F475589

General Info

Members Datasets Scaffolds Average Seq Length
692 367 1384 199

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10071326|Ga0307516_100713264
Length 234
Sequence MPVRVKKTRQNKKIEPRSDSIGTEKGSTGIFALPTSLPNQAAISGEGAPETRYAYKASLIGSAHQFELTDAGLKWKVASRSGVWAYTDIAAIRLSYRPSSMQSRRFRADINSKGGYRIAVLSTTWQTVSLMAPQDHGYRAFITELHRRMAQAGSKAALISGIGPKIYAAALATVAFLAISMAALLVRALWIGEWYGALFLVGFAALFTWQIGGFIRRNRPRTYDFEHLPEALLP

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
308 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
318 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
319 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
320 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
321 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
322 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
323 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
324 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
328 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
329 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
330 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
333 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
334 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
335 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
336 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
339 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
340 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
341 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
344 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
345 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
346 2791355199
347 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
348 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
349 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
350 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
351 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
352 2906610324
353 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
354 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
355 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
356 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
357 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
358 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
359 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
360 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
361 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
362 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
363 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
364 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
365 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
366 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
367 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 2.89
Rhizoplane 7.37
Rhizosphere 72.4
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10071326 3300031730 Bacteria 3335
2 LJQas_1001531 3300000549 Bacteria 3437
3 JGI25406J46586_10000048 3300003203 Bacteria 54715
4 rootH2_10075964 3300003320 Bacteria 1056
5 rootL2_10013826 3300003322 Bacteria 1788
6 rootL2_10175474 3300003322 Bacteria 1230
7 rootH1_10149053 3300003323 Bacteria 1130
8 rootH1_10150008 3300003323 Bacteria 1989
9 rootH1_10197061 3300003323 Bacteria 2311
10 JGI25404J52841_10015159 3300003659 Bacteria 1673
11 JGI25404J52841_10024992 3300003659 Bacteria 1286
12 JGI25404J52841_10041970 3300003659 Bacteria 968
13 JGI25404J52841_10042673 3300003659 Bacteria 959
14 JGI25404J52841_10052549 3300003659 Bacteria 856
15 JGI25405J52794_10004588 3300003911 Bacteria 2466
16 Ga0070658_10109269 3300005327 Bacteria 2289
17 Ga0070683_100098165 3300005329 Bacteria 2756
18 Ga0070683_100214251 3300005329 Bacteria 1830
19 Ga0070683_100584060 3300005329 Bacteria 1069
20 Ga0070670_100275397 3300005331 Bacteria 1469
21 Ga0068869_100649287 3300005334 Bacteria 895
22 Ga0070680_100013974 3300005336 Bacteria 6267
23 Ga0070680_100031151 3300005336 Bacteria 4287
24 Ga0070680_100292196 3300005336 Bacteria 1381
25 Ga0070682_100016175 3300005337 Bacteria 4335
26 Ga0070682_100138418 3300005337 Bacteria 1656
27 Ga0068868_100139652 3300005338 Bacteria 1988
28 Ga0068868_100785902 3300005338 Bacteria 858
29 Ga0070660_100008957 3300005339 Bacteria 7021
30 Ga0070689_100066530 3300005340 Bacteria 2808
31 Ga0070689_100210268 3300005340 Bacteria 1592
32 Ga0070689_100434825 3300005340 Bacteria 1114
33 Ga0070689_101076026 3300005340 Bacteria 718
34 Ga0070691_10192004 3300005341 Bacteria 1069
35 Ga0070661_100703534 3300005344 Bacteria 823
36 Ga0070671_100166681 3300005355 Bacteria 1863
37 Ga0070688_100325084 3300005365 Bacteria 1119
38 Ga0070659_100037727 3300005366 Bacteria 3768
39 Ga0070709_10020313 3300005434 Bacteria 3852
40 Ga0070709_10024397 3300005434 Bacteria 3559
41 Ga0070709_10169626 3300005434 Bacteria 1524
42 Ga0070714_100044789 3300005435 Bacteria 3747
43 Ga0070714_100712165 3300005435 Bacteria 969
44 Ga0070713_100099259 3300005436 Bacteria 2519
45 Ga0070713_100445026 3300005436 Bacteria 1216
46 Ga0070710_10005979 3300005437 Bacteria 5813
47 Ga0070711_100049525 3300005439 Bacteria 2877
48 Ga0070711_100070465 3300005439 Bacteria 2461
49 Ga0070711_100129890 3300005439 Bacteria 1875
50 Ga0070711_100421136 3300005439 Bacteria 1088
51 Ga0070694_100286428 3300005444 Bacteria 1258
52 Ga0070708_100496778 3300005445 Bacteria 1151
53 Ga0070708_100848921 3300005445 Bacteria 858
54 Ga0070663_100012536 3300005455 Bacteria 5367
55 Ga0070663_100021718 3300005455 Bacteria 4275
56 Ga0070663_100488918 3300005455 Bacteria 1020
57 Ga0070678_100173574 3300005456 Bacteria 1758
58 Ga0070678_100207413 3300005456 Bacteria 1621
59 Ga0070681_10056560 3300005458 Bacteria 3904
60 Ga0070681_10066683 3300005458 Bacteria 3568
61 Ga0070706_100136049 3300005467 Bacteria 2294
62 Ga0070706_100849928 3300005467 Bacteria 844
63 Ga0070707_100052622 3300005468 Bacteria 3904
64 Ga0070679_100033322 3300005530 Bacteria 5100
65 Ga0070679_100068160 3300005530 Bacteria 3549
66 Ga0070679_100487944 3300005530 Bacteria 1176
67 Ga0070684_100010386 3300005535 Bacteria 7372
68 Ga0070684_100053064 3300005535 Bacteria 3527
69 Ga0070684_100174583 3300005535 Bacteria 1952
70 Ga0070684_100362442 3300005535 Bacteria 1334
71 Ga0070697_100103336 3300005536 Bacteria 2368
72 Ga0068853_100122530 3300005539 Bacteria 2321
73 Ga0068853_100734838 3300005539 Bacteria 943
74 Ga0070672_100231083 3300005543 Bacteria 1554
75 Ga0070672_100646508 3300005543 Bacteria 923
76 Ga0070686_100187557 3300005544 Bacteria 1474
77 Ga0070696_100499312 3300005546 Bacteria 968
78 Ga0070693_100036267 3300005547 Bacteria 2740
