
115 3300048913 Ga0496110_0001683 Ga0496110_0001683_3104_3832 228
116 3300048914 Ga0496111_0000420 Ga0496111_0000420_20026_20754 228
117 3300048915 Ga0496112_0061448 Ga0496112_0061448_1929_2657 228
118 3300048916 Ga0496113_0000242 Ga0496113_0000242_20616_21344 228
119 3300048917 Ga0496114_0170287 Ga0496114_0170287_524_1252 228
120 3300050512 nmdc:mga0n895_1016_c1 nmdc:mga0n895_1016_c1_3787_4533 228
121 3300050513 nmdc:mga0rr50_906_c2 nmdc:mga0rr50_906_c2_1496_2242 228
122 3300050514 nmdc:mga08x19_114437_c1 nmdc:mga08x19_114437_c1_54_800 228
123 3300005327 Ga0070658_10157115 Ga0070658_101571153 229
124 3300005435 Ga0070714_100187374 Ga0070714_1001873742 229
125 3300005466 Ga0070685_10088397 Ga0070685_100883973 229
126 3300005578 Ga0068854_100317673 Ga0068854_1003176732 229
127 3300030745 Ga0316182_1092649 Ga0316182_10926493 229
128 3300031731 Ga0307405_10099537 Ga0307405_100995372 229
129 3300031824 Ga0307413_10002633 Ga0307413_1000263310 229
130 3300031903 Ga0307407_10007325 Ga0307407_100073252 229
131 3300031995 Ga0307409_100004995 Ga0307409_10000499510 229
132 3300032002 Ga0307416_100086559 Ga0307416_1000865592 229
133 3300032004 Ga0307414_10024082 Ga0307414_100240822 229
134 3300032005 Ga0307411_10006005 Ga0307411_100060057 229
135 3300032126 Ga0307415_100000898 Ga0307415_10000089816 229
136 3300041451 Ga0451791_1947175 Ga0451791_1947175_1313_2077 229
137 3300041453 Ga0451797_1305776 Ga0451797_1305776_180_944 229
138 3300041486 Ga0451807_0169169 Ga0451807_0169169_125_889 229
139 3300041512 Ga0451853_3172401 Ga0451853_3172401_231_995 229
140 3300046472 Ga0495580_0365298 Ga0495580_0365298_110_871 229
141 3300046513 Ga0495616_0001887 Ga0495616_0001887_10247_11011 229
142 3300046537 Ga0495598_0007096 Ga0495598_0007096_257_994 229
143 3300046539 Ga0495621_0014562 Ga0495621_0014562_521_1258 229
144 3300046558 Ga0495633_0024554 Ga0495633_0024554_605_1342 229
145 3300046684 Ga0495669_0007001 Ga0495669_0007001_2744_3481 229
146 3300046691 Ga0495670_0026037 Ga0495670_0026037_2012_2749 229
147 3300053087 Ga0500643_000004 Ga0500643_000004_743893_744627 229
148 3300001990 JGI24737J22298_10013867 JGI24737J22298_100138672 230
149 3300005327 Ga0070658_10070206 Ga0070658_100702063 230
150 3300005327 Ga0070658_10089528 Ga0070658_100895282 230
151 3300005331 Ga0070670_100010428 Ga0070670_1000104288 230
152 3300005331 Ga0070670_100789609 Ga0070670_1007896091 230
153 3300005333 Ga0070677_10217798 Ga0070677_102177981 230
154 3300005335 Ga0070666_10014487 Ga0070666_100144875 230
155 3300005337 Ga0070682_100134859 Ga0070682_1001348593 230
156 3300005338 Ga0068868_100771039 Ga0068868_1007710391 230
157 3300005339 Ga0070660_100026526 Ga0070660_1000265265 230
158 3300005344 Ga0070661_100028711 Ga0070661_1000287112 230
159 3300005345 Ga0070692_10191333 Ga0070692_101913331 230
160 3300005345 Ga0070692_10197524 Ga0070692_101975242 230
161 3300005353 Ga0070669_100124771 Ga0070669_1001247711 230
162 3300005353 Ga0070669_100263121 Ga0070669_1002631212 230
163 3300005354 Ga0070675_100061581 Ga0070675_1000615815 230
164 3300005354 Ga0070675_100109026 Ga0070675_1001090262 230
165 3300005355 Ga0070671_100059547 Ga0070671_1000595472 230
166 3300005355 Ga0070671_100061989 Ga0070671_1000619895 230
167 3300005355 Ga0070671_100147609 Ga0070671_1001476092 230
168 3300005356 Ga0070674_100009008 Ga0070674_1000090084 230
169 3300005356 Ga0070674_100105223 Ga0070674_1001052232 230
170 3300005356 Ga0070674_100259599 Ga0070674_1002595992 230
171 3300005364 Ga0070673_100016122 Ga0070673_1000161228 230
172 3300005364 Ga0070673_100354990 Ga0070673_1003549902 230
173 3300005366 Ga0070659_100023365 Ga0070659_1000233657 230
174 3300005366 Ga0070659_100084394 Ga0070659_1000843941 230
175 3300005366 Ga0070659_100099415 Ga0070659_1000994152 230
176 3300005367 Ga0070667_100004843 Ga0070667_1000048439 230
177 3300005455 Ga0070663_100020724 Ga0070663_1000207242 230
178 3300005456 Ga0070678_100006559 Ga0070678_1000065599 230
179 3300005456 Ga0070678_100371378 Ga0070678_1003713782 230
180 3300005457 Ga0070662_100003219 Ga0070662_10000321910 230
181 3300005457 Ga0070662_100090724 Ga0070662_1000907244 230
182 3300005457 Ga0070662_100116066 Ga0070662_1001160662 230
183 3300005458 Ga0070681_10081440 Ga0070681_100814402 230
184 3300005459 Ga0068867_100094307 Ga0068867_1000943072 230
185 3300005530 Ga0070679_100365315 Ga0070679_1003653152 230
186 3300005543 Ga0070672_100012806 Ga0070672_1000128063 230
187 3300005547 Ga0070693_100056962 Ga0070693_1000569622 230
188 3300005564 Ga0070664_100260110 Ga0070664_1002601102 230
