F475662

General Info

Members Datasets Scaffolds Average Seq Length
693 335 1386 138

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0323306|Ga0373943_0323306_180_653
Length 157
Sequence MSESTVAASTSANLQRDAAPPPPQVWPTLRARDAHALIRFLVDAFGFEETAVYADGDRVHHAELAWPLGGGIMLGSAPPADSSAPDAWPVPPGSGSCYVVTDDPDALCTRARRAGAEITTELHDTDYGSRDFAIRDPEGNRWSFGTYRGEPRRTSKT

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
101 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
102 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
127 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
323 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
324 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
325 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
326 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
327 2867369537 Streptomyces sp. Z26 Isolate Unclassified
328 2867475112 Streptomyces sp. TM32 Isolate Unclassified
329 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
330 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
331 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
332 2891562705 Microbispora tritici MT50 Isolate Unclassified
333 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
334 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
335 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 1.44
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 7.07
Rhizosphere 87.45
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0323306 3300035170 Unclassified 880
2 JGI24737J22298_10013186 3300001990 Bacteria 2692
3 JGI24743J22301_10082387 3300001991 Bacteria 680
4 JGI24738J21930_10010532 3300002075 Bacteria 2056
5 JGI25160J50197_1009200 3300003354 Bacteria 3686
6 JGI25160J50197_1013876 3300003354 Bacteria 2724
7 JGI25407J50210_10048991 3300003373 Bacteria 1072
8 Ga0070658_10134161 3300005327 Bacteria 2065
9 Ga0070658_10228399 3300005327 Bacteria 1575
10 Ga0070683_100038220 3300005329 Bacteria 4398
11 Ga0070683_100146167 3300005329 Bacteria 2240
12 Ga0070683_101664782 3300005329 Bacteria 613
13 Ga0070690_100031667 3300005330 Bacteria 3296
14 Ga0070670_101280800 3300005331 Bacteria 671
15 Ga0068869_100127423 3300005334 Bacteria 1953
16 Ga0068869_100251373 3300005334 Bacteria 1412
17 Ga0068869_100615289 3300005334 Bacteria 919
18 Ga0070680_100101485 3300005336 Bacteria 2388
19 Ga0070680_100213671 3300005336 Bacteria 1627
20 Ga0070682_100034013 3300005337 Bacteria 3100
21 Ga0070682_100855330 3300005337 Bacteria 743
22 Ga0068868_100082690 3300005338 Bacteria 2576
23 Ga0068868_100188341 3300005338 Bacteria 1715
24 Ga0070660_100051158 3300005339 Bacteria 3180
25 Ga0070660_100071742 3300005339 Bacteria 2704
26 Ga0070660_100122876 3300005339 Bacteria 2072
27 Ga0070691_10144095 3300005341 Bacteria 1216
28 Ga0070687_100027617 3300005343 Bacteria 2744
29 Ga0070687_100833594 3300005343 Bacteria 656
30 Ga0070661_100122120 3300005344 Bacteria 1952
31 Ga0070661_100193752 3300005344 Bacteria 1551
32 Ga0070661_100215869 3300005344 Bacteria 1470
33 Ga0070692_10052816 3300005345 Bacteria 2118
34 Ga0070692_10102804 3300005345 Bacteria 1569
35 Ga0070668_100003017 3300005347 Bacteria 12450
36 Ga0070669_100047682 3300005353 Bacteria 3125
37 Ga0070671_100105390 3300005355 Bacteria 2366
38 Ga0070674_100965521 3300005356 Unclassified 746
39 Ga0070674_101402681 3300005356 Bacteria 626
40 Ga0070673_100065060 3300005364 Bacteria 2907
41 Ga0070659_100148453 3300005366 Bacteria 1911
42 Ga0070709_10000050 3300005434 Bacteria 92617
43 Ga0070709_10386729 3300005434 Bacteria 1041
44 Ga0070709_10419419 3300005434 Bacteria 1003
45 Ga0070714_100026927 3300005435 Bacteria 4756
46 Ga0070714_100052728 3300005435 Bacteria 3470
47 Ga0070714_100071190 3300005435 Bacteria 3006
48 Ga0070714_100087082 3300005435 Bacteria 2731
49 Ga0070714_100091092 3300005435 Bacteria 2671
50 Ga0070714_100140725 3300005435 Bacteria 2166
51 Ga0070714_100338243 3300005435 Bacteria 1411
52 Ga0070714_100436730 3300005435 Bacteria 1242
53 Ga0070714_100952619 3300005435 Bacteria 834
54 Ga0070714_101081081 3300005435 Bacteria 781
55 Ga0070714_101082924 3300005435 Bacteria 781
56 Ga0070714_101151150 3300005435 Bacteria 756
57 Ga0070714_101911904 3300005435 Bacteria 579
58 Ga0070713_100000234 3300005436 Bacteria 36880
59 Ga0070713_100097228 3300005436 Bacteria 2544
60 Ga0070713_100484176 3300005436 Bacteria 1166
61 Ga0070713_100739706 3300005436 Bacteria 940
62 Ga0070713_101010348 3300005436 Bacteria 802
63 Ga0070713_101472821 3300005436 Unclassified 660
64 Ga0070710_10000291 3300005437 Bacteria 23753
65 Ga0070710_10023595 3300005437 Bacteria 3235
66 Ga0070710_10081927 3300005437 Bacteria 1885
67 Ga0070710_10453803 3300005437 Bacteria 869
68 Ga0070710_10997080 3300005437 Bacteria 610
69 Ga0070701_10076091 3300005438 Bacteria 1806
70 Ga0070701_10395661 3300005438 Bacteria 874
71 Ga0070711_100005623 3300005439 Bacteria 7505
72 Ga0070711_100325802 3300005439 Bacteria 1229
73 Ga0070711_100997043 3300005439 Bacteria 718
74 Ga0070711_101428518 3300005439 Bacteria 602
75 Ga0070705_100169921 3300005440 Bacteria 1466
76 Ga0070700_100016568 3300005441 Bacteria 4200
77 Ga0070700_100120417 3300005441 Bacteria 1758
78 Ga0070694_100410885 3300005444 Bacteria 1061
79 Ga0070708_100002501 3300005445 Bacteria 14185
80 Ga0070708_100004073 3300005445 Bacteria 11482
81 Ga0070708_100168064 3300005445 Bacteria 2046
82 Ga0070708_100306800 3300005445 Bacteria 1495
83 Ga0070708_100338370 3300005445 Bacteria 1418
84 Ga0070663_100167796 3300005455 Bacteria 1694
85 Ga0070663_100298508 3300005455 Bacteria 1289
86 Ga0070663_100565437 3300005455 Bacteria 952
87 Ga0070663_101145544 3300005455 Bacteria 681
88 Ga0070678_100162576 3300005456 Bacteria 1810
89 Ga0070662_100027312 3300005457 Bacteria 3960
90 Ga0070681_10145377 3300005458 Bacteria 2300
91 Ga0070681_10816893 3300005458 Bacteria 849
92 Ga0068867_100569361 3300005459 Bacteria 984
93 Ga0070685_10183273 3300005466 Bacteria 1350
94 Ga0070706_100009551 3300005467 Bacteria 9019
95 Ga0070706_100038573 3300005467 Bacteria 4409
96 Ga0070706_100070612 3300005467 Bacteria 3229
97 Ga0070706_100170182 3300005467 Bacteria 2034
98 Ga0070706_100935776 3300005467 Bacteria 800
99 Ga0070707_100001332 3300005468 Bacteria 24324
100 Ga0070707_100029812 3300005468 Bacteria 5192
101 Ga0070707_100044102 3300005468 Bacteria 4269
102 Ga0070707_100056772 3300005468 Bacteria 3756
103 Ga0070707_100134132 3300005468 Bacteria 2409
104 Ga0070698_100001732 3300005471 Bacteria 24325
105 Ga0070698_100001751 3300005471 Bacteria 24215