79 Ga0070693_100598294 3300005547 Bacteria 796
80 Ga0070665_100003902 3300005548 Bacteria 15759
81 Ga0070665_100052067 3300005548 Bacteria 4107
82 Ga0068855_100104631 3300005563 Bacteria 3255
83 Ga0068855_100110751 3300005563 Bacteria 3151
84 Ga0068855_100366330 3300005563 Bacteria 1585
85 Ga0070664_100196383 3300005564 Bacteria 1799
86 Ga0068857_100020850 3300005577 Bacteria 5765
87 Ga0068857_100037942 3300005577 Bacteria 4268
88 Ga0068854_100006800 3300005578 Bacteria 7290
89 Ga0068854_100974412 3300005578 Unclassified 749
90 Ga0068856_100028283 3300005614 Bacteria 5473
91 Ga0068856_100228635 3300005614 Bacteria 1875
92 Ga0068856_100707078 3300005614 Bacteria 1028
93 Ga0068852_100005807 3300005616 Bacteria 8861
94 Ga0068852_100077758 3300005616 Bacteria 2934
95 Ga0068864_100051879 3300005618 Bacteria 3534
96 Ga0068861_100324688 3300005719 Bacteria 1341
97 Ga0068851_10009198 3300005834 Bacteria 4587
98 Ga0068851_10054098 3300005834 Bacteria 2044
99 Ga0068851_10379403 3300005834 Bacteria 828
100 Ga0068863_100550961 3300005841 Bacteria 1139
101 Ga0068858_100217788 3300005842 Bacteria 1808
102 Ga0068858_100458112 3300005842 Bacteria 1229
103 Ga0068858_100563925 3300005842 Bacteria 1103
104 Ga0068860_100000562 3300005843 Bacteria 44958
105 Ga0068860_100598796 3300005843 Bacteria 1107
106 Ga0081455_10005695 3300005937 Bacteria 13591
107 Ga0081455_10007071 3300005937 Bacteria 11912
108 Ga0081455_10014883 3300005937 Bacteria 7585
109 Ga0081455_10047588 3300005937 Bacteria 3713
110 Ga0081540_1001350 3300005983 Bacteria 21352
111 Ga0081540_1001946 3300005983 Bacteria 17280
112 Ga0081540_1008381 3300005983 Bacteria 7224
113 Ga0081540_1010252 3300005983 Bacteria 6364
114 Ga0081540_1016474 3300005983 Bacteria 4622
115 Ga0081540_1017647 3300005983 Bacteria 4409
116 Ga0081540_1020646 3300005983 Bacteria 3953
117 Ga0081540_1060868 3300005983 Bacteria 1803
118 Ga0081539_10000008 3300005985 Bacteria 525071
119 Ga0081539_10013254 3300005985 Bacteria 6229
120 Ga0070717_10174850 3300006028 Bacteria 1869
121 Ga0070717_10466190 3300006028 Bacteria 1140
122 Ga0075365_10063555 3300006038 Bacteria 2472
123 Ga0075365_10312835 3300006038 Bacteria 1106
124 Ga0075363_100038017 3300006048 Bacteria 2529
125 Ga0075364_10199431 3300006051 Bacteria 1356
126 Ga0070715_10169159 3300006163 Bacteria 1087
127 Ga0070716_100082154 3300006173 Bacteria 1926
128 Ga0070716_100191638 3300006173 Bacteria 1351
129 Ga0070716_100220389 3300006173 Bacteria 1274
130 Ga0070712_100087849 3300006175 Bacteria 2269
131 Ga0070712_100337933 3300006175 Bacteria 1229
132 Ga0070712_100571920 3300006175 Bacteria 954
133 Ga0070712_100688567 3300006175 Bacteria 871
134 Ga0075362_10035523 3300006177 Bacteria 2176
135 Ga0075367_10004912 3300006178 Bacteria 6587
136 Ga0075367_10050278 3300006178 Bacteria 2460
137 Ga0075367_10240050 3300006178 Bacteria 1135
138 Ga0075369_10013072 3300006186 Bacteria 3287
139 Ga0075369_10187632 3300006186 Bacteria 952
140 Ga0097621_100121568 3300006237 Bacteria 2215
141 Ga0097621_100662890 3300006237 Bacteria 958
142 Ga0097621_101242999 3300006237 Unclassified 702
143 Ga0075370_10063022 3300006353 Bacteria 2113
144 Ga0068871_100376814 3300006358 Bacteria 1260
145 Ga0068871_100495016 3300006358 Bacteria 1101
146 Ga0068871_100639132 3300006358 Bacteria 971
147 Ga0075428_100049853 3300006844 Bacteria 4593
148 Ga0068865_100110906 3300006881 Bacteria 2024
149 Ga0075435_100341060 3300007076 Bacteria 1284
150 Ga0099794_10047456 3300007265 Bacteria 2059
151 Ga0099794_10075066 3300007265 Bacteria 1661
152 Ga0099794_10126601 3300007265 Bacteria 1288
153 Ga0099795_10154122 3300007788 Bacteria 943
154 Ga0105240_10007748 3300009093 Bacteria 15534
155 Ga0105240_10021481 3300009093 Bacteria 8584
156 Ga0105240_10102768 3300009093 Bacteria 3473
157 Ga0111539_10831151 3300009094 Bacteria 1075
158 Ga0105245_10030173 3300009098 Bacteria 4793
159 Ga0105245_10449407 3300009098 Bacteria 1297
160 Ga0105245_10888150 3300009098 Bacteria 932
161 Ga0105247_10065844 3300009101 Bacteria 2254
162 Ga0105247_10370493 3300009101 Bacteria 1012
163 Ga0114129_10096453 3300009147 Bacteria 4094
164 Ga0105243_10580672 3300009148 Bacteria 1076
165 Ga0105241_10051574 3300009174 Bacteria 3138
166 Ga0105241_10124334 3300009174 Bacteria 2081
167 Ga0105242_10091999 3300009176 Bacteria 2555
168 Ga0105248_10039371 3300009177 Bacteria 5293
169 Ga0105248_11295540 3300009177 Bacteria 824
170 Ga0105237_10011809 3300009545 Bacteria 9237
171 Ga0105237_10018673 3300009545 Bacteria 7169
172 Ga0105237_10019047 3300009545 Bacteria 7095
173 Ga0105237_10173836 3300009545 Bacteria 2154
174 Ga0105237_10550135 3300009545 Bacteria 1161
175 Ga0105238_10035982 3300009551 Bacteria 5033
176 Ga0105238_10101590 3300009551 Bacteria 2858
177 Ga0105249_10151268 3300009553 Bacteria 2235
178 Ga0105249_11296197 3300009553 Bacteria 800
179 Ga0105249_11487064 3300009553 Bacteria 749
180 Ga0099796_10071132 3300010159 Bacteria 1256
181 Ga0099796_10100148 3300010159 Bacteria 1089
182 Ga0105239_10075005 3300010375 Bacteria 3719
183 Ga0105239_10359448 3300010375 Bacteria 1644
184 Ga0105239_10757175 3300010375 Bacteria 1112
185 Ga0105239_10995895 3300010375 Bacteria 963
186 Ga0105239_11106427 3300010375 Bacteria 912
187 Ga0105239_11479981 3300010375 Bacteria 784
188 Ga0105246_10072778 3300011119 Bacteria 2424
189 Ga0105246_10082476 3300011119 Bacteria 2295
190 Ga0105246_10160360 3300011119 Bacteria 1713
191 Ga0105246_10339184 3300011119 Bacteria 1228
192 Ga0105246_11123337 3300011119 Bacteria 719
193 Ga0157370_10111111 3300013104 Bacteria 2562
194 Ga0157369_10008116 3300013105 Bacteria 12033
195 Ga0157369_10275483 3300013105 Bacteria 1753
196 Ga0157369_10894232 3300013105 Bacteria 911
197 Ga0157374_10024358 3300013296 Bacteria 5426
198 Ga0157378_10005382 3300013297 Bacteria 11224
199 Ga0157378_11097996 3300013297 Bacteria 832
200 Ga0163162_10010007 3300013306 Bacteria 9221
201 Ga0163162_10719437 3300013306 Bacteria 1119
202 Ga0157372_10196810 3300013307 Bacteria 2334
203 Ga0157372_11482011 3300013307 Bacteria 782
204 Ga0157375_10144973 3300013308 Bacteria 2505
205 Ga0157375_10145814 3300013308 Bacteria 2498
206 Ga0157375_10383279 3300013308 Bacteria 1572
207 Ga0157375_10805568 3300013308 Bacteria 1088
208 Ga0163163_10075022 3300014325 Bacteria 3375
209 Ga0163163_10214013 3300014325 Bacteria 1976
210 Ga0157380_10107406 3300014326 Bacteria 2337
211 Ga0157380_10524484 3300014326 Bacteria 1156
212 Ga0157379_10144400 3300014968 Bacteria 2146
213 Ga0157376_10398594 3300014969 Bacteria 1330
214 Ga0157376_10448341 3300014969 Bacteria 1258
215 Ga0157376_10959085 3300014969 Bacteria 876
216 Ga0209233_1008613 3300025261 Bacteria 3144