189 3300005577 Ga0068857_100055560 Ga0068857_1000555604 230
190 3300005577 Ga0068857_100150724 Ga0068857_1001507242 230
191 3300005578 Ga0068854_100012239 Ga0068854_1000122394 230
192 3300005578 Ga0068854_100131098 Ga0068854_1001310982 230
193 3300005618 Ga0068864_100020538 Ga0068864_1000205389 230
194 3300005841 Ga0068863_100026373 Ga0068863_1000263739 230
195 3300005842 Ga0068858_100027855 Ga0068858_1000278555 230
196 3300005842 Ga0068858_100191433 Ga0068858_1001914332 230
197 3300006237 Ga0097621_100013809 Ga0097621_1000138092 230
198 3300006237 Ga0097621_100362096 Ga0097621_1003620962 230
199 3300006358 Ga0068871_100073340 Ga0068871_1000733402 230
200 3300009093 Ga0105240_10122400 Ga0105240_101224003 230
201 3300009093 Ga0105240_10254026 Ga0105240_102540263 230
202 3300009174 Ga0105241_10399448 Ga0105241_103994482 230
203 3300009176 Ga0105242_10709164 Ga0105242_107091642 230
204 3300009177 Ga0105248_10447874 Ga0105248_104478742 230
205 3300009545 Ga0105237_10143831 Ga0105237_101438314 230
206 3300009551 Ga0105238_10195702 Ga0105238_101957023 230
207 3300013100 Ga0157373_10006944 Ga0157373_100069445 230
208 3300013100 Ga0157373_10042678 Ga0157373_100426782 230
209 3300013102 Ga0157371_10017317 Ga0157371_100173173 230
210 3300013102 Ga0157371_10080497 Ga0157371_100804972 230
211 3300013102 Ga0157371_10191993 Ga0157371_101919932 230
212 3300013104 Ga0157370_10161998 Ga0157370_101619983 230
213 3300013296 Ga0157374_10011026 Ga0157374_100110264 230
214 3300013306 Ga0163162_10008489 Ga0163162_1000848910 230
215 3300013308 Ga0157375_10009672 Ga0157375_100096726 230
216 3300014325 Ga0163163_10003869 Ga0163163_100038695 230
217 3300025315 Ga0207697_10051789 Ga0207697_100517891 230
218 3300025321 Ga0207656_10033202 Ga0207656_100332023 230
219 3300025893 Ga0207682_10171992 Ga0207682_101719921 230
220 3300025903 Ga0207680_10123373 Ga0207680_101233732 230
221 3300025904 Ga0207647_10023562 Ga0207647_100235621 230
222 3300025904 Ga0207647_10123794 Ga0207647_101237942 230
223 3300025904 Ga0207647_10175312 Ga0207647_101753122 230
224 3300025907 Ga0207645_10019263 Ga0207645_100192632 230
225 3300025907 Ga0207645_10186465 Ga0207645_101864652 230
226 3300025909 Ga0207705_10000030 Ga0207705_10000030194 230
227 3300025913 Ga0207695_10065597 Ga0207695_100655973 230
228 3300025919 Ga0207657_10120334 Ga0207657_101203342 230
229 3300025919 Ga0207657_10284744 Ga0207657_102847442 230
230 3300025920 Ga0207649_10001000 Ga0207649_1000100012 230
231 3300025920 Ga0207649_10275994 Ga0207649_102759942 230
232 3300025923 Ga0207681_10249655 Ga0207681_102496552 230
233 3300025924 Ga0207694_10267142 Ga0207694_102671422 230
234 3300025925 Ga0207650_10425561 Ga0207650_104255611 230
235 3300025926 Ga0207659_10562210 Ga0207659_105622102 230
236 3300025931 Ga0207644_10003259 Ga0207644_1000325913 230
237 3300025931 Ga0207644_10066054 Ga0207644_100660541 230
238 3300025931 Ga0207644_10468584 Ga0207644_104685842 230
239 3300025932 Ga0207690_10003400 Ga0207690_100034006 230
240 3300025933 Ga0207706_10000614 Ga0207706_100006145 230
241 3300025933 Ga0207706_10031954 Ga0207706_100319544 230
242 3300025933 Ga0207706_10044628 Ga0207706_100446284 230
243 3300025933 Ga0207706_10058768 Ga0207706_100587682 230
244 3300025937 Ga0207669_10005421 Ga0207669_100054215 230
245 3300025937 Ga0207669_10195538 Ga0207669_101955382 230
246 3300025940 Ga0207691_10008543 Ga0207691_100085435 230
247 3300025941 Ga0207711_10004361 Ga0207711_1000436112 230
248 3300025941 Ga0207711_10110682 Ga0207711_101106822 230
249 3300025945 Ga0207679_10208977 Ga0207679_102089773 230
250 3300025945 Ga0207679_10852542 Ga0207679_108525421 230
251 3300025949 Ga0207667_10056324 Ga0207667_100563242 230
252 3300025960 Ga0207651_10007284 Ga0207651_100072849 230
253 3300025981 Ga0207640_10005014 Ga0207640_100050146 230
254 3300025986 Ga0207658_10022779 Ga0207658_100227795 230
255 3300025986 Ga0207658_10558145 Ga0207658_105581451 230
256 3300026035 Ga0207703_10499086 Ga0207703_104990862 230
257 3300026067 Ga0207678_10007662 Ga0207678_1000766211 230
258 3300026067 Ga0207678_10016026 Ga0207678_100160264 230
259 3300026078 Ga0207702_10017653 Ga0207702_100176535 230
260 3300026088 Ga0207641_10104078 Ga0207641_101040782 230
261 3300026089 Ga0207648_10040779 Ga0207648_100407793 230
262 3300026116 Ga0207674_10049173 Ga0207674_100491736 230
263 3300026116 Ga0207674_10068656 Ga0207674_100686564 230
264 3300026121 Ga0207683_10000846 Ga0207683_1000084625 230
265 3300026121 Ga0207683_10440000 Ga0207683_104400002 230