106 Ga0070698_100026356 3300005471 Bacteria 6050
107 Ga0070698_100163306 3300005471 Bacteria 2170
108 Ga0070698_100629308 3300005471 Bacteria 1014
109 Ga0070699_100000297 3300005518 Bacteria 47937
110 Ga0070699_100842471 3300005518 Bacteria 839
111 Ga0070699_101129352 3300005518 Bacteria 719
112 Ga0070699_101898107 3300005518 Bacteria 545
113 Ga0070679_100210663 3300005530 Bacteria 1907
114 Ga0070679_100242823 3300005530 Bacteria 1758
115 Ga0070684_100007007 3300005535 Bacteria 8758
116 Ga0070684_100024857 3300005535 Bacteria 5028
117 Ga0070684_101573356 3300005535 Bacteria 620
118 Ga0070697_100075666 3300005536 Bacteria 2768
119 Ga0070697_100118574 3300005536 Bacteria 2212
120 Ga0070697_100437397 3300005536 Bacteria 1138
121 Ga0068853_100067164 3300005539 Bacteria 3114
122 Ga0070672_100631374 3300005543 Bacteria 935
123 Ga0070672_100995607 3300005543 Bacteria 743
124 Ga0070686_100081221 3300005544 Bacteria 2147
125 Ga0070695_100361256 3300005545 Bacteria 1091
126 Ga0070695_100963028 3300005545 Bacteria 692
127 Ga0070696_100022554 3300005546 Bacteria 4278
128 Ga0070693_100009236 3300005547 Bacteria 4899
129 Ga0070665_100162793 3300005548 Bacteria 2233
130 Ga0070665_100361572 3300005548 Bacteria 1457
131 Ga0070665_100948957 3300005548 Bacteria 873
132 Ga0070704_100395812 3300005549 Bacteria 1177
133 Ga0070704_100406749 3300005549 Bacteria 1162
134 Ga0068855_100005321 3300005563 Bacteria 15722
135 Ga0068855_100095296 3300005563 Bacteria 3431
136 Ga0068855_100446534 3300005563 Bacteria 1412
137 Ga0068855_100519779 3300005563 Bacteria 1291
138 Ga0070664_100170057 3300005564 Bacteria 1933
139 Ga0070664_101515868 3300005564 Bacteria 634
140 Ga0068854_100016218 3300005578 Bacteria 4960
141 Ga0068856_100018050 3300005614 Bacteria 6842
142 Ga0068856_100171558 3300005614 Bacteria 2181
143 Ga0068856_100494856 3300005614 Bacteria 1243
144 Ga0068856_100502212 3300005614 Bacteria 1234
145 Ga0068856_100508989 3300005614 Bacteria 1225
146 Ga0068856_102488141 3300005614 Bacteria 524
147 Ga0070702_100021564 3300005615 Bacteria 3391
148 Ga0068852_100877355 3300005616 Bacteria 914
149 Ga0068852_101574254 3300005616 Bacteria 680
150 Ga0068859_100044686 3300005617 Bacteria 4451
151 Ga0068859_100376411 3300005617 Bacteria 1515
152 Ga0068864_100088910 3300005618 Bacteria 2721
153 Ga0068864_100493987 3300005618 Bacteria 1176
154 Ga0068864_100530670 3300005618 Bacteria 1136
155 Ga0068864_102296817 3300005618 Unclassified 546
156 Ga0068866_10016365 3300005718 Bacteria 3316
157 Ga0068866_10032658 3300005718 Bacteria 2518
158 Ga0068851_10219816 3300005834 Bacteria 1067
159 Ga0068851_10224397 3300005834 Bacteria 1057
160 Ga0068870_10233941 3300005840 Bacteria 1131
161 Ga0068863_100254812 3300005841 Bacteria 1696
162 Ga0068863_101446057 3300005841 Bacteria 695
163 Ga0068858_100153802 3300005842 Bacteria 2164
164 Ga0068858_100189228 3300005842 Bacteria 1945
165 Ga0068860_100282185 3300005843 Bacteria 1623
166 Ga0068860_100581051 3300005843 Bacteria 1124
167 Ga0068860_100987160 3300005843 Bacteria 860
168 Ga0068862_100210665 3300005844 Bacteria 1756
169 Ga0068862_100673620 3300005844 Bacteria 1000
170 Ga0081538_10000837 3300005981 Bacteria 33338
171 Ga0081538_10001823 3300005981 Bacteria 21449
172 Ga0081538_10021794 3300005981 Bacteria 4663
173 Ga0081540_1003675 3300005983 Bacteria 12036
174 Ga0081540_1022910 3300005983 Bacteria 3673
175 Ga0070717_10002697 3300006028 Bacteria 12513
176 Ga0070717_10016728 3300006028 Bacteria 5692
177 Ga0070717_10041443 3300006028 Bacteria 3754
178 Ga0070717_10094448 3300006028 Bacteria 2530
179 Ga0070717_10183033 3300006028 Bacteria 1827
180 Ga0070717_10277119 3300006028 Bacteria 1487
181 Ga0070717_10385904 3300006028 Bacteria 1256
182 Ga0070717_10729112 3300006028 Bacteria 901
183 Ga0070717_11209018 3300006028 Bacteria 688
184 Ga0070717_11474158 3300006028 Bacteria 617
185 Ga0075368_10002918 3300006042 Bacteria 5650
186 Ga0070715_10002026 3300006163 Bacteria 6111
187 Ga0070716_100000777 3300006173 Bacteria 13680
188 Ga0070716_100021426 3300006173 Bacteria 3406
189 Ga0070716_100154161 3300006173 Bacteria 1481
190 Ga0070716_101644078 3300006173 Bacteria 528
191 Ga0070712_100012590 3300006175 Bacteria 5380
192 Ga0070712_100075708 3300006175 Bacteria 2421
193 Ga0070712_101173995 3300006175 Bacteria 667
194 Ga0068871_102104275 3300006358 Bacteria 537
195 Ga0075433_10015293 3300006852 Bacteria 6289
196 Ga0075433_10754987 3300006852 Bacteria 851
197 Ga0075434_100021315 3300006871 Bacteria 6299
198 Ga0075434_100138826 3300006871 Bacteria 2450
199 Ga0075434_100357058 3300006871 Bacteria 1482
200 Ga0075434_100692308 3300006871 Bacteria 1037
201 Ga0075429_100406145 3300006880 Bacteria 1193
202 Ga0068865_100184039 3300006881 Bacteria 1611
203 Ga0068865_100624504 3300006881 Bacteria 913
204 Ga0075436_100315279 3300006914 Bacteria 1123
205 Ga0097620_100044687 3300006931 Bacteria 4451
206 Ga0097620_100376422 3300006931 Bacteria 1515
207 Ga0075435_100016896 3300007076 Bacteria 5509
208 Ga0075435_100080959 3300007076 Bacteria 2667
209 Ga0075435_101042118 3300007076 Bacteria 715
210 Ga0099794_10070857 3300007265 Bacteria 1707
211 Ga0105251_10033716 3300009011 Bacteria 2539
212 Ga0105251_10059114 3300009011 Bacteria 1809
213 Ga0105240_10297589 3300009093 Bacteria 1847
214 Ga0105240_10335962 3300009093 Bacteria 1717
215 Ga0105245_10025942 3300009098 Bacteria 5155
216 Ga0105245_10232159 3300009098 Bacteria 1785
217 Ga0105245_10699394 3300009098 Bacteria 1047
218 Ga0105247_10131637 3300009101 Bacteria 1631
219 Ga0105247_10393462 3300009101 Bacteria 985
220 Ga0105241_10128753 3300009174 Bacteria 2047
221 Ga0105241_11386048 3300009174 Bacteria 673
222 Ga0105242_10089991 3300009176 Bacteria 2581
223 Ga0105248_10114725 3300009177 Bacteria 3039
224 Ga0105248_11734247 3300009177 Bacteria 708
225 Ga0105237_10370620 3300009545 Bacteria 1437
226 Ga0105237_10687334 3300009545 Bacteria 1030
227 Ga0105237_10734094 3300009545 Bacteria 994
228 Ga0105237_10874673 3300009545 Bacteria 905
229 Ga0105238_10075051 3300009551 Bacteria 3373
230 Ga0105238_10291927 3300009551 Bacteria 1613
231 Ga0105249_10003788 3300009553 Bacteria 13065
232 Ga0105249_10173188 3300009553 Bacteria 2094
233 Ga0105249_10263283 3300009553 Bacteria 1714
234 Ga0105249_10526882 3300009553 Bacteria 1230
235 Ga0105239_10561984 3300010375 Bacteria 1300
236 Ga0105246_10576610 3300011119 Unclassified 968
237 Ga0157335_1010895 3300012492 Bacteria 738
238 Ga0157319_1008227 3300012497 Bacteria 793
239 Ga0157339_1001551 3300012505 Bacteria 1427