217 Ga0209758_1004175 3300025297 Bacteria 12277
218 Ga0207697_10147940 3300025315 Bacteria 1021
219 Ga0207656_10083083 3300025321 Bacteria 1443
220 Ga0207710_10002003 3300025900 Bacteria 9708
221 Ga0207710_10064986 3300025900 Bacteria 1662
222 Ga0207688_10103732 3300025901 Bacteria 1645
223 Ga0207688_10284879 3300025901 Bacteria 1007
224 Ga0207680_10281957 3300025903 Bacteria 1154
225 Ga0207699_10038515 3300025906 Bacteria 2741
226 Ga0207699_10151082 3300025906 Bacteria 1537
227 Ga0207699_10191343 3300025906 Bacteria 1381
228 Ga0207705_10229841 3300025909 Bacteria 1411
229 Ga0207684_10150993 3300025910 Bacteria 1999
230 Ga0207684_10525121 3300025910 Bacteria 1014
231 Ga0207654_10002142 3300025911 Bacteria 10111
232 Ga0207707_10063356 3300025912 Bacteria 3218
233 Ga0207707_10072218 3300025912 Bacteria 3008
234 Ga0207707_10096526 3300025912 Bacteria 2583
235 Ga0207707_10372389 3300025912 Bacteria 1229
236 Ga0207695_10015064 3300025913 Bacteria 9121
237 Ga0207695_10056580 3300025913 Bacteria 4080
238 Ga0207695_10140063 3300025913 Bacteria 2368
239 Ga0207695_10194416 3300025913 Bacteria 1945
240 Ga0207671_10008930 3300025914 Bacteria 8436
241 Ga0207671_10027741 3300025914 Bacteria 4233
242 Ga0207671_10096883 3300025914 Bacteria 2230
243 Ga0207693_10008272 3300025915 Bacteria 8518
244 Ga0207693_10026499 3300025915 Bacteria 4588
245 Ga0207693_10029295 3300025915 Bacteria 4350
246 Ga0207693_10086641 3300025915 Bacteria 2454
247 Ga0207693_10296532 3300025915 Bacteria 1267
248 Ga0207663_10004056 3300025916 Bacteria 7261
249 Ga0207663_10163195 3300025916 Bacteria 1575
250 Ga0207663_10198018 3300025916 Bacteria 1447
251 Ga0207663_10478114 3300025916 Bacteria 965
252 Ga0207660_10575380 3300025917 Bacteria 917
253 Ga0207662_10030365 3300025918 Bacteria 3135
254 Ga0207657_10034539 3300025919 Bacteria 4545
255 Ga0207649_10123381 3300025920 Bacteria 1749
256 Ga0207652_10056918 3300025921 Bacteria 3366
257 Ga0207652_10348183 3300025921 Bacteria 1337
258 Ga0207646_10162278 3300025922 Bacteria 2017
259 Ga0207694_10000275 3300025924 Bacteria 48774
260 Ga0207694_10094910 3300025924 Bacteria 2357
261 Ga0207694_10461012 3300025924 Bacteria 1062
262 Ga0207694_10732450 3300025924 Bacteria 834
263 Ga0207694_11119578 3300025924 Bacteria 666
264 Ga0207650_10506203 3300025925 Bacteria 1009
265 Ga0207687_10570938 3300025927 Bacteria 951
266 Ga0207700_10081179 3300025928 Bacteria 2531
267 Ga0207664_10313497 3300025929 Bacteria 1383
268 Ga0207690_10148116 3300025932 Bacteria 1737
269 Ga0207706_10279411 3300025933 Bacteria 1456
270 Ga0207670_10337761 3300025936 Bacteria 1190
271 Ga0207669_10733891 3300025937 Bacteria 814
272 Ga0207704_10155361 3300025938 Bacteria 1621
273 Ga0207704_10610992 3300025938 Bacteria 894
274 Ga0207665_10030462 3300025939 Bacteria 3566
275 Ga0207665_10214382 3300025939 Bacteria 1408
276 Ga0207665_10233856 3300025939 Bacteria 1352
277 Ga0207691_10186321 3300025940 Bacteria 1812
278 Ga0207691_10224262 3300025940 Bacteria 1629
279 Ga0207689_10262133 3300025942 Bacteria 1430
280 Ga0207661_10070614 3300025944 Bacteria 2851
281 Ga0207661_10385461 3300025944 Bacteria 1269
282 Ga0207679_10170407 3300025945 Bacteria 1792
283 Ga0207667_10061756 3300025949 Bacteria 3920
284 Ga0207667_10116818 3300025949 Bacteria 2749
285 Ga0207667_10174058 3300025949 Bacteria 2212
286 Ga0207712_10810089 3300025961 Bacteria 824
287 Ga0207668_10268013 3300025972 Bacteria 1395
288 Ga0207677_10045839 3300026023 Bacteria 2922
289 Ga0207703_10104137 3300026035 Bacteria 2410
290 Ga0207703_10262546 3300026035 Bacteria 1561
291 Ga0207703_10936934 3300026035 Bacteria 830
292 Ga0207639_10101768 3300026041 Bacteria 2324
293 Ga0207639_10111945 3300026041 Bacteria 2226
294 Ga0207639_10576414 3300026041 Bacteria 1035
295 Ga0207678_10026294 3300026067 Bacteria 5077
296 Ga0207678_10035372 3300026067 Bacteria 4349
297 Ga0207678_10236463 3300026067 Bacteria 1564
298 Ga0207702_10000026 3300026078 Bacteria 186067
299 Ga0207702_10206127 3300026078 Bacteria 1825
300 Ga0207702_10309759 3300026078 Bacteria 1501
301 Ga0207641_10090048 3300026088 Bacteria 2682
302 Ga0207648_10580105 3300026089 Bacteria 1032
303 Ga0207676_10284150 3300026095 Bacteria 1504
304 Ga0207676_10946119 3300026095 Bacteria 847
305 Ga0207674_10010326 3300026116 Bacteria 10586
306 Ga0207674_10028112 3300026116 Bacteria 5939
307 Ga0207674_10110906 3300026116 Bacteria 2718
308 Ga0207674_10237867 3300026116 Bacteria 1768
309 Ga0207675_100157599 3300026118 Bacteria 2164
310 Ga0207683_10014699 3300026121 Bacteria 6666
311 Ga0207683_10656955 3300026121 Bacteria 971
312 Ga0207698_10068099 3300026142 Bacteria 2810
313 Ga0207698_11031570 3300026142 Bacteria 834
314 Ga0209179_1017533 3300027512 Bacteria 1358
315 Ga0268266_10471753 3300028379 Bacteria 1195
316 Ga0268266_10754361 3300028379 Bacteria 939
317 Ga0268265_10420902 3300028380 Bacteria 1240
318 Ga0268264_10000096 3300028381 Bacteria 230188
319 Ga0307517_10002514 3300028786 Bacteria 29301
320 Ga0307515_10028335 3300028794 Bacteria 9521
321 Ga0307511_10024706 3300030521 Bacteria 5558
322 Ga0265330_10009931 3300031235 Bacteria 4504
323 Ga0265330_10022202 3300031235 Bacteria 2890
324 Ga0265340_10001950 3300031247 Bacteria 11797
325 Ga0265339_10005018 3300031249 Bacteria 8901
326 Ga0265331_10066411 3300031250 Bacteria 1694
327 Ga0307513_10211149 3300031456 Bacteria 1772
328 Ga0307509_10071728 3300031507 Bacteria 3611
329 Ga0307509_10182300 3300031507 Bacteria 1962
330 Ga0307508_10001617 3300031616 Bacteria 25159
331 Ga0307508_10158699 3300031616 Bacteria 1865
332 Ga0307508_10181974 3300031616 Bacteria 1704
333 Ga0265314_10024825 3300031711 Bacteria 4535
334 Ga0265314_10268339 3300031711 Bacteria 971
335 Ga0265342_10031302 3300031712 Bacteria 3291
336 Ga0307516_10267220 3300031730 Bacteria 1398
337 Ga0307406_10842159 3300031901 Bacteria 777
338 Ga0307416_100425345 3300032002 Bacteria 1374
339 Ga0307411_10315081 3300032005 Bacteria 1261
340 Ga0307507_10291145 3300033179 Bacteria 1010
341 Ga0307510_10059632 3300033180 Bacteria 3937
342 Ga0315911_1000011 3300033442 Bacteria 264678
343 Ga0373926_0110390 3300035083 Bacteria 1033
344 Ga0373940_0029194 3300035088 Bacteria 1460
345 Ga0373923_0075945 3300035111 Bacteria 1450
346 Ga0373945_0019684 3300035116 Bacteria 2306
347 Ga0373945_0227994 3300035116 Bacteria 781
348 Ga0373954_0085680 3300035118 Bacteria 1509
349 Ga0373954_0087747 3300035118 Bacteria 1491
350 Ga0373954_0224803 3300035118 Bacteria 923
351 Ga0373956_0135308 3300035119 Bacteria 1156
352 Ga0373943_0030362 3300035170 Bacteria 2557
353 Ga0373943_0141035 3300035170 Bacteria 1298
354 Ga0373943_0210514 3300035170 Bacteria 1079
