F475491

General Info

Members Datasets Scaffolds Average Seq Length
690 205 1380 308

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0256403|Ga0501082_0256403_424_1401
Length 325
Sequence MPAVSLSTDRPSRTRRPLVAESVLDLVGSTPLVRLRRLPAPASATVLAKLESHNPGGSVKDRIALAMVEDAERRGRLRSGMTLVEPTSGNTGVGLAMVAAVKGYRLILTMPEDMSLERRRLLARFGAELQLTPAIEGMTGAVYAAEELCRAHADYVMLQQFQNPANPEVHRRTTALEILEATAGRLDAFVAGVGTGGTITGTGEVLRETLGRAVKIVAVEPARSPVLSGGRFAVHGIQGLGASFVPGIFNRDAVDEVVTVRDEDAMATALRLCREEGLLVGISAGANVWAALAVAAGLGEGRVVVTVLPDTGERYLSVDLEAPGR

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 99.28
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0256403 3300060353 Bacteria 1522
2 Ga0065715_10140814 3300005293 Bacteria 1857
3 Ga0070676_10004889 3300005328 Bacteria 7100
4 Ga0070676_10019457 3300005328 Bacteria 3778
5 Ga0070690_100207673 3300005330 Bacteria 1366
6 Ga0070670_100002651 3300005331 Bacteria 14795
7 Ga0068869_100000454 3300005334 Bacteria 22524
8 Ga0068869_100002372 3300005334 Bacteria 11330
9 Ga0068869_100125073 3300005334 Bacteria 1971
10 Ga0070680_100025007 3300005336 Bacteria 4773
11 Ga0070680_100053833 3300005336 Bacteria 3285
12 Ga0070680_100065726 3300005336 Bacteria 2973
13 Ga0070682_100000164 3300005337 Bacteria 50996
14 Ga0070660_100001192 3300005339 Bacteria 17625
15 Ga0070689_100022172 3300005340 Bacteria 4739
16 Ga0070691_10049471 3300005341 Bacteria 2003
17 Ga0070691_10108061 3300005341 Bacteria 1389
18 Ga0070661_100007596 3300005344 Bacteria 7477
19 Ga0070692_10000185 3300005345 Bacteria 16429
20 Ga0070692_10004690 3300005345 Bacteria 5729
21 Ga0070692_10019280 3300005345 Bacteria 3290
22 Ga0070669_100069938 3300005353 Bacteria 2593
23 Ga0070669_100155814 3300005353 Bacteria 1771
24 Ga0070673_100006759 3300005364 Bacteria 7485
25 Ga0070688_100085022 3300005365 Bacteria 2056
26 Ga0070659_100000169 3300005366 Bacteria 50438
27 Ga0070703_10001360 3300005406 Bacteria 7417
28 Ga0070703_10067019 3300005406 Bacteria 1189
29 Ga0070709_10420300 3300005434 Bacteria 1002
30 Ga0070713_100269868 3300005436 Bacteria 1558
31 Ga0070701_10000434 3300005438 Bacteria 14271
32 Ga0070701_10021820 3300005438 Bacteria 3063
33 Ga0070701_10061258 3300005438 Bacteria 1984
34 Ga0070705_100000303 3300005440 Bacteria 29220
35 Ga0070705_100420662 3300005440 Bacteria 995
36 Ga0070694_100000153 3300005444 Bacteria 35445
37 Ga0070694_100000394 3300005444 Bacteria 23658
38 Ga0070694_100029446 3300005444 Bacteria 3583
39 Ga0070694_100031508 3300005444 Bacteria 3477
40 Ga0070708_100002805 3300005445 Bacteria 13530
41 Ga0070708_100012658 3300005445 Bacteria 6889
42 Ga0070708_100027139 3300005445 Bacteria 4910
43 Ga0070708_100098682 3300005445 Bacteria 2671
44 Ga0070708_100234326 3300005445 Bacteria 1723
45 Ga0070663_100001895 3300005455 Bacteria 11672
46 Ga0070662_100090033 3300005457 Bacteria 2302
47 Ga0070681_10000730 3300005458 Bacteria 27149
48 Ga0068867_100070635 3300005459 Bacteria 2611
49 Ga0070706_100002480 3300005467 Bacteria 18577
50 Ga0070706_100006899 3300005467 Bacteria 10719