240 Ga0157315_1007034 3300012508 Bacteria 899
241 Ga0157373_10086158 3300013100 Bacteria 2214
242 Ga0157370_10079865 3300013104 Bacteria 3080
243 Ga0157369_10020963 3300013105 Bacteria 7307
244 Ga0157369_10144284 3300013105 Bacteria 2517
245 Ga0157369_10712222 3300013105 Bacteria 1033
246 Ga0157369_12386064 3300013105 Bacteria 536
247 Ga0157374_10003642 3300013296 Bacteria 12967
248 Ga0163162_11507495 3300013306 Bacteria 766
249 Ga0163162_12491447 3300013306 Bacteria 595
250 Ga0157372_10967160 3300013307 Bacteria 987
251 Ga0157375_10531536 3300013308 Bacteria 1339
252 Ga0163163_10054327 3300014325 Bacteria 3957
253 Ga0163163_10479517 3300014325 Bacteria 1305
254 Ga0163163_11128943 3300014325 Bacteria 847
255 Ga0163163_11351028 3300014325 Bacteria 774
256 Ga0157380_10024913 3300014326 Bacteria 4533
257 Ga0157380_10354636 3300014326 Bacteria 1374
258 Ga0157380_11382846 3300014326 Bacteria 754
259 Ga0182008_10008185 3300014497 Bacteria 5723
260 Ga0157377_10277339 3300014745 Bacteria 1097
261 Ga0157377_11402466 3300014745 Bacteria 551
262 Ga0157379_10068602 3300014968 Bacteria 3170
263 Ga0157379_10187164 3300014968 Bacteria 1871
264 Ga0182007_10003219 3300015262 Bacteria 7776
265 Ga0163161_10014946 3300017792 Bacteria 5406
266 Ga0163161_10068086 3300017792 Bacteria 2601
267 Ga0197907_11055370 3300020069 Bacteria 2105
268 Ga0206356_10442337 3300020070 Bacteria 2858
269 Ga0206349_1376759 3300020075 Bacteria 594
270 Ga0206354_11098712 3300020081 Bacteria 781
271 Ga0206353_10898352 3300020082 Bacteria 1195
272 Ga0206353_10968064 3300020082 Bacteria 979
273 Ga0206353_11955525 3300020082 Bacteria 3461
274 Ga0213875_10000263 3300021388 Bacteria 52579
275 Ga0213875_10020474 3300021388 Bacteria 3174
276 Ga0213875_10109225 3300021388 Bacteria 1291
277 Ga0213871_10266399 3300021441 Bacteria 547
278 Ga0224712_10009701 3300022467 Bacteria 2914
279 Ga0224712_10416830 3300022467 Bacteria 642
280 Ga0224569_109486 3300022732 Bacteria 690
281 Ga0224572_1000624 3300024225 Bacteria 4407
282 Ga0207426_1001153 3300025302 Bacteria 23778
283 Ga0207426_1007679 3300025302 Bacteria 4480
284 Ga0207653_10177172 3300025885 Bacteria 796
285 Ga0207692_10001046 3300025898 Bacteria 10108
286 Ga0207692_10065360 3300025898 Bacteria 1897
287 Ga0207692_10107626 3300025898 Bacteria 1541
288 Ga0207692_10206121 3300025898 Unclassified 1159
289 Ga0207692_10228411 3300025898 Bacteria 1106
290 Ga0207692_10521364 3300025898 Bacteria 756
291 Ga0207642_10018205 3300025899 Bacteria 2691
292 Ga0207688_10046391 3300025901 Bacteria 2426
293 Ga0207688_10142114 3300025901 Bacteria 1413
294 Ga0207680_10495970 3300025903 Bacteria 869
295 Ga0207647_10019719 3300025904 Bacteria 4531
296 Ga0207647_10050238 3300025904 Bacteria 2583
297 Ga0207685_10000566 3300025905 Bacteria 6424
298 Ga0207685_10022335 3300025905 Bacteria 2137
299 Ga0207685_10036748 3300025905 Bacteria 1798
300 Ga0207699_10000615 3300025906 Bacteria 17330
301 Ga0207699_10034664 3300025906 Bacteria 2865
302 Ga0207699_10042702 3300025906 Bacteria 2629
303 Ga0207699_10079294 3300025906 Bacteria 2031
304 Ga0207699_10365454 3300025906 Bacteria 1021
305 Ga0207699_10466935 3300025906 Bacteria 907
306 Ga0207643_10008428 3300025908 Bacteria 5532
307 Ga0207643_10352448 3300025908 Bacteria 924
308 Ga0207705_10483366 3300025909 Bacteria 961
309 Ga0207705_10651934 3300025909 Bacteria 819
310 Ga0207684_10008113 3300025910 Bacteria 9362
311 Ga0207684_10040820 3300025910 Bacteria 3934
312 Ga0207684_10073883 3300025910 Bacteria 2896
313 Ga0207684_10794281 3300025910 Bacteria 800
314 Ga0207654_10273809 3300025911 Bacteria 1140
315 Ga0207654_10750681 3300025911 Bacteria 703
316 Ga0207707_10112956 3300025912 Bacteria 2374
317 Ga0207695_10210001 3300025913 Bacteria 1858
318 Ga0207695_10242397 3300025913 Bacteria 1704
319 Ga0207671_10708262 3300025914 Bacteria 801
320 Ga0207671_11574216 3300025914 Bacteria 506
321 Ga0207693_10002572 3300025915 Bacteria 15768
322 Ga0207693_10003699 3300025915 Bacteria 13035
323 Ga0207693_10015860 3300025915 Bacteria 6035
324 Ga0207693_10176681 3300025915 Bacteria 1680
325 Ga0207693_10655319 3300025915 Bacteria 815
326 Ga0207663_10049029 3300025916 Bacteria 2617
327 Ga0207663_10415390 3300025916 Bacteria 1032
328 Ga0207663_10820892 3300025916 Bacteria 741
329 Ga0207663_11317056 3300025916 Bacteria 582
330 Ga0207663_11358024 3300025916 Bacteria 572
331 Ga0207660_10620157 3300025917 Bacteria 881
332 Ga0207662_10000280 3300025918 Bacteria 23584
333 Ga0207662_10030102 3300025918 Bacteria 3149
334 Ga0207657_10010096 3300025919 Bacteria 9441
335 Ga0207657_10149065 3300025919 Bacteria 1906
336 Ga0207657_10766838 3300025919 Bacteria 747
337 Ga0207646_10003994 3300025922 Bacteria 16334
338 Ga0207646_10026099 3300025922 Bacteria 5337
339 Ga0207646_10098825 3300025922 Bacteria 2615
340 Ga0207646_10102020 3300025922 Bacteria 2572
341 Ga0207646_10490023 3300025922 Bacteria 1108
342 Ga0207681_10034823 3300025923 Bacteria 3314
343 Ga0207681_10760867 3300025923 Bacteria 808
344 Ga0207687_10047419 3300025927 Bacteria 2979
345 Ga0207700_10000583 3300025928 Bacteria 21314
346 Ga0207700_10039233 3300025928 Bacteria 3445
347 Ga0207700_10188182 3300025928 Bacteria 1733
348 Ga0207700_10307891 3300025928 Bacteria 1369
349 Ga0207700_10778862 3300025928 Bacteria 855
350 Ga0207700_11186038 3300025928 Bacteria 682
351 Ga0207700_11215304 3300025928 Unclassified 673
352 Ga0207664_10002253 3300025929 Bacteria 12701
353 Ga0207664_10017546 3300025929 Bacteria 5251
354 Ga0207664_10028349 3300025929 Bacteria 4254
355 Ga0207664_10048984 3300025929 Bacteria 3325
356 Ga0207664_10178541 3300025929 Bacteria 1822
357 Ga0207664_10191553 3300025929 Bacteria 1761
358 Ga0207664_10404950 3300025929 Bacteria 1214
359 Ga0207664_10813976 3300025929 Bacteria 840
360 Ga0207644_10128817 3300025931 Bacteria 1935
361 Ga0207690_10087122 3300025932 Bacteria 2196
362 Ga0207706_10095211 3300025933 Bacteria 2619
363 Ga0207709_10042386 3300025935 Bacteria 2737
364 Ga0207670_10079759 3300025936 Bacteria 2286
365 Ga0207704_10280675 3300025938 Bacteria 1266
366 Ga0207665_10000019 3300025939 Bacteria 121429
367 Ga0207665_10001771 3300025939 Bacteria 14513
368 Ga0207665_10008135 3300025939 Bacteria 6923
369 Ga0207665_10021484 3300025939 Bacteria 4244
370 Ga0207665_10150793 3300025939 Bacteria 1665
371 Ga0207665_10221551 3300025939 Bacteria 1386
372 Ga0207691_10174546 3300025940 Bacteria 1881
373 Ga0207711_10104830 3300025941 Bacteria 2506
374 Ga0207711_10339764 3300025941 Bacteria 1390