355 Ga0373946_0058738 3300035171 Bacteria 1630
356 Ga0373946_0105047 3300035171 Bacteria 1271
357 Ga0373955_0194817 3300035172 Bacteria 1206
358 Ga0373942_0119676 3300035207 Unclassified 822
359 Ga0373924_0010277 3300035410 Bacteria 3445
360 Ga0373935_0005783 3300035692 Bacteria 7314
361 Ga0373927_0002398 3300035695 Bacteria 13655
362 Ga0373927_0007028 3300035695 Bacteria 7639
363 Ga0373927_0038326 3300035695 Bacteria 3112
364 Ga0373927_0051998 3300035695 Bacteria 2650
365 Ga0373927_0098608 3300035695 Bacteria 1900
366 Ga0373927_0226529 3300035695 Bacteria 1228
367 Ga0373927_0648632 3300035695 Bacteria 698
368 Ga0373933_0000159 3300035724 Bacteria 43953
369 Ga0373933_0041620 3300035724 Bacteria 2713
370 Ga0373933_0082661 3300035724 Bacteria 1971
371 Ga0373947_0017830 3300035725 Bacteria 4085
372 Ga0373947_0019775 3300035725 Bacteria 3885
373 Ga0373947_0415912 3300035725 Bacteria 908
374 Ga0373937_0715595 3300036401 Bacteria 948
375 Ga0373937_0726429 3300036401 Bacteria 940
376 Ga0373925_0210872 3300037068 Bacteria 1547
377 Ga0373925_0349745 3300037068 Bacteria 1200
378 Ga0373925_0581052 3300037068 Bacteria 922
379 Ga0395905_0824569 3300037471 Bacteria 830
380 Ga0436360_0275470 3300039438 Bacteria 7453
381 Ga0451789_0571772 3300041443 Bacteria 1008
382 Ga0451793_0618517 3300041452 Bacteria 754
383 Ga0451833_0630604 3300041491 Bacteria 775
384 Ga0466969_0341441 3300044656 Bacteria 678
385 Ga0466959_0029226 3300045049 Bacteria 4084
386 Ga0466967_0248725 3300045976 Bacteria 1698
387 Ga0466967_0589826 3300045976 Bacteria 1096
388 Ga0495592_0066154 3300046454 Bacteria 2645
389 Ga0495592_0134098 3300046454 Bacteria 1729
390 Ga0495592_0184630 3300046454 Bacteria 1418
391 Ga0495603_0006144 3300046455 Bacteria 7180
392 Ga0495603_0058315 3300046455 Bacteria 2283
393 Ga0495603_0064542 3300046455 Bacteria 2159
394 Ga0495603_0066543 3300046455 Bacteria 2122
395 Ga0495603_0067125 3300046455 Bacteria 2112
396 Ga0495590_0205089 3300046457 Bacteria 725
397 Ga0495629_0004438 3300046459 Bacteria 10512
398 Ga0495629_0037648 3300046459 Bacteria 3409
399 Ga0495629_0040163 3300046459 Bacteria 3292
400 Ga0495638_0067421 3300046460 Bacteria 2197
401 Ga0495638_0068557 3300046460 Bacteria 2175
402 Ga0495641_0048676 3300046461 Bacteria 1943
403 Ga0495651_0213351 3300046462 Bacteria 1341
404 Ga0495651_0237440 3300046462 Bacteria 1252
405 Ga0495653_0155239 3300046463 Bacteria 1595
406 Ga0495580_0563607 3300046472 Bacteria 755
407 Ga0495582_0017022 3300046473 Bacteria 3980
408 Ga0495582_0327700 3300046473 Unclassified 881
409 Ga0495582_0332631 3300046473 Bacteria 874
410 Ga0495582_0361850 3300046473 Bacteria 836
411 Ga0495605_0115659 3300046474 Bacteria 1220
412 Ga0495639_0004720 3300046475 Bacteria 5860
413 Ga0495639_0044950 3300046475 Bacteria 1998
414 Ga0495662_0144687 3300046476 Bacteria 1170
415 Ga0495662_0190001 3300046476 Bacteria 1013
416 Ga0495664_0016827 3300046477 Bacteria 4174
417 Ga0495664_0061536 3300046477 Bacteria 2235
418 Ga0495664_0121002 3300046477 Bacteria 1583
419 Ga0495584_0078777 3300046491 Bacteria 1658
420 Ga0495584_0289942 3300046491 Bacteria 831
421 Ga0495585_0301500 3300046492 Bacteria 787
422 Ga0495594_0092145 3300046499 Bacteria 1699
423 Ga0495596_0132750 3300046500 Bacteria 966
424 Ga0495606_0286854 3300046507 Bacteria 897
425 Ga0495628_0087330 3300046516 Bacteria 2418
426 Ga0495628_0104533 3300046516 Bacteria 2182
427 Ga0495630_0200553 3300046517 Bacteria 1522
428 Ga0495630_0320125 3300046517 Bacteria 1186
429 Ga0495632_0091816 3300046519 Bacteria 1439
430 Ga0495637_0029649 3300046520 Bacteria 2434
431 Ga0495648_0018888 3300046524 Bacteria 4863
432 Ga0495648_0162822 3300046524 Bacteria 1151
433 Ga0495666_0043788 3300046526 Bacteria 2162
434 Ga0495652_0072807 3300046529 Bacteria 2863
435 Ga0495652_0329164 3300046529 Bacteria 1101
436 Ga0495665_0020550 3300046531 Bacteria 3545
437 Ga0495665_0028027 3300046531 Bacteria 3022
438 Ga0495665_0147289 3300046531 Bacteria 1230
439 Ga0495640_0016742 3300046533 Bacteria 5480
440 Ga0495640_0033701 3300046533 Bacteria 3637
441 Ga0495640_0320370 3300046533 Bacteria 960
442 Ga0495587_0097317 3300046536 Bacteria 1697
443 Ga0495598_0008819 3300046537 Bacteria 2361
444 Ga0495598_0025241 3300046537 Bacteria 1619
445 Ga0495621_0127685 3300046539 Bacteria 987
446 Ga0495597_0172332 3300046542 Bacteria 878
447 Ga0495645_0013460 3300046543 Bacteria 5784
448 Ga0495645_0158944 3300046543 Bacteria 1564
449 Ga0495645_0185219 3300046543 Bacteria 1423
450 Ga0495645_0214665 3300046543 Bacteria 1297
451 Ga0495622_0228666 3300046557 Bacteria 822
452 Ga0495633_0062257 3300046558 Bacteria 1747
453 Ga0495633_0075712 3300046558 Bacteria 1567
454 Ga0495634_0045197 3300046642 Bacteria 2978
455 Ga0495634_0050883 3300046642 Bacteria 2780
456 Ga0495625_0211414 3300046660 Bacteria 1275
457 Ga0495625_0369670 3300046660 Bacteria 902
458 Ga0495588_0097522 3300046674 Bacteria 1543
459 Ga0495588_0111645 3300046674 Bacteria 1440
460 Ga0495657_0110775 3300046675 Bacteria 1739
461 Ga0495657_0263112 3300046675 Bacteria 1036
462 Ga0495657_0334744 3300046675 Bacteria 898
463 Ga0495599_0072029 3300046678 Bacteria 2157
464 Ga0495599_0137925 3300046678 Bacteria 1513
465 Ga0495599_0244702 3300046678 Bacteria 1093
466 Ga0495599_0281594 3300046678 Bacteria 1007
467 Ga0495623_0047788 3300046679 Bacteria 2716
468 Ga0495646_0011556 3300046680 Bacteria 5607
469 Ga0495646_0384016 3300046680 Bacteria 732
470 Ga0495647_0029876 3300046681 Bacteria 2018
471 Ga0495647_0052442 3300046681 Bacteria 1588
472 Ga0495658_0036459 3300046683 Bacteria 2713
473 Ga0495658_0072295 3300046683 Bacteria 2006
474 Ga0495658_0275237 3300046683 Bacteria 1061
475 Ga0495669_0192351 3300046684 Bacteria 974
476 Ga0495613_0068590 3300046689 Bacteria 2586
477 Ga0495613_0105081 3300046689 Bacteria 2039
478 Ga0495613_0240115 3300046689 Bacteria 1267
479 Ga0495624_0005689 3300046690 Bacteria 8948
480 Ga0495624_0032842 3300046690 Bacteria 3363
481 Ga0495671_0112470 3300046692 Bacteria 1330
482 Ga0495649_0237322 3300046694 Bacteria 939
483 Ga0495589_0114469 3300046794 Bacteria 1301
484 Ga0495600_0034273 3300046809 Bacteria 3295
485 Ga0495600_0169500 3300046809 Bacteria 1409
486 Ga0495581_0005564 3300047315 Bacteria 7300
487 Ga0495581_0043249 3300047315 Bacteria 2605
488 Ga0495581_0111072 3300047315 Bacteria 1594
489 Ga0495604_0048194 3300047317 Bacteria 3315
490 Ga0495604_0231530 3300047317 Bacteria 1267
491 Ga0495604_0249460 3300047317 Bacteria 1210
492 Ga0495674_0224605 3300047319 Bacteria 1551
493 Ga0495674_0335362 3300047319 Bacteria 1229
494 Ga0495674_0345729 3300047319 Bacteria 1208
495 Ga0495674_0486560 3300047319 Bacteria 988
496 Ga0495672_0021660 3300047320 Bacteria 4189