266 3300026142 Ga0207698_10027136 Ga0207698_100271362 230
267 3300026142 Ga0207698_10276171 Ga0207698_102761713 230
268 3300028379 Ga0268266_10032066 Ga0268266_100320662 230
269 3300028786 Ga0307517_10046543 Ga0307517_100465433 230
270 3300031548 Ga0307408_100033445 Ga0307408_1000334452 230
271 3300031548 Ga0307408_100316316 Ga0307408_1003163162 230
272 3300031731 Ga0307405_10009331 Ga0307405_100093315 230
273 3300031731 Ga0307405_10017649 Ga0307405_100176492 230
274 3300031731 Ga0307405_10163476 Ga0307405_101634762 230
275 3300031852 Ga0307410_10008532 Ga0307410_100085322 230
276 3300031852 Ga0307410_10518455 Ga0307410_105184552 230
277 3300031901 Ga0307406_10005210 Ga0307406_100052103 230
278 3300031901 Ga0307406_10036445 Ga0307406_100364452 230
279 3300031903 Ga0307407_10069924 Ga0307407_100699242 230
280 3300031911 Ga0307412_10024284 Ga0307412_100242842 230
281 3300031911 Ga0307412_10150465 Ga0307412_101504652 230
282 3300031995 Ga0307409_100057300 Ga0307409_1000573002 230
283 3300032002 Ga0307416_100001470 Ga0307416_10000147012 230
284 3300032002 Ga0307416_100138581 Ga0307416_1001385812 230
285 3300032002 Ga0307416_100606253 Ga0307416_1006062532 230
286 3300032002 Ga0307416_100866184 Ga0307416_1008661841 230
287 3300032005 Ga0307411_10021236 Ga0307411_100212363 230
288 3300032126 Ga0307415_100204911 Ga0307415_1002049113 230
289 3300037312 Ga0395899_0105000 Ga0395899_0105000_366_1124 230
290 3300037312 Ga0395899_0179320 Ga0395899_0179320_343_1086 230
291 3300037418 Ga0395900_0039490 Ga0395900_0039490_2442_3185 230
292 3300037418 Ga0395900_0044753 Ga0395900_0044753_2522_3280 230
293 3300037418 Ga0395900_0057224 Ga0395900_0057224_3130_3861 230
294 3300037418 Ga0395900_0076977 Ga0395900_0076977_973_1716 230
295 3300037418 Ga0395900_0088680 Ga0395900_0088680_1988_2731 230
296 3300037418 Ga0395900_0114450 Ga0395900_0114450_529_1260 230
297 3300037418 Ga0395900_0255616 Ga0395900_0255616_47_790 230
298 3300037418 Ga0395900_0466753 Ga0395900_0466753_413_1156 230
299 3300037418 Ga0395900_0741115 Ga0395900_0741115_66_809 230
300 3300037466 Ga0395898_0235509 Ga0395898_0235509_450_1199 230
301 3300037471 Ga0395905_0005143 Ga0395905_0005143_10952_11695 230
302 3300037471 Ga0395905_0005435 Ga0395905_0005435_2182_2940 230
303 3300037471 Ga0395905_0016861 Ga0395905_0016861_442_1173 230
304 3300037471 Ga0395905_0048262 Ga0395905_0048262_314_1063 230
305 3300037471 Ga0395905_0594126 Ga0395905_0594126_80_835 230
306 3300038443 Ga0395901_0019225 Ga0395901_0019225_2905_3636 230
307 3300038443 Ga0395901_0036450 Ga0395901_0036450_1365_2123 230
308 3300038443 Ga0395901_0063228 Ga0395901_0063228_2045_2788 230
309 3300038443 Ga0395901_0083516 Ga0395901_0083516_2403_3146 230
310 3300042004 Ga0439445_0000271 Ga0439445_0000271_5199_5942 230
311 3300044694 Ga0466963_0097060 Ga0466963_0097060_1250_1981 230
312 3300044694 Ga0466963_0171420 Ga0466963_0171420_331_1086 230
313 3300044842 Ga0466957_0139358 Ga0466957_0139358_125_880 230
314 3300044842 Ga0466957_0310496 Ga0466957_0310496_131_862 230
315 3300045049 Ga0466959_0169896 Ga0466959_0169896_232_963 230
316 3300045836 Ga0466958_0240217 Ga0466958_0240217_155_886 230
317 3300046525 Ga0495663_0049186 Ga0495663_0049186_243_995 230
318 3300046684 Ga0495669_0025351 Ga0495669_0025351_1524_2267 230
319 3300046684 Ga0495669_0029398 Ga0495669_0029398_392_1144 230
320 3300048911 Ga0496108_0004508 Ga0496108_0004508_1388_2161 230
321 3300048912 Ga0496109_0005202 Ga0496109_0005202_6895_7668 230
322 3300048913 Ga0496110_0026844 Ga0496110_0026844_2772_3545 230
323 3300048915 Ga0496112_0349300 Ga0496112_0349300_507_1280 230
324 3300027876 Ga0209974_10035446 Ga0209974_100354462 231
325 3300001989 JGI24739J22299_10031542 JGI24739J22299_100315422 232
326 3300005293 Ga0065715_10361050 Ga0065715_103610502 232
327 3300005327 Ga0070658_10231805 Ga0070658_102318052 232
328 3300005327 Ga0070658_10495075 Ga0070658_104950751 232
329 3300005336 Ga0070680_100088510 Ga0070680_1000885102 232
330 3300005339 Ga0070660_100026442 Ga0070660_1000264424 232
331 3300005339 Ga0070660_100051584 Ga0070660_1000515842 232
332 3300005364 Ga0070673_100127015 Ga0070673_1001270152 232
333 3300005366 Ga0070659_100030921 Ga0070659_1000309215 232
334 3300005366 Ga0070659_100103667 Ga0070659_1001036673 232
335 3300005366 Ga0070659_100674401 Ga0070659_1006744011 232
336 3300005367 Ga0070667_100053782 Ga0070667_1000537824 232
337 3300005455 Ga0070663_100068894 Ga0070663_1000688942 232
338 3300005458 Ga0070681_10434345 Ga0070681_104343452 232