375 Ga0207689_10405636 3300025942 Bacteria 1136
376 Ga0207689_11234892 3300025942 Bacteria 629
377 Ga0207661_10018260 3300025944 Bacteria 5209
378 Ga0207661_10049848 3300025944 Bacteria 3335
379 Ga0207661_10133609 3300025944 Bacteria 2129
380 Ga0207679_10341321 3300025945 Bacteria 1303
381 Ga0207679_11783044 3300025945 Bacteria 562
382 Ga0207667_10019283 3300025949 Bacteria 7620
383 Ga0207667_10388554 3300025949 Bacteria 1421
384 Ga0207667_10664074 3300025949 Bacteria 1047
385 Ga0207667_11638085 3300025949 Bacteria 611
386 Ga0207651_10080763 3300025960 Bacteria 2342
387 Ga0207651_10598721 3300025960 Bacteria 963
388 Ga0207712_10005052 3300025961 Bacteria 8351
389 Ga0207712_10263560 3300025961 Bacteria 1399
390 Ga0207668_10062438 3300025972 Bacteria 2623
391 Ga0207668_11195406 3300025972 Bacteria 683
392 Ga0207640_10014818 3300025981 Bacteria 4497
393 Ga0207640_10549976 3300025981 Bacteria 970
394 Ga0207658_11024585 3300025986 Bacteria 753
395 Ga0207703_10232753 3300026035 Bacteria 1653
396 Ga0207678_10097265 3300026067 Bacteria 2516
397 Ga0207678_10259680 3300026067 Bacteria 1489
398 Ga0207678_10469299 3300026067 Bacteria 1095
399 Ga0207678_10560100 3300026067 Bacteria 1000
400 Ga0207708_10056348 3300026075 Bacteria 2998
401 Ga0207702_10011805 3300026078 Bacteria 7273
402 Ga0207702_10100285 3300026078 Bacteria 2554
403 Ga0207702_10178281 3300026078 Bacteria 1955
404 Ga0207702_10209427 3300026078 Bacteria 1812
405 Ga0207702_10286463 3300026078 Bacteria 1559
406 Ga0207702_10867068 3300026078 Bacteria 894
407 Ga0207641_10615646 3300026088 Bacteria 1064
408 Ga0207648_10517164 3300026089 Bacteria 1093
409 Ga0207676_10468815 3300026095 Bacteria 1190
410 Ga0207674_10575858 3300026116 Bacteria 1088
411 Ga0207675_100203273 3300026118 Bacteria 1903
412 Ga0207683_10082459 3300026121 Bacteria 2857
413 Ga0207683_10427630 3300026121 Bacteria 1220
414 Ga0207698_10923955 3300026142 Bacteria 881
415 Ga0209813_10009557 3300027866 Bacteria 2485
416 Ga0207428_10472701 3300027907 Bacteria 912
417 Ga0268266_10461269 3300028379 Bacteria 1209
418 Ga0268266_10503013 3300028379 Bacteria 1157
419 Ga0268265_10057999 3300028380 Bacteria 2954
420 Ga0268264_10160901 3300028381 Bacteria 2022
421 Ga0268264_10589069 3300028381 Bacteria 1095
422 Ga0265336_10005074 3300028666 Bacteria 4899
423 Ga0307517_10101722 3300028786 Bacteria 2259
424 Ga0265338_10000957 3300028800 Bacteria 48665
425 Ga0307512_10008864 3300030522 Bacteria 9756
426 Ga0307513_10000354 3300031456 Bacteria 66910
427 Ga0307513_10078440 3300031456 Bacteria 3416
428 Ga0307513_10241218 3300031456 Bacteria 1612
429 Ga0307513_10463776 3300031456 Bacteria 989
430 Ga0307508_10002311 3300031616 Bacteria 20242
431 Ga0307406_10308260 3300031901 Bacteria 1219
432 Ga0307412_10517076 3300031911 Bacteria 997
433 Ga0307409_101407158 3300031995 Bacteria 724
434 Ga0307416_103043884 3300032002 Bacteria 561
435 Ga0373948_0080630 3300034817 Bacteria 742
436 Ga0373948_0141654 3300034817 Bacteria 595
437 Ga0373959_0083617 3300034820 Bacteria 739
438 Ga0373938_0104944 3300034957 Bacteria 714
439 Ga0373926_0168468 3300035083 Bacteria 838
440 Ga0373928_0028039 3300035084 Bacteria 1229
441 Ga0373929_0043674 3300035085 Bacteria 1004
442 Ga0373934_0016245 3300035086 Bacteria 2829
443 Ga0373940_0116083 3300035088 Bacteria 826
444 Ga0373949_0017940 3300035090 Bacteria 1600
445 Ga0373952_0011261 3300035092 Bacteria 1742
446 Ga0373923_0211336 3300035111 Bacteria 899
447 Ga0373936_0005930 3300035113 Bacteria 4598
448 Ga0373939_0016142 3300035114 Bacteria 1965
449 Ga0373939_0155101 3300035114 Bacteria 837
450 Ga0373941_0012386 3300035115 Bacteria 2229
451 Ga0373941_0060264 3300035115 Bacteria 1233
452 Ga0373941_0502571 3300035115 Bacteria 516
453 Ga0373945_0258970 3300035116 Bacteria 736
454 Ga0373953_0138062 3300035117 Bacteria 1042
455 Ga0373954_0025484 3300035118 Bacteria 2704
456 Ga0373954_0042592 3300035118 Bacteria 2117
457 Ga0373954_0101005 3300035118 Bacteria 1392
458 Ga0373957_0164760 3300035120 Bacteria 914
459 Ga0373960_0401972 3300035121 Bacteria 529
460 Ga0373943_0588597 3300035170 Unclassified 655
461 Ga0373943_0726659 3300035170 Bacteria 589
462 Ga0373946_0079045 3300035171 Bacteria 1436
463 Ga0373946_0230956 3300035171 Bacteria 896
464 Ga0373955_0070225 3300035172 Bacteria 1956
465 Ga0373955_0573534 3300035172 Bacteria 690
466 Ga0373942_0013302 3300035207 Bacteria 1977
467 Ga0373942_0015669 3300035207 Bacteria 1851
468 Ga0373961_0003283 3300035241 Bacteria 4026
469 Ga0373961_0006940 3300035241 Bacteria 2727
470 Ga0373931_0048378 3300035691 Bacteria 2254
471 Ga0373931_0061399 3300035691 Bacteria 2026
472 Ga0373931_0268325 3300035691 Bacteria 1044
473 Ga0373931_0504169 3300035691 Bacteria 781
474 Ga0373933_0021056 3300035724 Bacteria 3700
475 Ga0373933_0037656 3300035724 Bacteria 2838
476 Ga0373933_0222263 3300035724 Bacteria 1212
477 Ga0373947_0244747 3300035725 Bacteria 1184
478 Ga0373937_0174971 3300036401 Bacteria 2014
479 Ga0373937_0816991 3300036401 Bacteria 880
480 Ga0373925_0483860 3300037068 Bacteria 1015
481 Ga0373925_0537700 3300037068 Bacteria 960
482 Ga0395900_0045302 3300037418 Bacteria 4531
483 Ga0395898_0018702 3300037466 Bacteria 7064
484 Ga0436364_0028955 3300037853 Bacteria 5483
485 Ga0436364_0065152 3300037853 Bacteria 40870
486 Ga0436364_0142449 3300037853 Unclassified 618
487 Ga0436364_0186557 3300037853 Bacteria 4954
488 Ga0436364_0275949 3300037853 Bacteria 1235
489 Ga0436364_0628387 3300037853 Bacteria 16150
490 Ga0436364_1025546 3300037853 Bacteria 6129
491 Ga0436360_0123171 3300039438 Bacteria 1071
492 Ga0436362_0490277 3300039453 Bacteria 912
493 Ga0436362_1154466 3300039453 Bacteria 905
494 Ga0466969_0021551 3300044656 Bacteria 3331
495 Ga0466972_0005436 3300044658 Bacteria 6381
496 Ga0466972_0612202 3300044658 Bacteria 515
497 Ga0466965_0274498 3300044683 Bacteria 909
498 Ga0466965_0327851 3300044683 Bacteria 835
499 Ga0466965_0545159 3300044683 Bacteria 654
500 Ga0466966_0079124 3300044684 Bacteria 2049
501 Ga0466961_0176815 3300044693 Bacteria 1326
502 Ga0466961_0265509 3300044693 Bacteria 1052
503 Ga0466963_0044862 3300044694 Bacteria 2910
504 Ga0466963_0049849 3300044694 Bacteria 2770
505 Ga0466963_0503084 3300044694 Bacteria 855
506 Ga0466963_0886907 3300044694 Bacteria 629
507 Ga0466968_0107028 3300044735 Bacteria 1254
508 Ga0466970_0022182 3300044765 Bacteria 3314
509 Ga0466970_0103702 3300044765 Bacteria 1550
510 Ga0466970_0173082 3300044765 Bacteria 1197
511 Ga0466957_0051268 3300044842 Bacteria 2512
512 Ga0466957_0316973 3300044842 Bacteria 1051