497 Ga0495672_0035700 3300047320 Bacteria 3060
498 Ga0495676_0222972 3300047321 Bacteria 1298
499 Ga0495676_0269854 3300047321 Bacteria 1155
500 Ga0495680_0043560 3300047322 Bacteria 3552
501 Ga0495675_0222389 3300047444 Bacteria 1142
502 Ga0495677_0157956 3300047445 Bacteria 874
503 Ga0495673_0044336 3300047469 Bacteria 1984
504 Ga0495673_0175849 3300047469 Bacteria 813
505 Ga0495684_0029095 3300047471 Bacteria 4240
506 Ga0495684_0244968 3300047471 Bacteria 1306
507 Ga0495686_0017653 3300047472 Bacteria 4802
508 Ga0495686_0103400 3300047472 Bacteria 1716
509 Ga0495686_0142925 3300047472 Bacteria 1411
510 Ga0495593_0020147 3300047673 Bacteria 3735
511 Ga0495593_0131407 3300047673 Bacteria 1271
512 Ga0495602_0087506 3300048088 Bacteria 2596
513 Ga0496100_0016734 3300048903 Bacteria 4313
514 Ga0496100_0083423 3300048903 Bacteria 2164
515 Ga0496101_0010816 3300048904 Bacteria 6037
516 Ga0496101_0071471 3300048904 Bacteria 2544
517 Ga0496101_0202272 3300048904 Bacteria 1536
518 Ga0496102_0003066 3300048905 Bacteria 14146
519 Ga0496102_0041408 3300048905 Bacteria 4171
520 Ga0496102_0697310 3300048905 Bacteria 938
521 Ga0496102_0963291 3300048905 Bacteria 774
522 Ga0496103_0035119 3300048906 Bacteria 3069
523 Ga0496104_0008842 3300048907 Bacteria 8953
524 Ga0496104_0078799 3300048907 Bacteria 3140
525 Ga0496104_0163325 3300048907 Bacteria 2136
526 Ga0496105_0088943 3300048908 Bacteria 2551
527 Ga0496105_0097186 3300048908 Bacteria 2432
528 Ga0496106_0002053 3300048909 Bacteria 15142
529 Ga0496106_0160347 3300048909 Bacteria 1779
530 Ga0496106_0174689 3300048909 Bacteria 1704
531 Ga0496106_0461341 3300048909 Bacteria 1021
532 Ga0496106_0546611 3300048909 Bacteria 929
533 Ga0496106_0554423 3300048909 Bacteria 922
534 Ga0496107_0006990 3300048910 Bacteria 7775
535 Ga0496108_0061696 3300048911 Bacteria 3156
536 Ga0496108_0210666 3300048911 Bacteria 1687
537 Ga0496109_0022595 3300048912 Bacteria 5572
538 Ga0496109_0024531 3300048912 Bacteria 5362
539 Ga0496109_0350222 3300048912 Bacteria 1395
540 Ga0496109_0446970 3300048912 Bacteria 1221
541 Ga0496110_0035235 3300048913 Bacteria 4341
542 Ga0496110_0042832 3300048913 Bacteria 3951
543 Ga0496110_0071118 3300048913 Bacteria 3084
544 Ga0496110_0398702 3300048913 Bacteria 1254
545 Ga0496111_0012409 3300048914 Bacteria 5768
546 Ga0496111_0135583 3300048914 Bacteria 1823
547 Ga0496111_0739995 3300048914 Bacteria 714
548 Ga0496112_0006027 3300048915 Bacteria 10582
549 Ga0496112_0094603 3300048915 Bacteria 2958
550 Ga0496113_0056214 3300048916 Bacteria 2953
551 Ga0496113_0141611 3300048916 Bacteria 1892
552 Ga0496113_0168152 3300048916 Bacteria 1736
553 Ga0496114_0122077 3300048917 Bacteria 2241
554 Ga0496114_0130927 3300048917 Bacteria 2166
555 Ga0496114_0231311 3300048917 Bacteria 1624
556 Ga0496114_0293422 3300048917 Bacteria 1435
557 Ga0496114_0858161 3300048917 Bacteria 788
558 Ga0496115_0001279 3300048918 Bacteria 18002
559 Ga0496115_0121803 3300048918 Bacteria 2147
560 Ga0496115_0218743 3300048918 Bacteria 1572
561 Ga0496115_0318175 3300048918 Bacteria 1273
562 Ga0496117_0166234 3300048920 Bacteria 1286
563 Ga0496118_0013103 3300048921 Bacteria 7878
564 Ga0496118_0279804 3300048921 Bacteria 929
565 Ga0496119_0075755 3300048922 Bacteria 1954
566 Ga0496119_0087051 3300048922 Bacteria 1784
567 Ga0496119_0162733 3300048922 Bacteria 1184
568 Ga0496121_0000300 3300048924 Bacteria 102506
569 Ga0496121_0026815 3300048924 Bacteria 5413
570 Ga0496121_0106917 3300048924 Bacteria 2144
571 Ga0496121_0201804 3300048924 Bacteria 1417
572 Ga0496121_0235069 3300048924 Bacteria 1281
573 Ga0496121_0399790 3300048924 Bacteria 900
574 Ga0496121_0428229 3300048924 Bacteria 859
575 Ga0496124_0017397 3300048927 Bacteria 6774
576 Ga0496124_0145647 3300048927 Bacteria 1864
577 Ga0496125_0061814 3300048928 Bacteria 3001
578 Ga0496126_0008064 3300048929 Bacteria 11410
579 Ga0496126_0037811 3300048929 Bacteria 4497
580 Ga0496126_0119107 3300048929 Bacteria 2291
581 Ga0496126_0141398 3300048929 Unclassified 2071
582 Ga0496126_0214679 3300048929 Bacteria 1618
583 Ga0496126_0319534 3300048929 Bacteria 1276
584 Ga0496126_0379435 3300048929 Bacteria 1151
585 Ga0501046_0433498 3300049580 Bacteria 946
586 Ga0501047_0007633 3300049581 Bacteria 10184
587 Ga0501067_0028531 3300049583 Bacteria 3093
588 Ga0501067_0131006 3300049583 Bacteria 1396
589 Ga0501073_0023009 3300049589 Bacteria 4481
590 Ga0501080_0008285 3300049742 Bacteria 9418
591 Ga0501044_0006221 3300049823 Bacteria 13197
592 nmdc:mga00v17_109715_c1 3300050491 Bacteria 1749
593 nmdc:mga00v17_110278_c1 3300050491 Bacteria 1745
594 nmdc:mga0yw44_10995_c1 3300050492 Bacteria 4647
595 nmdc:mga0yw44_520944_c1 3300050492 Bacteria 807
596 nmdc:mga0k408_153388_c1 3300050493 Bacteria 1372
597 nmdc:mga06z11_315641_c1 3300050494 Bacteria 932
598 nmdc:mga06z11_380551_c1 3300050494 Bacteria 848
599 nmdc:mga06z11_5933_c1 3300050494 Bacteria 4933
600 nmdc:mga04h51_11677_c1 3300050495 Bacteria 2445
601 nmdc:mga05p37_121352_c1 3300050507 Bacteria 3210
602 nmdc:mga08y16_851895_c1 3300050511 Bacteria 901
603 nmdc:mga0n895_337270_c1 3300050512 Bacteria 1527
604 nmdc:mga0rr50_323373_c1 3300050513 Bacteria 1293
605 nmdc:mga0sz30_160024_c1 3300050516 Bacteria 997
606 nmdc:mga0sz30_4657_c1 3300050516 Bacteria 2946
607 Ga0495601_0062870 3300053077 Bacteria 2359
608 Ga0495601_0083012 3300053077 Bacteria 2057
609 Ga0495601_0086066 3300053077 Bacteria 2020
610 Ga0495601_0431385 3300053077 Bacteria 853
611 Ga0495601_0507132 3300053077 Bacteria 778
612 Ga0495612_0038058 3300053078 Bacteria 1954
613 Ga0495612_0128122 3300053078 Bacteria 1095
614 Ga0500635_0010270 3300053080 Bacteria 2623
615 Ga0495655_0091792 3300053083 Bacteria 886
616 Ga0495595_0049981 3300053084 Bacteria 1935
617 Ga0495595_0052569 3300053084 Bacteria 1890
618 Ga0495619_0064822 3300053085 Bacteria 2436
619 Ga0495619_0077734 3300053085 Bacteria 2230
620 Ga0495619_0229247 3300053085 Bacteria 1287
621 Ga0500578_0174665 3300053086 Bacteria 1327
622 Ga0500643_070491 3300053087 Bacteria 970
623 Ga0500644_0112322 3300053088 Bacteria 1051
624 Ga0500651_0239191 3300053093 Bacteria 1059
625 Ga0500566_0002296 3300053094 Bacteria 11313
626 Ga0500566_0017263 3300053094 Bacteria 4239
627 Ga0500641_0005682 3300053096 Bacteria 4420
628 Ga0500641_0010450 3300053096 Bacteria 3355
629 Ga0500650_0240368 3300053098 Bacteria 815
630 Ga0500554_001303 3300053102 Bacteria 4834
631 Ga0500555_030822 3300053103 Bacteria 1521
632 Ga0500558_202423 3300053106 Bacteria 690
633 Ga0500572_039889 3300053111 Bacteria 1356
634 Ga0500595_001281 3300053119 Bacteria 13681
635 Ga0500595_002271 3300053119 Bacteria 9687