339 3300005530 Ga0070679_100317833 Ga0070679_1003178332 232
340 3300005535 Ga0070684_100013261 Ga0070684_1000132613 232
341 3300005563 Ga0068855_100659876 Ga0068855_1006598762 232
342 3300005564 Ga0070664_100217941 Ga0070664_1002179412 232
343 3300005616 Ga0068852_100249983 Ga0068852_1002499834 232
344 3300013102 Ga0157371_10009986 Ga0157371_100099865 232
345 3300013102 Ga0157371_10056390 Ga0157371_100563902 232
346 3300025904 Ga0207647_10173446 Ga0207647_101734462 232
347 3300025919 Ga0207657_10031434 Ga0207657_100314344 232
348 3300025919 Ga0207657_10032552 Ga0207657_100325524 232
349 3300025921 Ga0207652_10091999 Ga0207652_100919992 232
350 3300025926 Ga0207659_10011691 Ga0207659_100116912 232
351 3300025929 Ga0207664_10129522 Ga0207664_101295222 232
352 3300025932 Ga0207690_10197901 Ga0207690_101979013 232
353 3300025932 Ga0207690_10358681 Ga0207690_103586812 232
354 3300025933 Ga0207706_10017400 Ga0207706_100174005 232
355 3300025933 Ga0207706_10059934 Ga0207706_100599343 232
356 3300025945 Ga0207679_10106066 Ga0207679_101060662 232
357 3300025960 Ga0207651_10020708 Ga0207651_100207082 232
358 3300025960 Ga0207651_10043587 Ga0207651_100435874 232
359 3300026067 Ga0207678_10011032 Ga0207678_100110327 232
360 3300031852 Ga0307410_10335885 Ga0307410_103358852 232
361 3300032002 Ga0307416_100218924 Ga0307416_1002189242 232
362 3300032002 Ga0307416_100558895 Ga0307416_1005588952 232
363 3300037418 Ga0395900_0054284 Ga0395900_0054284_2105_2848 232
364 3300037466 Ga0395898_0138450 Ga0395898_0138450_1566_2309 232
365 3300037471 Ga0395905_0028576 Ga0395905_0028576_2577_3320 232
366 3300038443 Ga0395901_0000516 Ga0395901_0000516_41124_41867 232
367 3300001915 JGI24741J21665_1005952 JGI24741J21665_10059524 233
368 3300001979 JGI24740J21852_10010639 JGI24740J21852_100106392 233
369 3300001989 JGI24739J22299_10028206 JGI24739J22299_100282062 233
370 3300001990 JGI24737J22298_10026699 JGI24737J22298_100266994 233
371 3300002067 JGI24735J21928_10021837 JGI24735J21928_100218372 233
372 3300005329 Ga0070683_100024152 Ga0070683_1000241527 233
373 3300005337 Ga0070682_100074382 Ga0070682_1000743821 233
374 3300005345 Ga0070692_10076955 Ga0070692_100769554 233
375 3300005345 Ga0070692_10151236 Ga0070692_101512361 233
376 3300005457 Ga0070662_100038748 Ga0070662_1000387486 233
377 3300005530 Ga0070679_100342349 Ga0070679_1003423491 233
378 3300005535 Ga0070684_100220175 Ga0070684_1002201751 233
379 3300005539 Ga0068853_100364729 Ga0068853_1003647291 233
380 3300005563 Ga0068855_100104982 Ga0068855_1001049822 233
381 3300005564 Ga0070664_100157203 Ga0070664_1001572034 233
382 3300005577 Ga0068857_100237125 Ga0068857_1002371252 233
383 3300005578 Ga0068854_100464349 Ga0068854_1004643491 233
384 3300005834 Ga0068851_10164608 Ga0068851_101646082 233
385 3300013102 Ga0157371_10069129 Ga0157371_100691292 233
386 3300013307 Ga0157372_10162635 Ga0157372_101626353 233
387 3300025904 Ga0207647_10091309 Ga0207647_100913092 233
388 3300025909 Ga0207705_10103080 Ga0207705_101030802 233
389 3300025912 Ga0207707_10189917 Ga0207707_101899172 233
390 3300025917 Ga0207660_10069032 Ga0207660_100690323 233
391 3300025919 Ga0207657_10100863 Ga0207657_101008632 233
392 3300025920 Ga0207649_10134267 Ga0207649_101342672 233
393 3300025921 Ga0207652_10079314 Ga0207652_100793145 233
394 3300025932 Ga0207690_10018027 Ga0207690_100180272 233
395 3300025933 Ga0207706_10012750 Ga0207706_100127504 233
396 3300025944 Ga0207661_10488674 Ga0207661_104886742 233
397 3300025945 Ga0207679_10108555 Ga0207679_101085555 233
398 3300025949 Ga0207667_10253451 Ga0207667_102534514 233
399 3300026067 Ga0207678_10012837 Ga0207678_100128375 233
400 3300026116 Ga0207674_10031516 Ga0207674_100315163 233
401 3300001904 JGI24736J21556_1027078 JGI24736J21556_10270781 234
402 3300001990 JGI24737J22298_10077473 JGI24737J22298_100774731 234
403 3300002067 JGI24735J21928_10069807 JGI24735J21928_100698071 234
404 3300002077 JGI24744J21845_10000550 JGI24744J21845_100005503 234
405 3300005327 Ga0070658_10010002 Ga0070658_100100024 234
406 3300005327 Ga0070658_10012293 Ga0070658_100122935 234
407 3300005327 Ga0070658_10080963 Ga0070658_100809634 234
408 3300005327 Ga0070658_10245839 Ga0070658_102458392 234
409 3300005329 Ga0070683_100125212 Ga0070683_1001252121 234
410 3300005329 Ga0070683_100174155 Ga0070683_1001741551 234
411 3300005330 Ga0070690_100004711 Ga0070690_1000047115 234
412 3300005330 Ga0070690_100014947 Ga0070690_1000149473 234
413 3300005331 Ga0070670_100090737 Ga0070670_1000907373 234