513 Ga0466957_0460398 3300044842 Bacteria 877
514 Ga0466960_0037608 3300044901 Bacteria 2271
515 Ga0466960_0374450 3300044901 Bacteria 816
516 Ga0466960_0489642 3300044901 Bacteria 719
517 Ga0466959_0170529 3300045049 Bacteria 1526
518 Ga0466958_0015959 3300045836 Bacteria 4318
519 Ga0466967_0014735 3300045976 Bacteria 6106
520 Ga0466967_0028145 3300045976 Bacteria 4687
521 Ga0466967_0043646 3300045976 Bacteria 3883
522 Ga0466967_0099534 3300045976 Bacteria 2656
523 Ga0466967_0120805 3300045976 Bacteria 2420
524 Ga0466967_0141148 3300045976 Bacteria 2244
525 Ga0466967_0147549 3300045976 Bacteria 2195
526 Ga0466967_0629796 3300045976 Bacteria 1060
527 Ga0466967_0740231 3300045976 Bacteria 975
528 Ga0466967_1182412 3300045976 Bacteria 762
529 Ga0495592_0065342 3300046454 Bacteria 2663
530 Ga0495592_0091008 3300046454 Bacteria 2188
531 Ga0495629_0196694 3300046459 Bacteria 1394
532 Ga0495641_0051975 3300046461 Bacteria 1869
533 Ga0495641_0431104 3300046461 Unclassified 599
534 Ga0495651_0000950 3300046462 Bacteria 22399
535 Ga0495651_0035055 3300046462 Bacteria 3909
536 Ga0495653_0019344 3300046463 Bacteria 5523
537 Ga0495582_0046973 3300046473 Bacteria 2378
538 Ga0495639_0153690 3300046475 Bacteria 1111
539 Ga0495664_0058801 3300046477 Bacteria 2287
540 Ga0495594_0296064 3300046499 Bacteria 922
541 Ga0495608_0055568 3300046511 Bacteria 2616
542 Ga0495608_0066908 3300046511 Bacteria 2351
543 Ga0495618_0075066 3300046514 Bacteria 2153
544 Ga0495628_0001646 3300046516 Bacteria 20442
545 Ga0495628_0197067 3300046516 Bacteria 1519
546 Ga0495628_1025752 3300046516 Bacteria 567
547 Ga0495630_0264642 3300046517 Bacteria 1313
548 Ga0495652_0018457 3300046529 Bacteria 6216
549 Ga0495652_0162225 3300046529 Bacteria 1734
550 Ga0495652_0904913 3300046529 Bacteria 582
551 Ga0495665_0013179 3300046531 Bacteria 4475
552 Ga0495640_0063902 3300046533 Bacteria 2490
553 Ga0495587_0000345 3300046536 Bacteria 33064
554 Ga0495587_0140579 3300046536 Bacteria 1378
555 Ga0495587_0614699 3300046536 Bacteria 598
556 Ga0495645_0013274 3300046543 Bacteria 5821
557 Ga0495645_0747379 3300046543 Bacteria 590
558 Ga0495667_0002768 3300046559 Bacteria 11703
559 Ga0495667_0176130 3300046559 Bacteria 1373
560 Ga0495667_0450652 3300046559 Bacteria 808
561 Ga0495667_0616095 3300046559 Bacteria 676
562 Ga0495634_0066201 3300046642 Bacteria 2392
563 Ga0495634_0290369 3300046642 Bacteria 991
564 Ga0495635_0046670 3300046663 Bacteria 2988
565 Ga0495635_0063092 3300046663 Bacteria 2544
566 Ga0495588_0275383 3300046674 Bacteria 887
567 Ga0495657_0014811 3300046675 Bacteria 5722
568 Ga0495657_0029676 3300046675 Bacteria 3834
569 Ga0495599_0000694 3300046678 Bacteria 19041
570 Ga0495599_0168454 3300046678 Bacteria 1352
571 Ga0495599_0358476 3300046678 Bacteria 873
572 Ga0495623_0032717 3300046679 Bacteria 3341
573 Ga0495646_0338697 3300046680 Bacteria 789
574 Ga0495658_0082348 3300046683 Bacteria 1891
575 Ga0495613_0061232 3300046689 Bacteria 2756
576 Ga0495600_0064073 3300046809 Bacteria 2402
577 Ga0495600_0431793 3300046809 Bacteria 816
578 Ga0495674_0226129 3300047319 Bacteria 1545
579 Ga0495676_0182010 3300047321 Bacteria 1472
580 Ga0495676_0502210 3300047321 Bacteria 796
581 Ga0495676_0815183 3300047321 Bacteria 600
582 Ga0495680_0010838 3300047322 Bacteria 8111
583 Ga0495680_0012089 3300047322 Bacteria 7616
584 Ga0495675_0014265 3300047444 Bacteria 5023
585 Ga0495675_0041046 3300047444 Bacteria 2949
586 Ga0495675_0253247 3300047444 Bacteria 1057
587 Ga0495684_0014181 3300047471 Bacteria 6131
588 Ga0495684_0044076 3300047471 Bacteria 3415
589 Ga0495593_0044171 3300047673 Bacteria 2385
590 Ga0495602_0046917 3300048088 Bacteria 3897
591 Ga0495602_0137433 3300048088 Bacteria 1939
592 Ga0495614_0118910 3300048089 Bacteria 1164
593 Ga0496100_0042678 3300048903 Bacteria 2898
594 Ga0496100_0201280 3300048903 Bacteria 1451
595 Ga0496101_0178758 3300048904 Bacteria 1633
596 Ga0496102_0039000 3300048905 Bacteria 4290
597 Ga0496102_0501068 3300048905 Bacteria 1136
598 Ga0496103_0008902 3300048906 Bacteria 5951
599 Ga0496103_0421504 3300048906 Bacteria 857
600 Ga0496104_0004394 3300048907 Bacteria 12274
601 Ga0496104_0044431 3300048907 Bacteria 4174
602 Ga0496104_0170977 3300048907 Bacteria 2084
603 Ga0496105_0002559 3300048908 Bacteria 13205
604 Ga0496105_0009242 3300048908 Bacteria 7699
605 Ga0496105_0069770 3300048908 Bacteria 2904
606 Ga0496105_0215297 3300048908 Bacteria 1565
607 Ga0496106_0142742 3300048909 Bacteria 1884
608 Ga0496106_0615318 3300048909 Bacteria 869
609 Ga0496106_0782904 3300048909 Bacteria 757
610 Ga0496107_0159699 3300048910 Bacteria 1670
611 Ga0496108_0004883 3300048911 Bacteria 10825
612 Ga0496108_0032095 3300048911 Bacteria 4360
613 Ga0496108_0754443 3300048911 Bacteria 841
614 Ga0496109_0005919 3300048912 Bacteria 10260
615 Ga0496109_0168899 3300048912 Bacteria 2051
616 Ga0496109_0408761 3300048912 Bacteria 1282
617 Ga0496109_0793814 3300048912 Bacteria 885
618 Ga0496110_0004829 3300048913 Bacteria 10504
619 Ga0496110_0081556 3300048913 Bacteria 2884
620 Ga0496110_0305319 3300048913 Bacteria 1449
621 Ga0496110_0549332 3300048913 Bacteria 1050
622 Ga0496110_0740595 3300048913 Bacteria 886
623 Ga0496111_0018394 3300048914 Bacteria 4840
624 Ga0496111_0046577 3300048914 Bacteria 3122
625 Ga0496112_0002690 3300048915 Bacteria 14366
626 Ga0496112_0041831 3300048915 Bacteria 4484
627 Ga0496112_0184189 3300048915 Bacteria 2052
628 Ga0496112_0277949 3300048915 Bacteria 1622
629 Ga0496112_0483489 3300048915 Bacteria 1174
630 Ga0496112_0856184 3300048915 Unclassified 832
631 Ga0496113_0224225 3300048916 Bacteria 1498
632 Ga0496113_0326170 3300048916 Bacteria 1231
633 Ga0496113_0339598 3300048916 Bacteria 1204
634 Ga0496113_0493457 3300048916 Bacteria 983
635 Ga0496114_0934709 3300048917 Bacteria 749
636 Ga0496114_0964417 3300048917 Bacteria 735
637 Ga0496115_0011313 3300048918 Bacteria 6687
638 Ga0496115_0042822 3300048918 Bacteria 3609
639 Ga0496115_0268734 3300048918 Bacteria 1401
640 Ga0496115_0606897 3300048918 Bacteria 869
641 Ga0496115_0739519 3300048918 Bacteria 770
642 Ga0496126_0525886 3300048929 Bacteria 942
643 Ga0501032_1016403 3300049569 Bacteria 521
644 Ga0501038_0626697 3300049574 Unclassified 812
645 Ga0501040_0936505 3300049576 Bacteria 628
646 Ga0501042_0090166 3300049578 Bacteria 2200
647 Ga0501042_0516111 3300049578 Bacteria 868
648 Ga0501042_0636242 3300049578 Bacteria 776
649 Ga0501042_0998973 3300049578 Bacteria 610
650 Ga0501071_0347373 3300049587 Bacteria 1129