636 Ga0500595_021200 3300053119 Bacteria 2323
637 Ga0500614_095230 3300053123 Bacteria 851
638 Ga0500642_0064869 3300053130 Bacteria 1649
639 Ga0500559_0009464 3300053136 Bacteria 4215
640 Ga0500559_0135145 3300053136 Bacteria 1153
641 Ga0500568_0002973 3300053139 Bacteria 9699
642 Ga0500568_0061972 3300053139 Bacteria 1446
643 Ga0500577_0028870 3300053142 Bacteria 1915
644 Ga0500589_155504 3300053147 Bacteria 925
645 Ga0500590_062642 3300053148 Bacteria 1865
646 Ga0500590_068454 3300053148 Bacteria 1769
647 Ga0500603_009637 3300053150 Bacteria 2164
648 Ga0500604_0016580 3300053151 Bacteria 2031
649 Ga0500627_0089689 3300053158 Bacteria 1376
650 Ga0500627_0159131 3300053158 Bacteria 1019
651 Ga0500630_042338 3300053159 Bacteria 2222
652 Ga0500638_000186 3300053162 Bacteria 12634
653 Ga0500638_105118 3300053162 Bacteria 1311
654 Ga0500639_012355 3300053163 Bacteria 4482
655 Ga0500639_087652 3300053163 Bacteria 1556
656 Ga0500639_092238 3300053163 Bacteria 1506
657 Ga0500637_0000223 3300053178 Bacteria 21034
658 Ga0500637_0056407 3300053178 Bacteria 2244
659 Ga0500645_018038 3300053730 Bacteria 2206
660 Ga0500645_046175 3300053730 Bacteria 1278
661 Ga0500645_073559 3300053730 Bacteria 979
662 Ga0500609_009836 3300053731 Bacteria 1287
663 Ga0500596_004481 3300053735 Bacteria 2554
664 Ga0500601_002905 3300053737 Bacteria 1850
665 Ga0500601_007158 3300053737 Bacteria 1233
666 Ga0500661_000101 3300055283 Bacteria 13840
667 Ga0466962_0436427 3300061719 Bacteria 658
668 2509151136 2508501128 Bacteria 8613869
669 2513673195 2513237098 Bacteria 9902361
670 2793073120 2791355197 Bacteria 8420563
671 2793079369
672 2874612222 2874604998 Bacteria 7834745
673 2889042004 2889033259 Bacteria 9099371
674 2903755549 2903748898 Bacteria 9972761
675 2903772765 2903768456 Bacteria 9749579
676 2904697442 2904690495 Bacteria 9412302
677 2906610955
678 2906661754 2906660503 Bacteria 8595048
679 2908744464 2908739725 Bacteria 8628932
680 2908762102 2908756301 Bacteria 8864324
681 2922366127 2922361189 Bacteria 7436256
682 2941514527 2941507105 Bacteria 8166816
683 2941522423 2941515067 Bacteria 8166720
684 2941530294 2941523033 Bacteria 8169134
685 3005478348 3005474847 Bacteria 9259049
686 8006964990 8006964411 Bacteria 8966052
687 8006988638 8006984368 Bacteria 9651211
688 8006994353 8006994254 Bacteria 8309700
689 8019566652 8019565922 Bacteria 9639779
690 8056679870 8056673599 Bacteria 7871253
691 8056686489 8056681323 Bacteria 8472857
692 8056691703 8056689827 Bacteria 6712655
693 Ga0307516_10071326
694 LJQas_1001531
695 JGI25406J46586_10000048
696 rootH2_10075964
697 rootL2_10013826
698 rootL2_10175474
699 rootH1_10149053
700 rootH1_10150008
701 rootH1_10197061
702 JGI25404J52841_10015159
703 JGI25404J52841_10024992
704 JGI25404J52841_10041970
705 JGI25404J52841_10042673
706 JGI25404J52841_10052549
707 JGI25405J52794_10004588
708 Ga0070658_10109269
709 Ga0070683_100098165
710 Ga0070683_100214251
711 Ga0070683_100584060
712 Ga0070670_100275397
713 Ga0068869_100649287
714 Ga0070680_100013974
715 Ga0070680_100031151
716 Ga0070680_100292196
717 Ga0070682_100016175
718 Ga0070682_100138418
719 Ga0068868_100139652
720 Ga0068868_100785902
721 Ga0070660_100008957
722 Ga0070689_100066530
723 Ga0070689_100210268
724 Ga0070689_100434825
725 Ga0070689_101076026
726 Ga0070691_10192004
727 Ga0070661_100703534
728 Ga0070671_100166681
729 Ga0070688_100325084
730 Ga0070659_100037727
731 Ga0070709_10020313
732 Ga0070709_10024397
733 Ga0070709_10169626
734 Ga0070714_100044789
735 Ga0070714_100712165
736 Ga0070713_100099259
737 Ga0070713_100445026
738 Ga0070710_10005979
739 Ga0070711_100049525
740 Ga0070711_100070465
741 Ga0070711_100129890
742 Ga0070711_100421136
743 Ga0070694_100286428
744 Ga0070708_100496778
745 Ga0070708_100848921
746 Ga0070663_100012536
747 Ga0070663_100021718
748 Ga0070663_100488918
749 Ga0070678_100173574
750 Ga0070678_100207413
751 Ga0070681_10056560
752 Ga0070681_10066683
753 Ga0070706_100136049
754 Ga0070706_100849928
755 Ga0070707_100052622
756 Ga0070679_100033322
757 Ga0070679_100068160
758 Ga0070679_100487944
759 Ga0070684_100010386
760 Ga0070684_100053064
761 Ga0070684_100174583
762 Ga0070684_100362442
763 Ga0070697_100103336
764 Ga0068853_100122530
765 Ga0068853_100734838
766 Ga0070672_100231083
767 Ga0070672_100646508
768 Ga0070686_100187557
769 Ga0070696_100499312
770 Ga0070693_100036267
771 Ga0070693_100598294
772 Ga0070665_100003902
773 Ga0070665_100052067
774 Ga0068855_100104631
775 Ga0068855_100110751
776 Ga0068855_100366330
777 Ga0070664_100196383
778 Ga0068857_100020850
779 Ga0068857_100037942
780 Ga0068854_100006800
781 Ga0068854_100974412
782 Ga0068856_100028283
783 Ga0068856_100228635
784 Ga0068856_100707078
785 Ga0068852_100005807
786 Ga0068852_100077758
787 Ga0068864_100051879
788 Ga0068861_100324688
789 Ga0068851_10009198
790 Ga0068851_10054098
791 Ga0068851_10379403
792 Ga0068863_100550961
793 Ga0068858_100217788
794 Ga0068858_100458112
795 Ga0068858_100563925
796 Ga0068860_100000562
797 Ga0068860_100598796
798 Ga0081455_10005695
799 Ga0081455_10007071
800 Ga0081455_10014883
801 Ga0081455_10047588
802 Ga0081540_1001350
803 Ga0081540_1001946
804 Ga0081540_1008381
805 Ga0081540_1010252
806 Ga0081540_1016474
807 Ga0081540_1017647
808 Ga0081540_1020646
809 Ga0081540_1060868
810 Ga0081539_10000008
811 Ga0081539_10013254
812 Ga0070717_10174850
813 Ga0070717_10466190
814 Ga0075365_10063555
815 Ga0075365_10312835
816 Ga0075363_100038017
817 Ga0075364_10199431
818 Ga0070715_10169159
819 Ga0070716_100082154
820 Ga0070716_100191638
821 Ga0070716_100220389
822 Ga0070712_100087849
823 Ga0070712_100337933
824 Ga0070712_100571920
825 Ga0070712_100688567
826 Ga0075362_10035523
827 Ga0075367_10004912
828 Ga0075367_10050278
829 Ga0075367_10240050
830 Ga0075369_10013072
831 Ga0075369_10187632
832 Ga0097621_100121568
833 Ga0097621_100662890
834 Ga0097621_101242999
835 Ga0075370_10063022
836 Ga0068871_100376814
837 Ga0068871_100495016
838 Ga0068871_100639132
839 Ga0075428_100049853
840 Ga0068865_100110906
841 Ga0075435_100341060
842 Ga0099794_10047456
843 Ga0099794_10075066
844 Ga0099794_10126601
845 Ga0099795_10154122
846 Ga0105240_10007748
847 Ga0105240_10021481
848 Ga0105240_10102768
849 Ga0111539_10831151
850 Ga0105245_10030173
851 Ga0105245_10449407
852 Ga0105245_10888150
853 Ga0105247_10065844
854 Ga0105247_10370493
855 Ga0114129_10096453
856 Ga0105243_10580672
857 Ga0105241_10051574
858 Ga0105241_10124334
859 Ga0105242_10091999
860 Ga0105248_10039371
861 Ga0105248_11295540
862 Ga0105237_10011809
863 Ga0105237_10018673
864 Ga0105237_10019047
865 Ga0105237_10173836
866 Ga0105237_10550135
867 Ga0105238_10035982