414 3300005334 Ga0068869_100064347 Ga0068869_1000643475 234
415 3300005334 Ga0068869_100156979 Ga0068869_1001569794 234
416 3300005335 Ga0070666_10000753 Ga0070666_1000075315 234
417 3300005335 Ga0070666_10015349 Ga0070666_100153496 234
418 3300005336 Ga0070680_100000683 Ga0070680_10000068325 234
419 3300005336 Ga0070680_100002724 Ga0070680_1000027247 234
420 3300005336 Ga0070680_100030548 Ga0070680_1000305482 234
421 3300005338 Ga0068868_100015820 Ga0068868_10001582010 234
422 3300005338 Ga0068868_100025829 Ga0068868_1000258295 234
423 3300005338 Ga0068868_100076475 Ga0068868_1000764753 234
424 3300005338 Ga0068868_100172603 Ga0068868_1001726031 234
425 3300005339 Ga0070660_100017677 Ga0070660_1000176772 234
426 3300005339 Ga0070660_100121414 Ga0070660_1001214141 234
427 3300005339 Ga0070660_100123766 Ga0070660_1001237664 234
428 3300005339 Ga0070660_100200870 Ga0070660_1002008702 234
429 3300005344 Ga0070661_100136456 Ga0070661_1001364564 234
430 3300005344 Ga0070661_100326998 Ga0070661_1003269982 234
431 3300005345 Ga0070692_10007183 Ga0070692_100071837 234
432 3300005347 Ga0070668_100253873 Ga0070668_1002538733 234
433 3300005354 Ga0070675_100186770 Ga0070675_1001867701 234
434 3300005355 Ga0070671_100005658 Ga0070671_1000056585 234
435 3300005355 Ga0070671_100008324 Ga0070671_1000083244 234
436 3300005355 Ga0070671_100028479 Ga0070671_1000284794 234
437 3300005355 Ga0070671_100075750 Ga0070671_1000757505 234
438 3300005356 Ga0070674_100016218 Ga0070674_1000162183 234
439 3300005364 Ga0070673_100013891 Ga0070673_1000138912 234
440 3300005364 Ga0070673_100023632 Ga0070673_1000236322 234
441 3300005364 Ga0070673_100052110 Ga0070673_1000521102 234
442 3300005364 Ga0070673_100129701 Ga0070673_1001297013 234
443 3300005366 Ga0070659_100002531 Ga0070659_1000025316 234
444 3300005366 Ga0070659_100032659 Ga0070659_1000326592 234
445 3300005366 Ga0070659_100139330 Ga0070659_1001393301 234
446 3300005366 Ga0070659_100153824 Ga0070659_1001538241 234
447 3300005366 Ga0070659_100212652 Ga0070659_1002126522 234
448 3300005366 Ga0070659_100242839 Ga0070659_1002428392 234
449 3300005367 Ga0070667_100010621 Ga0070667_1000106216 234
450 3300005367 Ga0070667_100157027 Ga0070667_1001570272 234
451 3300005435 Ga0070714_100103378 Ga0070714_1001033783 234
452 3300005435 Ga0070714_100111177 Ga0070714_1001111773 234
453 3300005435 Ga0070714_100158992 Ga0070714_1001589921 234
454 3300005436 Ga0070713_100416355 Ga0070713_1004163551 234
455 3300005455 Ga0070663_100024430 Ga0070663_1000244304 234
456 3300005455 Ga0070663_100047615 Ga0070663_1000476152 234
457 3300005455 Ga0070663_100082758 Ga0070663_1000827583 234
458 3300005455 Ga0070663_100130835 Ga0070663_1001308352 234
459 3300005456 Ga0070678_100008022 Ga0070678_1000080222 234
460 3300005456 Ga0070678_100320353 Ga0070678_1003203531 234
461 3300005457 Ga0070662_100041402 Ga0070662_1000414022 234
462 3300005458 Ga0070681_10145066 Ga0070681_101450662 234
463 3300005458 Ga0070681_10510786 Ga0070681_105107861 234
464 3300005459 Ga0068867_100007760 Ga0068867_1000077605 234
465 3300005459 Ga0068867_100024893 Ga0068867_1000248935 234
466 3300005459 Ga0068867_100047780 Ga0068867_1000477802 234
467 3300005466 Ga0070685_10014719 Ga0070685_100147196 234
468 3300005530 Ga0070679_100337957 Ga0070679_1003379572 234
469 3300005535 Ga0070684_100115223 Ga0070684_1001152235 234
470 3300005539 Ga0068853_100111764 Ga0068853_1001117641 234
471 3300005539 Ga0068853_100182981 Ga0068853_1001829811 234
472 3300005543 Ga0070672_100003732 Ga0070672_1000037326 234
473 3300005543 Ga0070672_100268806 Ga0070672_1002688062 234
474 3300005544 Ga0070686_100082749 Ga0070686_1000827494 234
475 3300005548 Ga0070665_100045702 Ga0070665_1000457024 234
476 3300005548 Ga0070665_100430022 Ga0070665_1004300222 234
477 3300005563 Ga0068855_100044189 Ga0068855_1000441892 234
478 3300005563 Ga0068855_100321669 Ga0068855_1003216692 234
479 3300005563 Ga0068855_100371987 Ga0068855_1003719872 234
480 3300005564 Ga0070664_100026954 Ga0070664_1000269548 234
481 3300005564 Ga0070664_100123868 Ga0070664_1001238682 234
482 3300005564 Ga0070664_100179137 Ga0070664_1001791373 234
483 3300005564 Ga0070664_100368008 Ga0070664_1003680082 234
484 3300005577 Ga0068857_100166876 Ga0068857_1001668762 234
485 3300005578 Ga0068854_100017667 Ga0068854_1000176677 234
486 3300005578 Ga0068854_100058080 Ga0068854_1000580805 234
487 3300005578 Ga0068854_100153295 Ga0068854_1001532952 234
488 3300005578 Ga0068854_100212652 Ga0068854_1002126523 234