651 Ga0501072_0141433 3300049588 Unclassified 1919
652 Ga0501075_0295493 3300049591 Bacteria 1234
653 Ga0501076_0094452 3300049592 Bacteria 2408
654 Ga0501076_0477456 3300049592 Bacteria 1027
655 Ga0501076_0691043 3300049592 Bacteria 842
656 Ga0501081_0485985 3300049743 Bacteria 919
657 Ga0501045_0775788 3300049824 Bacteria 706
658 nmdc:mga06z11_15715_c1 3300050494 Bacteria 3386
659 nmdc:mga04h51_12136_c1 3300050495 Bacteria 2411
660 nmdc:mga09592_486545_c1 3300050508 Bacteria 1063
661 nmdc:mga08y16_1161290_c1 3300050511 Bacteria 744
662 nmdc:mga0n895_159189_c1 3300050512 Bacteria 2289
663 nmdc:mga0n895_1884465_c1 3300050512 Bacteria 557
664 nmdc:mga0n895_269417_c1 3300050512 Bacteria 1727
665 nmdc:mga0n895_64694_c1 3300050512 Bacteria 3618
666 nmdc:mga0n895_80991_c1 3300050512 Bacteria 3235
667 nmdc:mga0rr50_10305_c1 3300050513 Bacteria 5924
668 nmdc:mga0rr50_109237_c1 3300050513 Bacteria 2186
669 nmdc:mga0rr50_618489_c1 3300050513 Bacteria 924
670 nmdc:mga08x19_303036_c1 3300050514 Bacteria 1110
671 nmdc:mga0a205_234680_c1 3300050515 Bacteria 1716
672 nmdc:mga0a205_5537_c1 3300050515 Bacteria 11373
673 Ga0495601_0054438 3300053077 Bacteria 2531
674 Ga0495612_0049380 3300053078 Bacteria 1726
675 Ga0495595_0003303 3300053084 Bacteria 6405
676 Ga0495619_0078661 3300053085 Bacteria 2217
677 Ga0587073_0212185 3300059492 Bacteria 587
678 Ga0501082_0710119 3300060353 Bacteria 880
679 Ga0530510_0084326 3300061734 Bacteria 2314
680 Ga0530510_0351715 3300061734 Bacteria 1107
681 2644013917 2643221601 Bacteria 7493239
682 2686537893 2684623035 Bacteria 8032739
683 2808915146 2808606375 Bacteria 9466072
684 2856744756 2856741275 Bacteria 8096094
685 2867372705 2867369537 Bacteria 6501581
686 2867480362 2867475112 Bacteria 6909112
687 2891328596 2891326441 Bacteria 6439512
688 2891399733 2891395885 Bacteria 9251614
689 2891557459 2891554331 Bacteria 8812224
690 2891564039 2891562705 Bacteria 8039471
691 2895888185 2895880812 Bacteria 11255272
692 2995465386 2995463766 Bacteria 8577691
693 8055177670 8055172936 Bacteria 9305943
694 Ga0373943_0323306
695 JGI24737J22298_10013186
696 JGI24743J22301_10082387
697 JGI24738J21930_10010532
698 JGI25160J50197_1009200
699 JGI25160J50197_1013876
700 JGI25407J50210_10048991
701 Ga0070658_10134161
702 Ga0070658_10228399
703 Ga0070683_100038220
704 Ga0070683_100146167
705 Ga0070683_101664782
706 Ga0070690_100031667
707 Ga0070670_101280800
708 Ga0068869_100127423
709 Ga0068869_100251373
710 Ga0068869_100615289
711 Ga0070680_100101485
712 Ga0070680_100213671
713 Ga0070682_100034013
714 Ga0070682_100855330
715 Ga0068868_100082690
716 Ga0068868_100188341
717 Ga0070660_100051158
718 Ga0070660_100071742
719 Ga0070660_100122876
720 Ga0070691_10144095
721 Ga0070687_100027617
722 Ga0070687_100833594
723 Ga0070661_100122120
724 Ga0070661_100193752
725 Ga0070661_100215869
726 Ga0070692_10052816
727 Ga0070692_10102804
728 Ga0070668_100003017
729 Ga0070669_100047682
730 Ga0070671_100105390
731 Ga0070674_100965521
732 Ga0070674_101402681
733 Ga0070673_100065060
734 Ga0070659_100148453
735 Ga0070709_10000050
736 Ga0070709_10386729
737 Ga0070709_10419419
738 Ga0070714_100026927
739 Ga0070714_100052728
740 Ga0070714_100071190
741 Ga0070714_100087082
742 Ga0070714_100091092
743 Ga0070714_100140725
744 Ga0070714_100338243
745 Ga0070714_100436730
746 Ga0070714_100952619
747 Ga0070714_101081081
748 Ga0070714_101082924
749 Ga0070714_101151150
750 Ga0070714_101911904
751 Ga0070713_100000234
752 Ga0070713_100097228
753 Ga0070713_100484176
754 Ga0070713_100739706
755 Ga0070713_101010348
756 Ga0070713_101472821
757 Ga0070710_10000291
758 Ga0070710_10023595
759 Ga0070710_10081927
760 Ga0070710_10453803
761 Ga0070710_10997080
762 Ga0070701_10076091
763 Ga0070701_10395661
764 Ga0070711_100005623
765 Ga0070711_100325802
766 Ga0070711_100997043
767 Ga0070711_101428518
768 Ga0070705_100169921
769 Ga0070700_100016568
770 Ga0070700_100120417
771 Ga0070694_100410885
772 Ga0070708_100002501
773 Ga0070708_100004073
774 Ga0070708_100168064
775 Ga0070708_100306800
776 Ga0070708_100338370
777 Ga0070663_100167796
778 Ga0070663_100298508
779 Ga0070663_100565437
780 Ga0070663_101145544
781 Ga0070678_100162576
782 Ga0070662_100027312
783 Ga0070681_10145377
784 Ga0070681_10816893
785 Ga0068867_100569361
786 Ga0070685_10183273
787 Ga0070706_100009551
788 Ga0070706_100038573
789 Ga0070706_100070612
790 Ga0070706_100170182
791 Ga0070706_100935776
792 Ga0070707_100001332
793 Ga0070707_100029812
794 Ga0070707_100044102
795 Ga0070707_100056772
796 Ga0070707_100134132
797 Ga0070698_100001732
798 Ga0070698_100001751
799 Ga0070698_100026356
800 Ga0070698_100163306
801 Ga0070698_100629308
802 Ga0070699_100000297
803 Ga0070699_100842471
804 Ga0070699_101129352
805 Ga0070699_101898107
806 Ga0070679_100210663
807 Ga0070679_100242823
808 Ga0070684_100007007
809 Ga0070684_100024857
810 Ga0070684_101573356
811 Ga0070697_100075666
812 Ga0070697_100118574
813 Ga0070697_100437397
814 Ga0068853_100067164
815 Ga0070672_100631374
816 Ga0070672_100995607
817 Ga0070686_100081221
818 Ga0070695_100361256
819 Ga0070695_100963028
820 Ga0070696_100022554
821 Ga0070693_100009236
822 Ga0070665_100162793
823 Ga0070665_100361572
824 Ga0070665_100948957
825 Ga0070704_100395812
826 Ga0070704_100406749
827 Ga0068855_100005321
828 Ga0068855_100095296
829 Ga0068855_100446534
830 Ga0068855_100519779
831 Ga0070664_100170057
832 Ga0070664_101515868
833 Ga0068854_100016218
834 Ga0068856_100018050
835 Ga0068856_100171558
836 Ga0068856_100494856
837 Ga0068856_100502212
838 Ga0068856_100508989
839 Ga0068856_102488141
840 Ga0070702_100021564
841 Ga0068852_100877355
842 Ga0068852_101574254
843 Ga0068859_100044686
844 Ga0068859_100376411
845 Ga0068864_100088910
846 Ga0068864_100493987
847 Ga0068864_100530670
848 Ga0068864_102296817
849 Ga0068866_10016365
850 Ga0068866_10032658
851 Ga0068851_10219816
852 Ga0068851_10224397
853 Ga0068870_10233941
854 Ga0068863_100254812
855 Ga0068863_101446057
856 Ga0068858_100153802
857 Ga0068858_100189228
858 Ga0068860_100282185
859 Ga0068860_100581051
860 Ga0068860_100987160
861 Ga0068862_100210665
862 Ga0068862_100673620
863 Ga0081538_10000837
864 Ga0081538_10001823
865 Ga0081538_10021794
866 Ga0081540_1003675
867 Ga0081540_1022910
868 Ga0070717_10002697
869 Ga0070717_10016728
870 Ga0070717_10041443
871 Ga0070717_10094448
872 Ga0070717_10183033
873 Ga0070717_10277119
874 Ga0070717_10385904
875 Ga0070717_10729112
876 Ga0070717_11209018
877 Ga0070717_11474158
878 Ga0075368_10002918
879 Ga0070715_10002026