868 Ga0105238_10101590
869 Ga0105249_10151268
870 Ga0105249_11296197
871 Ga0105249_11487064
872 Ga0099796_10071132
873 Ga0099796_10100148
874 Ga0105239_10075005
875 Ga0105239_10359448
876 Ga0105239_10757175
877 Ga0105239_10995895
878 Ga0105239_11106427
879 Ga0105239_11479981
880 Ga0105246_10072778
881 Ga0105246_10082476
882 Ga0105246_10160360
883 Ga0105246_10339184
884 Ga0105246_11123337
885 Ga0157370_10111111
886 Ga0157369_10008116
887 Ga0157369_10275483
888 Ga0157369_10894232
889 Ga0157374_10024358
890 Ga0157378_10005382
891 Ga0157378_11097996
892 Ga0163162_10010007
893 Ga0163162_10719437
894 Ga0157372_10196810
895 Ga0157372_11482011
896 Ga0157375_10144973
897 Ga0157375_10145814
898 Ga0157375_10383279
899 Ga0157375_10805568
900 Ga0163163_10075022
901 Ga0163163_10214013
902 Ga0157380_10107406
903 Ga0157380_10524484
904 Ga0157379_10144400
905 Ga0157376_10398594
906 Ga0157376_10448341
907 Ga0157376_10959085
908 Ga0209233_1008613
909 Ga0209758_1004175
910 Ga0207697_10147940
911 Ga0207656_10083083
912 Ga0207710_10002003
913 Ga0207710_10064986
914 Ga0207688_10103732
915 Ga0207688_10284879
916 Ga0207680_10281957
917 Ga0207699_10038515
918 Ga0207699_10151082
919 Ga0207699_10191343
920 Ga0207705_10229841
921 Ga0207684_10150993
922 Ga0207684_10525121
923 Ga0207654_10002142
924 Ga0207707_10063356
925 Ga0207707_10072218
926 Ga0207707_10096526
927 Ga0207707_10372389
928 Ga0207695_10015064
929 Ga0207695_10056580
930 Ga0207695_10140063
931 Ga0207695_10194416
932 Ga0207671_10008930
933 Ga0207671_10027741
934 Ga0207671_10096883
935 Ga0207693_10008272
936 Ga0207693_10026499
937 Ga0207693_10029295
938 Ga0207693_10086641
939 Ga0207693_10296532
940 Ga0207663_10004056
941 Ga0207663_10163195
942 Ga0207663_10198018
943 Ga0207663_10478114
944 Ga0207660_10575380
945 Ga0207662_10030365
946 Ga0207657_10034539
947 Ga0207649_10123381
948 Ga0207652_10056918
949 Ga0207652_10348183
950 Ga0207646_10162278
951 Ga0207694_10000275
952 Ga0207694_10094910
953 Ga0207694_10461012
954 Ga0207694_10732450
955 Ga0207694_11119578
956 Ga0207650_10506203
957 Ga0207687_10570938
958 Ga0207700_10081179
959 Ga0207664_10313497
960 Ga0207690_10148116
961 Ga0207706_10279411
962 Ga0207670_10337761
963 Ga0207669_10733891
964 Ga0207704_10155361
965 Ga0207704_10610992
966 Ga0207665_10030462
967 Ga0207665_10214382
968 Ga0207665_10233856
969 Ga0207691_10186321
970 Ga0207691_10224262
971 Ga0207689_10262133
972 Ga0207661_10070614
973 Ga0207661_10385461
974 Ga0207679_10170407
975 Ga0207667_10061756
976 Ga0207667_10116818
977 Ga0207667_10174058
978 Ga0207712_10810089
979 Ga0207668_10268013
980 Ga0207677_10045839
981 Ga0207703_10104137
982 Ga0207703_10262546
983 Ga0207703_10936934
984 Ga0207639_10101768
985 Ga0207639_10111945
986 Ga0207639_10576414
987 Ga0207678_10026294
988 Ga0207678_10035372
989 Ga0207678_10236463
990 Ga0207702_10000026
991 Ga0207702_10206127
992 Ga0207702_10309759
993 Ga0207641_10090048
994 Ga0207648_10580105
995 Ga0207676_10284150
996 Ga0207676_10946119
997 Ga0207674_10010326
998 Ga0207674_10028112
999 Ga0207674_10110906
1000 Ga0207674_10237867
1001 Ga0207675_100157599
1002 Ga0207683_10014699
1003 Ga0207683_10656955
1004 Ga0207698_10068099
1005 Ga0207698_11031570
1006 Ga0209179_1017533
1007 Ga0268266_10471753
1008 Ga0268266_10754361
1009 Ga0268265_10420902
1010 Ga0268264_10000096
1011 Ga0307517_10002514
1012 Ga0307515_10028335
1013 Ga0307511_10024706
1014 Ga0265330_10009931
1015 Ga0265330_10022202
1016 Ga0265340_10001950
1017 Ga0265339_10005018
1018 Ga0265331_10066411
1019 Ga0307513_10211149
1020 Ga0307509_10071728
1021 Ga0307509_10182300
1022 Ga0307508_10001617
1023 Ga0307508_10158699
1024 Ga0307508_10181974
1025 Ga0265314_10024825
1026 Ga0265314_10268339
1027 Ga0265342_10031302
1028 Ga0307516_10267220
1029 Ga0307406_10842159
1030 Ga0307416_100425345
1031 Ga0307411_10315081
1032 Ga0307507_10291145
1033 Ga0307510_10059632
1034 Ga0315911_1000011
1035 Ga0373926_0110390
1036 Ga0373940_0029194
1037 Ga0373923_0075945
1038 Ga0373945_0019684
1039 Ga0373945_0227994
1040 Ga0373954_0085680
1041 Ga0373954_0087747
1042 Ga0373954_0224803
1043 Ga0373956_0135308
1044 Ga0373943_0030362
1045 Ga0373943_0141035
1046 Ga0373943_0210514
1047 Ga0373946_0058738
1048 Ga0373946_0105047
1049 Ga0373955_0194817
1050 Ga0373942_0119676
1051 Ga0373924_0010277
1052 Ga0373935_0005783
1053 Ga0373927_0002398
1054 Ga0373927_0007028
1055 Ga0373927_0038326
1056 Ga0373927_0051998
1057 Ga0373927_0098608
1058 Ga0373927_0226529
1059 Ga0373927_0648632
1060 Ga0373933_0000159
1061 Ga0373933_0041620
1062 Ga0373933_0082661
1063 Ga0373947_0017830
1064 Ga0373947_0019775
1065 Ga0373947_0415912
1066 Ga0373937_0715595
1067 Ga0373937_0726429
1068 Ga0373925_0210872
1069 Ga0373925_0349745
1070 Ga0373925_0581052
1071 Ga0395905_0824569
1072 Ga0436360_0275470
1073 Ga0451789_0571772
1074 Ga0451793_0618517
1075 Ga0451833_0630604
1076 Ga0466969_0341441
1077 Ga0466959_0029226
1078 Ga0466967_0248725
1079 Ga0466967_0589826
1080 Ga0495592_0066154
1081 Ga0495592_0134098
1082 Ga0495592_0184630
1083 Ga0495603_0006144
1084 Ga0495603_0058315
1085 Ga0495603_0064542
1086 Ga0495603_0066543
1087 Ga0495603_0067125
1088 Ga0495590_0205089
1089 Ga0495629_0004438
1090 Ga0495629_0037648
1091 Ga0495629_0040163
1092 Ga0495638_0067421
1093 Ga0495638_0068557
1094 Ga0495641_0048676
1095 Ga0495651_0213351
1096 Ga0495651_0237440
1097 Ga0495653_0155239
1098 Ga0495580_0563607
1099 Ga0495582_0017022
1100 Ga0495582_0327700
1101 Ga0495582_0332631
1102 Ga0495582_0361850
1103 Ga0495605_0115659
1104 Ga0495639_0004720
1105 Ga0495639_0044950
1106 Ga0495662_0144687
1107 Ga0495662_0190001
1108 Ga0495664_0016827
1109 Ga0495664_0061536
1110 Ga0495664_0121002
1111 Ga0495584_0078777
1112 Ga0495584_0289942
1113 Ga0495585_0301500
1114 Ga0495594_0092145
1115 Ga0495596_0132750
1116 Ga0495606_0286854
1117 Ga0495628_0087330
1118 Ga0495628_0104533
1119 Ga0495630_0200553
1120 Ga0495630_0320125
1121 Ga0495632_0091816
1122 Ga0495637_0029649
1123 Ga0495648_0018888
1124 Ga0495648_0162822
1125 Ga0495666_0043788
1126 Ga0495652_0072807
1127 Ga0495652_0329164
1128 Ga0495665_0020550
1129 Ga0495665_0028027
1130 Ga0495665_0147289
1131 Ga0495640_0016742
1132 Ga0495640_0033701
1133 Ga0495640_0320370
1134 Ga0495587_0097317
1135 Ga0495598_0008819
1136 Ga0495598_0025241
1137 Ga0495621_0127685
1138 Ga0495597_0172332
1139 Ga0495645_0013460
1140 Ga0495645_0158944
1141 Ga0495645_0185219
1142 Ga0495645_0214665
1143 Ga0495622_0228666
1144 Ga0495633_0062257
1145 Ga0495633_0075712
1146 Ga0495634_0045197
1147 Ga0495634_0050883
1148 Ga0495625_0211414
1149 Ga0495625_0369670
1150 Ga0495588_0097522
1151 Ga0495588_0111645
1152 Ga0495657_0110775
1153 Ga0495657_0263112