489 3300005614 Ga0068856_100037313 Ga0068856_1000373135 234
490 3300005614 Ga0068856_100039087 Ga0068856_1000390872 234
491 3300005614 Ga0068856_100047342 Ga0068856_1000473422 234
492 3300005614 Ga0068856_100110001 Ga0068856_1001100014 234
493 3300005614 Ga0068856_100133321 Ga0068856_1001333212 234
494 3300005616 Ga0068852_100000992 Ga0068852_10000099217 234
495 3300005616 Ga0068852_100014616 Ga0068852_1000146162 234
496 3300005616 Ga0068852_100017959 Ga0068852_1000179594 234
497 3300005616 Ga0068852_100044650 Ga0068852_1000446506 234
498 3300005616 Ga0068852_100048730 Ga0068852_1000487306 234
499 3300005616 Ga0068852_100279994 Ga0068852_1002799942 234
500 3300005618 Ga0068864_100038673 Ga0068864_1000386732 234
501 3300005718 Ga0068866_10032261 Ga0068866_100322612 234
502 3300005718 Ga0068866_10043558 Ga0068866_100435582 234
503 3300005841 Ga0068863_100037237 Ga0068863_1000372372 234
504 3300005842 Ga0068858_100018345 Ga0068858_1000183455 234
505 3300005842 Ga0068858_100178836 Ga0068858_1001788362 234
506 3300005843 Ga0068860_100081612 Ga0068860_1000816122 234
507 3300006237 Ga0097621_100030354 Ga0097621_1000303542 234
508 3300006237 Ga0097621_100770025 Ga0097621_1007700251 234
509 3300006358 Ga0068871_100019859 Ga0068871_1000198592 234
510 3300006881 Ga0068865_100067256 Ga0068865_1000672562 234
511 3300009093 Ga0105240_10079294 Ga0105240_100792943 234
512 3300009098 Ga0105245_10013595 Ga0105245_100135955 234
513 3300009098 Ga0105245_10044859 Ga0105245_100448592 234
514 3300009098 Ga0105245_10254925 Ga0105245_102549252 234
515 3300009098 Ga0105245_10501425 Ga0105245_105014252 234
516 3300009174 Ga0105241_10070244 Ga0105241_100702442 234
517 3300009174 Ga0105241_10226945 Ga0105241_102269452 234
518 3300009177 Ga0105248_10025655 Ga0105248_100256554 234
519 3300009177 Ga0105248_10051957 Ga0105248_100519575 234
520 3300009177 Ga0105248_10322128 Ga0105248_103221282 234
521 3300009551 Ga0105238_10043379 Ga0105238_100433795 234
522 3300009551 Ga0105238_10047987 Ga0105238_100479875 234
523 3300011119 Ga0105246_10168820 Ga0105246_101688204 234
524 3300013100 Ga0157373_10016085 Ga0157373_100160856 234
525 3300013100 Ga0157373_10073636 Ga0157373_100736362 234
526 3300013100 Ga0157373_10180324 Ga0157373_101803241 234
527 3300013100 Ga0157373_10273457 Ga0157373_102734573 234
528 3300013102 Ga0157371_10127075 Ga0157371_101270752 234
529 3300013102 Ga0157371_10257272 Ga0157371_102572722 234
530 3300013102 Ga0157371_10311490 Ga0157371_103114901 234
531 3300013104 Ga0157370_10122831 Ga0157370_101228312 234
532 3300013104 Ga0157370_10148397 Ga0157370_101483974 234
533 3300013104 Ga0157370_10158100 Ga0157370_101581005 234
534 3300013105 Ga0157369_10062548 Ga0157369_100625484 234
535 3300013105 Ga0157369_10221541 Ga0157369_102215414 234
536 3300013105 Ga0157369_10240855 Ga0157369_102408552 234
537 3300013296 Ga0157374_10051583 Ga0157374_100515832 234
538 3300013297 Ga0157378_10069268 Ga0157378_100692682 234
539 3300013306 Ga0163162_10481227 Ga0163162_104812272 234
540 3300013307 Ga0157372_10129321 Ga0157372_101293216 234
541 3300013307 Ga0157372_10194622 Ga0157372_101946223 234
542 3300013307 Ga0157372_10609867 Ga0157372_106098672 234
543 3300013308 Ga0157375_10125442 Ga0157375_101254422 234
544 3300013308 Ga0157375_10722023 Ga0157375_107220232 234
545 3300014745 Ga0157377_10097190 Ga0157377_100971902 234
546 3300014969 Ga0157376_10145098 Ga0157376_101450983 234
547 3300020082 Ga0206353_10060407 Ga0206353_100604072 234
548 3300020082 Ga0206353_10496975 Ga0206353_104969753 234
549 3300025315 Ga0207697_10012116 Ga0207697_100121163 234
550 3300025315 Ga0207697_10079698 Ga0207697_100796981 234
551 3300025321 Ga0207656_10008586 Ga0207656_100085862 234
552 3300025893 Ga0207682_10064759 Ga0207682_100647592 234
553 3300025901 Ga0207688_10116128 Ga0207688_101161283 234
554 3300025903 Ga0207680_10002819 Ga0207680_100028192 234
555 3300025904 Ga0207647_10032914 Ga0207647_100329142 234
556 3300025904 Ga0207647_10039292 Ga0207647_100392922 234
557 3300025904 Ga0207647_10062277 Ga0207647_100622771 234
558 3300025907 Ga0207645_10048966 Ga0207645_100489664 234
559 3300025908 Ga0207643_10227947 Ga0207643_102279472 234
560 3300025909 Ga0207705_10053709 Ga0207705_100537092 234
561 3300025909 Ga0207705_10071502 Ga0207705_100715022 234
562 3300025909 Ga0207705_10184883 Ga0207705_101848833 234
563 3300025912 Ga0207707_10164391 Ga0207707_101643912 234
564 3300025917 Ga0207660_10000438 Ga0207660_1000043818 234
565 3300025917 Ga0207660_10000522 Ga0207660_1000052225 234