880 Ga0070716_100000777
881 Ga0070716_100021426
882 Ga0070716_100154161
883 Ga0070716_101644078
884 Ga0070712_100012590
885 Ga0070712_100075708
886 Ga0070712_101173995
887 Ga0068871_102104275
888 Ga0075433_10015293
889 Ga0075433_10754987
890 Ga0075434_100021315
891 Ga0075434_100138826
892 Ga0075434_100357058
893 Ga0075434_100692308
894 Ga0075429_100406145
895 Ga0068865_100184039
896 Ga0068865_100624504
897 Ga0075436_100315279
898 Ga0097620_100044687
899 Ga0097620_100376422
900 Ga0075435_100016896
901 Ga0075435_100080959
902 Ga0075435_101042118
903 Ga0099794_10070857
904 Ga0105251_10033716
905 Ga0105251_10059114
906 Ga0105240_10297589
907 Ga0105240_10335962
908 Ga0105245_10025942
909 Ga0105245_10232159
910 Ga0105245_10699394
911 Ga0105247_10131637
912 Ga0105247_10393462
913 Ga0105241_10128753
914 Ga0105241_11386048
915 Ga0105242_10089991
916 Ga0105248_10114725
917 Ga0105248_11734247
918 Ga0105237_10370620
919 Ga0105237_10687334
920 Ga0105237_10734094
921 Ga0105237_10874673
922 Ga0105238_10075051
923 Ga0105238_10291927
924 Ga0105249_10003788
925 Ga0105249_10173188
926 Ga0105249_10263283
927 Ga0105249_10526882
928 Ga0105239_10561984
929 Ga0105246_10576610
930 Ga0157335_1010895
931 Ga0157319_1008227
932 Ga0157339_1001551
933 Ga0157315_1007034
934 Ga0157373_10086158
935 Ga0157370_10079865
936 Ga0157369_10020963
937 Ga0157369_10144284
938 Ga0157369_10712222
939 Ga0157369_12386064
940 Ga0157374_10003642
941 Ga0163162_11507495
942 Ga0163162_12491447
943 Ga0157372_10967160
944 Ga0157375_10531536
945 Ga0163163_10054327
946 Ga0163163_10479517
947 Ga0163163_11128943
948 Ga0163163_11351028
949 Ga0157380_10024913
950 Ga0157380_10354636
951 Ga0157380_11382846
952 Ga0182008_10008185
953 Ga0157377_10277339
954 Ga0157377_11402466
955 Ga0157379_10068602
956 Ga0157379_10187164
957 Ga0182007_10003219
958 Ga0163161_10014946
959 Ga0163161_10068086
960 Ga0197907_11055370
961 Ga0206356_10442337
962 Ga0206349_1376759
963 Ga0206354_11098712
964 Ga0206353_10898352
965 Ga0206353_10968064
966 Ga0206353_11955525
967 Ga0213875_10000263
968 Ga0213875_10020474
969 Ga0213875_10109225
970 Ga0213871_10266399
971 Ga0224712_10009701
972 Ga0224712_10416830
973 Ga0224569_109486
974 Ga0224572_1000624
975 Ga0207426_1001153
976 Ga0207426_1007679
977 Ga0207653_10177172
978 Ga0207692_10001046
979 Ga0207692_10065360
980 Ga0207692_10107626
981 Ga0207692_10206121
982 Ga0207692_10228411
983 Ga0207692_10521364
984 Ga0207642_10018205
985 Ga0207688_10046391
986 Ga0207688_10142114
987 Ga0207680_10495970
988 Ga0207647_10019719
989 Ga0207647_10050238
990 Ga0207685_10000566
991 Ga0207685_10022335
992 Ga0207685_10036748
993 Ga0207699_10000615
994 Ga0207699_10034664
995 Ga0207699_10042702
996 Ga0207699_10079294
997 Ga0207699_10365454
998 Ga0207699_10466935
999 Ga0207643_10008428
1000 Ga0207643_10352448
1001 Ga0207705_10483366
1002 Ga0207705_10651934
1003 Ga0207684_10008113
1004 Ga0207684_10040820
1005 Ga0207684_10073883
1006 Ga0207684_10794281
1007 Ga0207654_10273809
1008 Ga0207654_10750681
1009 Ga0207707_10112956
1010 Ga0207695_10210001
1011 Ga0207695_10242397
1012 Ga0207671_10708262
1013 Ga0207671_11574216
1014 Ga0207693_10002572
1015 Ga0207693_10003699
1016 Ga0207693_10015860
1017 Ga0207693_10176681
1018 Ga0207693_10655319
1019 Ga0207663_10049029
1020 Ga0207663_10415390
1021 Ga0207663_10820892
1022 Ga0207663_11317056
1023 Ga0207663_11358024
1024 Ga0207660_10620157
1025 Ga0207662_10000280
1026 Ga0207662_10030102
1027 Ga0207657_10010096
1028 Ga0207657_10149065
1029 Ga0207657_10766838
1030 Ga0207646_10003994
1031 Ga0207646_10026099
1032 Ga0207646_10098825
1033 Ga0207646_10102020
1034 Ga0207646_10490023
1035 Ga0207681_10034823
1036 Ga0207681_10760867
1037 Ga0207687_10047419
1038 Ga0207700_10000583
1039 Ga0207700_10039233
1040 Ga0207700_10188182
1041 Ga0207700_10307891
1042 Ga0207700_10778862
1043 Ga0207700_11186038
1044 Ga0207700_11215304
1045 Ga0207664_10002253
1046 Ga0207664_10017546
1047 Ga0207664_10028349
1048 Ga0207664_10048984
1049 Ga0207664_10178541
1050 Ga0207664_10191553
1051 Ga0207664_10404950
1052 Ga0207664_10813976
1053 Ga0207644_10128817
1054 Ga0207690_10087122
1055 Ga0207706_10095211
1056 Ga0207709_10042386
1057 Ga0207670_10079759
1058 Ga0207704_10280675
1059 Ga0207665_10000019
1060 Ga0207665_10001771
1061 Ga0207665_10008135
1062 Ga0207665_10021484
1063 Ga0207665_10150793
1064 Ga0207665_10221551
1065 Ga0207691_10174546
1066 Ga0207711_10104830
1067 Ga0207711_10339764
1068 Ga0207689_10405636
1069 Ga0207689_11234892
1070 Ga0207661_10018260
1071 Ga0207661_10049848
1072 Ga0207661_10133609
1073 Ga0207679_10341321
1074 Ga0207679_11783044
1075 Ga0207667_10019283
1076 Ga0207667_10388554
1077 Ga0207667_10664074
1078 Ga0207667_11638085
1079 Ga0207651_10080763
1080 Ga0207651_10598721
1081 Ga0207712_10005052
1082 Ga0207712_10263560
1083 Ga0207668_10062438
1084 Ga0207668_11195406
1085 Ga0207640_10014818
1086 Ga0207640_10549976
1087 Ga0207658_11024585
1088 Ga0207703_10232753
1089 Ga0207678_10097265
1090 Ga0207678_10259680
1091 Ga0207678_10469299
1092 Ga0207678_10560100
1093 Ga0207708_10056348
1094 Ga0207702_10011805
1095 Ga0207702_10100285
1096 Ga0207702_10178281
1097 Ga0207702_10209427
1098 Ga0207702_10286463
1099 Ga0207702_10867068
1100 Ga0207641_10615646
1101 Ga0207648_10517164
1102 Ga0207676_10468815
1103 Ga0207674_10575858
1104 Ga0207675_100203273
1105 Ga0207683_10082459
1106 Ga0207683_10427630
1107 Ga0207698_10923955
1108 Ga0209813_10009557
1109 Ga0207428_10472701
1110 Ga0268266_10461269
1111 Ga0268266_10503013
1112 Ga0268265_10057999
1113 Ga0268264_10160901
1114 Ga0268264_10589069
1115 Ga0265336_10005074
1116 Ga0307517_10101722
1117 Ga0265338_10000957
1118 Ga0307512_10008864
1119 Ga0307513_10000354
1120 Ga0307513_10078440
1121 Ga0307513_10241218
1122 Ga0307513_10463776
1123 Ga0307508_10002311
1124 Ga0307406_10308260
1125 Ga0307412_10517076
1126 Ga0307409_101407158
1127 Ga0307416_103043884
1128 Ga0373948_0080630
1129 Ga0373948_0141654
1130 Ga0373959_0083617
1131 Ga0373938_0104944
1132 Ga0373926_0168468
1133 Ga0373928_0028039
1134 Ga0373929_0043674
1135 Ga0373934_0016245
1136 Ga0373940_0116083
1137 Ga0373949_0017940
1138 Ga0373952_0011261
1139 Ga0373923_0211336
1140 Ga0373936_0005930
1141 Ga0373939_0016142
1142 Ga0373939_0155101
1143 Ga0373941_0012386
1144 Ga0373941_0060264
1145 Ga0373941_0502571
1146 Ga0373945_0258970
1147 Ga0373953_0138062
1148 Ga0373954_0025484
1149 Ga0373954_0042592
1150 Ga0373954_0101005
1151 Ga0373957_0164760
1152 Ga0373960_0401972
1153 Ga0373943_0588597
1154 Ga0373943_0726659
1155 Ga0373946_0079045