1154 Ga0495657_0334744
1155 Ga0495599_0072029
1156 Ga0495599_0137925
1157 Ga0495599_0244702
1158 Ga0495599_0281594
1159 Ga0495623_0047788
1160 Ga0495646_0011556
1161 Ga0495646_0384016
1162 Ga0495647_0029876
1163 Ga0495647_0052442
1164 Ga0495658_0036459
1165 Ga0495658_0072295
1166 Ga0495658_0275237
1167 Ga0495669_0192351
1168 Ga0495613_0068590
1169 Ga0495613_0105081
1170 Ga0495613_0240115
1171 Ga0495624_0005689
1172 Ga0495624_0032842
1173 Ga0495671_0112470
1174 Ga0495649_0237322
1175 Ga0495589_0114469
1176 Ga0495600_0034273
1177 Ga0495600_0169500
1178 Ga0495581_0005564
1179 Ga0495581_0043249
1180 Ga0495581_0111072
1181 Ga0495604_0048194
1182 Ga0495604_0231530
1183 Ga0495604_0249460
1184 Ga0495674_0224605
1185 Ga0495674_0335362
1186 Ga0495674_0345729
1187 Ga0495674_0486560
1188 Ga0495672_0021660
1189 Ga0495672_0035700
1190 Ga0495676_0222972
1191 Ga0495676_0269854
1192 Ga0495680_0043560
1193 Ga0495675_0222389
1194 Ga0495677_0157956
1195 Ga0495673_0044336
1196 Ga0495673_0175849
1197 Ga0495684_0029095
1198 Ga0495684_0244968
1199 Ga0495686_0017653
1200 Ga0495686_0103400
1201 Ga0495686_0142925
1202 Ga0495593_0020147
1203 Ga0495593_0131407
1204 Ga0495602_0087506
1205 Ga0496100_0016734
1206 Ga0496100_0083423
1207 Ga0496101_0010816
1208 Ga0496101_0071471
1209 Ga0496101_0202272
1210 Ga0496102_0003066
1211 Ga0496102_0041408
1212 Ga0496102_0697310
1213 Ga0496102_0963291
1214 Ga0496103_0035119
1215 Ga0496104_0008842
1216 Ga0496104_0078799
1217 Ga0496104_0163325
1218 Ga0496105_0088943
1219 Ga0496105_0097186
1220 Ga0496106_0002053
1221 Ga0496106_0160347
1222 Ga0496106_0174689
1223 Ga0496106_0461341
1224 Ga0496106_0546611
1225 Ga0496106_0554423
1226 Ga0496107_0006990
1227 Ga0496108_0061696
1228 Ga0496108_0210666
1229 Ga0496109_0022595
1230 Ga0496109_0024531
1231 Ga0496109_0350222
1232 Ga0496109_0446970
1233 Ga0496110_0035235
1234 Ga0496110_0042832
1235 Ga0496110_0071118
1236 Ga0496110_0398702
1237 Ga0496111_0012409
1238 Ga0496111_0135583
1239 Ga0496111_0739995
1240 Ga0496112_0006027
1241 Ga0496112_0094603
1242 Ga0496113_0056214
1243 Ga0496113_0141611
1244 Ga0496113_0168152
1245 Ga0496114_0122077
1246 Ga0496114_0130927
1247 Ga0496114_0231311
1248 Ga0496114_0293422
1249 Ga0496114_0858161
1250 Ga0496115_0001279
1251 Ga0496115_0121803
1252 Ga0496115_0218743
1253 Ga0496115_0318175
1254 Ga0496117_0166234
1255 Ga0496118_0013103
1256 Ga0496118_0279804
1257 Ga0496119_0075755
1258 Ga0496119_0087051
1259 Ga0496119_0162733
1260 Ga0496121_0000300
1261 Ga0496121_0026815
1262 Ga0496121_0106917
1263 Ga0496121_0201804
1264 Ga0496121_0235069
1265 Ga0496121_0399790
1266 Ga0496121_0428229
1267 Ga0496124_0017397
1268 Ga0496124_0145647
1269 Ga0496125_0061814
1270 Ga0496126_0008064
1271 Ga0496126_0037811
1272 Ga0496126_0119107
1273 Ga0496126_0141398
1274 Ga0496126_0214679
1275 Ga0496126_0319534
1276 Ga0496126_0379435
1277 Ga0501046_0433498
1278 Ga0501047_0007633
1279 Ga0501067_0028531
1280 Ga0501067_0131006
1281 Ga0501073_0023009
1282 Ga0501080_0008285
1283 Ga0501044_0006221
1284 nmdc:mga00v17_109715_c1
1285 nmdc:mga00v17_110278_c1
1286 nmdc:mga0yw44_10995_c1
1287 nmdc:mga0yw44_520944_c1
1288 nmdc:mga0k408_153388_c1
1289 nmdc:mga06z11_315641_c1
1290 nmdc:mga06z11_380551_c1
1291 nmdc:mga06z11_5933_c1
1292 nmdc:mga04h51_11677_c1
1293 nmdc:mga05p37_121352_c1
1294 nmdc:mga08y16_851895_c1
1295 nmdc:mga0n895_337270_c1
1296 nmdc:mga0rr50_323373_c1
1297 nmdc:mga0sz30_160024_c1
1298 nmdc:mga0sz30_4657_c1
1299 Ga0495601_0062870
1300 Ga0495601_0083012
1301 Ga0495601_0086066
1302 Ga0495601_0431385
1303 Ga0495601_0507132
1304 Ga0495612_0038058
1305 Ga0495612_0128122
1306 Ga0500635_0010270
1307 Ga0495655_0091792
1308 Ga0495595_0049981
1309 Ga0495595_0052569
1310 Ga0495619_0064822
1311 Ga0495619_0077734
1312 Ga0495619_0229247
1313 Ga0500578_0174665
1314 Ga0500643_070491
1315 Ga0500644_0112322
1316 Ga0500651_0239191
1317 Ga0500566_0002296
1318 Ga0500566_0017263
1319 Ga0500641_0005682
1320 Ga0500641_0010450
1321 Ga0500650_0240368
1322 Ga0500554_001303
1323 Ga0500555_030822
1324 Ga0500558_202423
1325 Ga0500572_039889
1326 Ga0500595_001281
1327 Ga0500595_002271
1328 Ga0500595_021200
1329 Ga0500614_095230
1330 Ga0500642_0064869
1331 Ga0500559_0009464
1332 Ga0500559_0135145
1333 Ga0500568_0002973
1334 Ga0500568_0061972
1335 Ga0500577_0028870
1336 Ga0500589_155504
1337 Ga0500590_062642
1338 Ga0500590_068454
1339 Ga0500603_009637
1340 Ga0500604_0016580
1341 Ga0500627_0089689
1342 Ga0500627_0159131
1343 Ga0500630_042338
1344 Ga0500638_000186
1345 Ga0500638_105118
1346 Ga0500639_012355
1347 Ga0500639_087652
1348 Ga0500639_092238
1349 Ga0500637_0000223
1350 Ga0500637_0056407
1351 Ga0500645_018038
1352 Ga0500645_046175
1353 Ga0500645_073559
1354 Ga0500609_009836
1355 Ga0500596_004481
1356 Ga0500601_002905
1357 Ga0500601_007158
1358 Ga0500661_000101
1359 Ga0466962_0436427
1360 2509151136
1361 2513673195
1362 2793073120
1363 2793079369
1364 2874612222
1365 2889042004
1366 2903755549
1367 2903772765
1368 2904697442
1369 2906610955
1370 2906661754
1371 2908744464
1372 2908762102
1373 2922366127
1374 2941514527
1375 2941522423
1376 2941530294
1377 3005478348
1378 8006964990
1379 8006988638
1380 8006994353
1381 8019566652
1382 8056679870
1383 8056686489
1384 8056691703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z1y-assembly1.cif.gz_A thermostable enolase from chloroflexus aurantiacus with substrate 2-phosphoglycerate 0.8218 49 85
6j36-assembly1.cif.gz_A crystal structure of mycoplasma hyopneumoniae enolase 0.8184 50 85
5j04-assembly1.cif.gz_A crystal structure of enolase from synechococcus elongatus, complex with phosphoenolpyruvate 0.8174 49 85
6j36-assembly1.cif.gz_B crystal structure of mycoplasma hyopneumoniae enolase 0.8172 50 85
7xml-assembly1.cif.gz_B cryo-em structure of peip-bs_enolase complex 0.8162 51 86
ID Description Score Start End Superfamily
3fcpE01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.8281 51 86 3.30.390.10
1w6tB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.8233 51 83 3.30.390.10
af_P49134_639_725_4.10.1240.30 Few Secondary Structures;Irregular;Hormone receptor fold; 0.8173 54 81 4.10.1240.30
1e9iD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.8141 51 82 3.30.390.10
af_P38104_1_104_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.8048 50 85 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A0Q6ZI93-F1-model_v4 Uncharacterized protein 0.9517 11 196 GO:0016020
AF-A0A1G8XJP0-F1-model_v4 Bll5862 protein 0.9463 8 196 GO:0016020
AF-A5EMV9-F1-model_v4 deleted 0.9446 36 196
AF-A0A515KN27-F1-model_v4 Uncharacterized protein 0.9445 8 196 GO:0016020
AF-A0A0N1CBK7-F1-model_v4 Uncharacterized protein 0.9435 8 196 GO:0016020

Map