566 3300025917 Ga0207660_10055818 Ga0207660_100558185 234
567 3300025919 Ga0207657_10011457 Ga0207657_1001145711 234
568 3300025919 Ga0207657_10014835 Ga0207657_100148357 234
569 3300025919 Ga0207657_10020788 Ga0207657_100207887 234
570 3300025919 Ga0207657_10023453 Ga0207657_100234535 234
571 3300025919 Ga0207657_10234284 Ga0207657_102342842 234
572 3300025919 Ga0207657_10454192 Ga0207657_104541922 234
573 3300025920 Ga0207649_10014726 Ga0207649_100147264 234
574 3300025921 Ga0207652_10037733 Ga0207652_100377332 234
575 3300025921 Ga0207652_10172448 Ga0207652_101724484 234
576 3300025921 Ga0207652_10211101 Ga0207652_102111012 234
577 3300025924 Ga0207694_10052961 Ga0207694_100529612 234
578 3300025924 Ga0207694_10469002 Ga0207694_104690022 234
579 3300025925 Ga0207650_10410401 Ga0207650_104104012 234
580 3300025926 Ga0207659_10100135 Ga0207659_101001352 234
581 3300025927 Ga0207687_10024032 Ga0207687_100240325 234
582 3300025927 Ga0207687_10367602 Ga0207687_103676022 234
583 3300025929 Ga0207664_10139560 Ga0207664_101395601 234
584 3300025931 Ga0207644_10000243 Ga0207644_1000024335 234
585 3300025931 Ga0207644_10004423 Ga0207644_100044232 234
586 3300025931 Ga0207644_10160076 Ga0207644_101600762 234
587 3300025931 Ga0207644_10186645 Ga0207644_101866453 234
588 3300025932 Ga0207690_10005651 Ga0207690_100056515 234
589 3300025932 Ga0207690_10114978 Ga0207690_101149784 234
590 3300025932 Ga0207690_10133972 Ga0207690_101339722 234
591 3300025932 Ga0207690_10189646 Ga0207690_101896463 234
592 3300025933 Ga0207706_10029145 Ga0207706_100291455 234
593 3300025934 Ga0207686_10096963 Ga0207686_100969632 234
594 3300025937 Ga0207669_10016552 Ga0207669_100165523 234
595 3300025938 Ga0207704_10022279 Ga0207704_100222795 234
596 3300025938 Ga0207704_10167204 Ga0207704_101672043 234
597 3300025940 Ga0207691_10026627 Ga0207691_100266272 234
598 3300025940 Ga0207691_10277372 Ga0207691_102773722 234
599 3300025941 Ga0207711_10001208 Ga0207711_100012088 234
600 3300025941 Ga0207711_10039055 Ga0207711_100390552 234
601 3300025941 Ga0207711_10218744 Ga0207711_102187442 234
602 3300025942 Ga0207689_10019180 Ga0207689_100191804 234
603 3300025942 Ga0207689_10417576 Ga0207689_104175762 234
604 3300025942 Ga0207689_10547702 Ga0207689_105477022 234
605 3300025944 Ga0207661_10213608 Ga0207661_102136082 234
606 3300025945 Ga0207679_10069214 Ga0207679_100692142 234
607 3300025945 Ga0207679_10233828 Ga0207679_102338282 234
608 3300025949 Ga0207667_10167647 Ga0207667_101676472 234
609 3300025949 Ga0207667_10239442 Ga0207667_102394422 234
610 3300025960 Ga0207651_10004605 Ga0207651_100046052 234
611 3300025960 Ga0207651_10018623 Ga0207651_100186232 234
612 3300025960 Ga0207651_10221539 Ga0207651_102215393 234
613 3300025981 Ga0207640_10043563 Ga0207640_100435632 234
614 3300025981 Ga0207640_10059719 Ga0207640_100597193 234
615 3300025981 Ga0207640_10178042 Ga0207640_101780423 234
616 3300025986 Ga0207658_10002850 Ga0207658_1000285011 234
617 3300025986 Ga0207658_10008745 Ga0207658_100087455 234
618 3300026023 Ga0207677_10000529 Ga0207677_100005295 234
619 3300026023 Ga0207677_10011520 Ga0207677_100115208 234
620 3300026023 Ga0207677_10109180 Ga0207677_101091804 234
621 3300026035 Ga0207703_10003391 Ga0207703_100033915 234
622 3300026035 Ga0207703_10012417 Ga0207703_100124175 234
623 3300026041 Ga0207639_10110332 Ga0207639_101103324 234
624 3300026041 Ga0207639_10187095 Ga0207639_101870952 234
625 3300026041 Ga0207639_10283602 Ga0207639_102836022 234
626 3300026067 Ga0207678_10031229 Ga0207678_100312295 234
627 3300026067 Ga0207678_10042935 Ga0207678_100429355 234
628 3300026067 Ga0207678_10101379 Ga0207678_101013793 234
629 3300026078 Ga0207702_10030325 Ga0207702_100303252 234
630 3300026078 Ga0207702_10104553 Ga0207702_101045532 234
631 3300026078 Ga0207702_10322584 Ga0207702_103225842 234
632 3300026078 Ga0207702_10392627 Ga0207702_103926272 234
633 3300026088 Ga0207641_10027657 Ga0207641_100276572 234
634 3300026089 Ga0207648_10011459 Ga0207648_100114596 234
635 3300026089 Ga0207648_10015863 Ga0207648_100158639 234
636 3300026089 Ga0207648_10035351 Ga0207648_100353515 234
637 3300026095 Ga0207676_10045412 Ga0207676_100454125 234
638 3300026116 Ga0207674_10025523 Ga0207674_100255232 234
639 3300026116 Ga0207674_10647790 Ga0207674_106477902 234
640 3300026121 Ga0207683_10003293 Ga0207683_100032938 234
641 3300026121 Ga0207683_10004238 Ga0207683_100042387 234
642 3300026121 Ga0207683_10013463 Ga0207683_100134633 234
643 3300026142 Ga0207698_10000739 Ga0207698_100007396 234