1156 Ga0373946_0230956
1157 Ga0373955_0070225
1158 Ga0373955_0573534
1159 Ga0373942_0013302
1160 Ga0373942_0015669
1161 Ga0373961_0003283
1162 Ga0373961_0006940
1163 Ga0373931_0048378
1164 Ga0373931_0061399
1165 Ga0373931_0268325
1166 Ga0373931_0504169
1167 Ga0373933_0021056
1168 Ga0373933_0037656
1169 Ga0373933_0222263
1170 Ga0373947_0244747
1171 Ga0373937_0174971
1172 Ga0373937_0816991
1173 Ga0373925_0483860
1174 Ga0373925_0537700
1175 Ga0395900_0045302
1176 Ga0395898_0018702
1177 Ga0436364_0028955
1178 Ga0436364_0065152
1179 Ga0436364_0142449
1180 Ga0436364_0186557
1181 Ga0436364_0275949
1182 Ga0436364_0628387
1183 Ga0436364_1025546
1184 Ga0436360_0123171
1185 Ga0436362_0490277
1186 Ga0436362_1154466
1187 Ga0466969_0021551
1188 Ga0466972_0005436
1189 Ga0466972_0612202
1190 Ga0466965_0274498
1191 Ga0466965_0327851
1192 Ga0466965_0545159
1193 Ga0466966_0079124
1194 Ga0466961_0176815
1195 Ga0466961_0265509
1196 Ga0466963_0044862
1197 Ga0466963_0049849
1198 Ga0466963_0503084
1199 Ga0466963_0886907
1200 Ga0466968_0107028
1201 Ga0466970_0022182
1202 Ga0466970_0103702
1203 Ga0466970_0173082
1204 Ga0466957_0051268
1205 Ga0466957_0316973
1206 Ga0466957_0460398
1207 Ga0466960_0037608
1208 Ga0466960_0374450
1209 Ga0466960_0489642
1210 Ga0466959_0170529
1211 Ga0466958_0015959
1212 Ga0466967_0014735
1213 Ga0466967_0028145
1214 Ga0466967_0043646
1215 Ga0466967_0099534
1216 Ga0466967_0120805
1217 Ga0466967_0141148
1218 Ga0466967_0147549
1219 Ga0466967_0629796
1220 Ga0466967_0740231
1221 Ga0466967_1182412
1222 Ga0495592_0065342
1223 Ga0495592_0091008
1224 Ga0495629_0196694
1225 Ga0495641_0051975
1226 Ga0495641_0431104
1227 Ga0495651_0000950
1228 Ga0495651_0035055
1229 Ga0495653_0019344
1230 Ga0495582_0046973
1231 Ga0495639_0153690
1232 Ga0495664_0058801
1233 Ga0495594_0296064
1234 Ga0495608_0055568
1235 Ga0495608_0066908
1236 Ga0495618_0075066
1237 Ga0495628_0001646
1238 Ga0495628_0197067
1239 Ga0495628_1025752
1240 Ga0495630_0264642
1241 Ga0495652_0018457
1242 Ga0495652_0162225
1243 Ga0495652_0904913
1244 Ga0495665_0013179
1245 Ga0495640_0063902
1246 Ga0495587_0000345
1247 Ga0495587_0140579
1248 Ga0495587_0614699
1249 Ga0495645_0013274
1250 Ga0495645_0747379
1251 Ga0495667_0002768
1252 Ga0495667_0176130
1253 Ga0495667_0450652
1254 Ga0495667_0616095
1255 Ga0495634_0066201
1256 Ga0495634_0290369
1257 Ga0495635_0046670
1258 Ga0495635_0063092
1259 Ga0495588_0275383
1260 Ga0495657_0014811
1261 Ga0495657_0029676
1262 Ga0495599_0000694
1263 Ga0495599_0168454
1264 Ga0495599_0358476
1265 Ga0495623_0032717
1266 Ga0495646_0338697
1267 Ga0495658_0082348
1268 Ga0495613_0061232
1269 Ga0495600_0064073
1270 Ga0495600_0431793
1271 Ga0495674_0226129
1272 Ga0495676_0182010
1273 Ga0495676_0502210
1274 Ga0495676_0815183
1275 Ga0495680_0010838
1276 Ga0495680_0012089
1277 Ga0495675_0014265
1278 Ga0495675_0041046
1279 Ga0495675_0253247
1280 Ga0495684_0014181
1281 Ga0495684_0044076
1282 Ga0495593_0044171
1283 Ga0495602_0046917
1284 Ga0495602_0137433
1285 Ga0495614_0118910
1286 Ga0496100_0042678
1287 Ga0496100_0201280
1288 Ga0496101_0178758
1289 Ga0496102_0039000
1290 Ga0496102_0501068
1291 Ga0496103_0008902
1292 Ga0496103_0421504
1293 Ga0496104_0004394
1294 Ga0496104_0044431
1295 Ga0496104_0170977
1296 Ga0496105_0002559
1297 Ga0496105_0009242
1298 Ga0496105_0069770
1299 Ga0496105_0215297
1300 Ga0496106_0142742
1301 Ga0496106_0615318
1302 Ga0496106_0782904
1303 Ga0496107_0159699
1304 Ga0496108_0004883
1305 Ga0496108_0032095
1306 Ga0496108_0754443
1307 Ga0496109_0005919
1308 Ga0496109_0168899
1309 Ga0496109_0408761
1310 Ga0496109_0793814
1311 Ga0496110_0004829
1312 Ga0496110_0081556
1313 Ga0496110_0305319
1314 Ga0496110_0549332
1315 Ga0496110_0740595
1316 Ga0496111_0018394
1317 Ga0496111_0046577
1318 Ga0496112_0002690
1319 Ga0496112_0041831
1320 Ga0496112_0184189
1321 Ga0496112_0277949
1322 Ga0496112_0483489
1323 Ga0496112_0856184
1324 Ga0496113_0224225
1325 Ga0496113_0326170
1326 Ga0496113_0339598
1327 Ga0496113_0493457
1328 Ga0496114_0934709
1329 Ga0496114_0964417
1330 Ga0496115_0011313
1331 Ga0496115_0042822
1332 Ga0496115_0268734
1333 Ga0496115_0606897
1334 Ga0496115_0739519
1335 Ga0496126_0525886
1336 Ga0501032_1016403
1337 Ga0501038_0626697
1338 Ga0501040_0936505
1339 Ga0501042_0090166
1340 Ga0501042_0516111
1341 Ga0501042_0636242
1342 Ga0501042_0998973
1343 Ga0501071_0347373
1344 Ga0501072_0141433
1345 Ga0501075_0295493
1346 Ga0501076_0094452
1347 Ga0501076_0477456
1348 Ga0501076_0691043
1349 Ga0501081_0485985
1350 Ga0501045_0775788
1351 nmdc:mga06z11_15715_c1
1352 nmdc:mga04h51_12136_c1
1353 nmdc:mga09592_486545_c1
1354 nmdc:mga08y16_1161290_c1
1355 nmdc:mga0n895_159189_c1
1356 nmdc:mga0n895_1884465_c1
1357 nmdc:mga0n895_269417_c1
1358 nmdc:mga0n895_64694_c1
1359 nmdc:mga0n895_80991_c1
1360 nmdc:mga0rr50_10305_c1
1361 nmdc:mga0rr50_109237_c1
1362 nmdc:mga0rr50_618489_c1
1363 nmdc:mga08x19_303036_c1
1364 nmdc:mga0a205_234680_c1
1365 nmdc:mga0a205_5537_c1
1366 Ga0495601_0054438
1367 Ga0495612_0049380
1368 Ga0495595_0003303
1369 Ga0495619_0078661
1370 Ga0587073_0212185
1371 Ga0501082_0710119
1372 Ga0530510_0084326
1373 Ga0530510_0351715
1374 2644013917
1375 2686537893
1376 2808915146
1377 2856744756
1378 2867372705
1379 2867480362
1380 2891328596
1381 2891399733
1382 2891557459
1383 2891564039
1384 2895888185
1385 2995465386
1386 8055177670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

144

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8217 16 136
4n04-assembly1.cif.gz_A the crystal structure of glyoxalase / bleomycin resistance protein from catenulispora acidiphila dsm 44928 0.819 16 137
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8106 20 136
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.7995 15 142
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7968 16 136
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9492 85 136 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9231 85 134 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8701 85 136 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8551 85 134 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8461 86 142 3.30.720.110
ID Description Score Start End GO Terms
AF-X8DGJ8-F1-model_v4 Glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein 0.9423 17 142 GO:0051213
AF-A0A848ARP0-F1-model_v4 deleted 0.9372 17 140
AF-A0A4V1F5T4-F1-model_v4 Glyoxalase 0.9344 15 140
AF-A0A1X6XNR5-F1-model_v4 VOC domain-containing protein 0.9314 11 142
AF-A0A848ARP0-F1-model_v4 deleted 0.9298 17 140

Map