644 3300026142 Ga0207698_10042442 Ga0207698_100424422 234
645 3300026142 Ga0207698_10049263 Ga0207698_100492636 234
646 3300026142 Ga0207698_10326628 Ga0207698_103266282 234
647 3300028379 Ga0268266_10357130 Ga0268266_103571302 234
648 3300028381 Ga0268264_10070538 Ga0268264_100705385 234
649 3300035691 Ga0373931_0339761 Ga0373931_0339761_36_782 234
650 3300037312 Ga0395899_0007795 Ga0395899_0007795_513_1259 234
651 3300037312 Ga0395899_0068769 Ga0395899_0068769_437_1183 234
652 3300037312 Ga0395899_0246502 Ga0395899_0246502_172_921 234
653 3300037418 Ga0395900_0046853 Ga0395900_0046853_2144_2890 234
654 3300037418 Ga0395900_0205261 Ga0395900_0205261_82_831 234
655 3300037418 Ga0395900_0218827 Ga0395900_0218827_926_1672 234
656 3300037418 Ga0395900_0336332 Ga0395900_0336332_124_870 234
657 3300037418 Ga0395900_0413624 Ga0395900_0413624_41_787 234
658 3300037418 Ga0395900_0640887 Ga0395900_0640887_179_928 234
659 3300037466 Ga0395898_0037311 Ga0395898_0037311_1423_2169 234
660 3300037466 Ga0395898_0152257 Ga0395898_0152257_753_1499 234
661 3300037466 Ga0395898_0264936 Ga0395898_0264936_352_1098 234
662 3300037471 Ga0395905_0000226 Ga0395905_0000226_48361_49098 234
663 3300037471 Ga0395905_0043361 Ga0395905_0043361_2780_3526 234
664 3300037471 Ga0395905_0096105 Ga0395905_0096105_437_1183 234
665 3300037471 Ga0395905_0132699 Ga0395905_0132699_798_1544 234
666 3300037471 Ga0395905_0188134 Ga0395905_0188134_32_778 234
667 3300037471 Ga0395905_0404044 Ga0395905_0404044_303_1049 234
668 3300037471 Ga0395905_0449963 Ga0395905_0449963_247_996 234
669 3300037471 Ga0395905_0684623 Ga0395905_0684623_45_794 234
670 3300038443 Ga0395901_0131118 Ga0395901_0131118_73_819 234
671 3300044694 Ga0466963_0001244 Ga0466963_0001244_1944_2687 234
672 3300044694 Ga0466963_0031748 Ga0466963_0031748_1543_2289 234
673 3300044694 Ga0466963_0056198 Ga0466963_0056198_882_1697 234
674 3300044842 Ga0466957_0027232 Ga0466957_0027232_2257_3006 234
675 3300044842 Ga0466957_0273344 Ga0466957_0273344_66_812 234
676 3300045836 Ga0466958_0025271 Ga0466958_0025271_578_1393 234
677 3300045836 Ga0466958_0157946 Ga0466958_0157946_103_852 234
678 3300045976 Ga0466967_0003821 Ga0466967_0003821_5944_6690 234
679 3300045976 Ga0466967_0014645 Ga0466967_0014645_2229_2978 234
680 3300045976 Ga0466967_0092625 Ga0466967_0092625_94_840 234
681 3300045976 Ga0466967_0094828 Ga0466967_0094828_725_1471 234
682 3300045976 Ga0466967_0102570 Ga0466967_0102570_727_1476 234
683 3300045976 Ga0466967_0157795 Ga0466967_0157795_1133_1879 234
684 3300046691 Ga0495670_0047286 Ga0495670_0047286_624_1370 234
685 3300048906 Ga0496103_0175434 Ga0496103_0175434_172_918 234
686 3300048909 Ga0496106_0076790 Ga0496106_0076790_291_1037 234
687 3300048914 Ga0496111_0034917 Ga0496111_0034917_386_1132 234
688 3300048915 Ga0496112_0417348 Ga0496112_0417348_380_1126 234
689 3300048917 Ga0496114_0000016 Ga0496114_0000016_208751_209497 234
690 3300049584 Ga0501068_0149480 Ga0501068_0149480_661_1398 234
691 3300049586 Ga0501070_0105959 Ga0501070_0105959_1262_2032 234
692 3300049590 Ga0501074_0186257 Ga0501074_0186257_157_900 234
693 3300061719 Ga0466962_0164313 Ga0466962_0164313_236_1051 234

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.3863 47 231
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.3673 48 225
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.367 47 231
4das-assembly1.cif.gz_H crystal structure of bullfrog m ferritin 0.3389 33 149
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3299 3 230
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8891 49 231 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.841 49 231 1.20.120.1630
af_Q6MG14_62_250_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7468 50 214 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7415 51 201 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6707 51 201 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A3D4GWQ9-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9613 156 231 GO:0016020
AF-A0A7V4P7Q0-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9382 3 232 GO:0008168
GO:0016020
GO:0032259
AF-A0A838QU31-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9341 1 234 GO:0008168
GO:0016020
GO:0032259
AF-A0A838QU31-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9303 1 234 GO:0008168
GO:0016020
GO:0032259
AF-A0A7W6PUJ7-F1-model_v4 Methanethiol S-methyltransferase 0.9302 49 231 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.75 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map