51 Ga0070706_100039579 3300005467 Bacteria 4352
52 Ga0070706_100067102 3300005467 Bacteria 3318
53 Ga0070706_100101981 3300005467 Bacteria 2667
54 Ga0070706_100397654 3300005467 Bacteria 1283
55 Ga0070707_100003230 3300005468 Bacteria 15441
56 Ga0070707_100004373 3300005468 Bacteria 13235
57 Ga0070707_100004480 3300005468 Bacteria 13085
58 Ga0070707_100006735 3300005468 Bacteria 10648
59 Ga0070707_100133507 3300005468 Bacteria 2414
60 Ga0070707_100149079 3300005468 Bacteria 2277
61 Ga0070707_100220071 3300005468 Bacteria 1849
62 Ga0070698_100002229 3300005471 Bacteria 21462
63 Ga0070698_100009682 3300005471 Bacteria 10306
64 Ga0070698_100015432 3300005471 Bacteria 8071
65 Ga0070698_100045359 3300005471 Bacteria 4499
66 Ga0070698_100112955 3300005471 Bacteria 2681
67 Ga0070698_100246894 3300005471 Bacteria 1718
68 Ga0070699_100002125 3300005518 Bacteria 17972
69 Ga0070699_100010069 3300005518 Bacteria 8186
70 Ga0070699_100016368 3300005518 Bacteria 6368
71 Ga0070699_100028568 3300005518 Bacteria 4809
72 Ga0070699_100034353 3300005518 Bacteria 4383
73 Ga0070699_100057958 3300005518 Bacteria 3354
74 Ga0070699_100425884 3300005518 Bacteria 1202
75 Ga0070679_100000780 3300005530 Bacteria 27672
76 Ga0070679_100151411 3300005530 Bacteria 2296
77 Ga0070697_100007241 3300005536 Bacteria 8629
78 Ga0070697_100020405 3300005536 Bacteria 5241
79 Ga0070697_100043288 3300005536 Bacteria 3645
80 Ga0070697_100054038 3300005536 Bacteria 3264
81 Ga0070697_100144847 3300005536 Bacteria 1999
82 Ga0068853_100001544 3300005539 Bacteria 16734
83 Ga0070686_100120636 3300005544 Bacteria 1800
84 Ga0070686_100243678 3300005544 Bacteria 1310
85 Ga0070695_100002060 3300005545 Bacteria 11494
86 Ga0070695_100003497 3300005545 Bacteria 9168
87 Ga0070695_100004742 3300005545 Bacteria 8002
88 Ga0070695_100005853 3300005545 Bacteria 7253
89 Ga0070695_100009011 3300005545 Bacteria 5932
90 Ga0070696_100001302 3300005546 Bacteria 16274
91 Ga0070696_100032605 3300005546 Bacteria 3574
92 Ga0070696_100065384 3300005546 Bacteria 2549
93 Ga0070696_100072427 3300005546 Bacteria 2427
94 Ga0070696_100178770 3300005546 Bacteria 1573
95 Ga0070693_100000018 3300005547 Bacteria 62344
96 Ga0070693_100036024 3300005547 Bacteria 2748
97 Ga0070704_100008622 3300005549 Bacteria 6125
98 Ga0070704_100049443 3300005549 Bacteria 2950
99 Ga0070704_100135223 3300005549 Bacteria 1917
100 Ga0068855_100000233 3300005563 Bacteria 70757
101 Ga0070664_100010975 3300005564 Bacteria 7346
102 Ga0068857_100009717 3300005577 Bacteria 8357
103 Ga0068854_100001715 3300005578 Bacteria 13360
104 Ga0068856_100000806 3300005614 Bacteria 33848
105 Ga0070702_100255630 3300005615 Bacteria 1190
106 Ga0068859_100006365 3300005617 Bacteria 11976
107 Ga0068859_100009180 3300005617 Bacteria 9986
108 Ga0068859_100259722 3300005617 Bacteria 1828
109 Ga0068864_100004417 3300005618 Bacteria 11548
110 Ga0068861_100200085 3300005719 Bacteria 1676
111 Ga0068870_10000059 3300005840 Bacteria 34564
112 Ga0068858_100040912 3300005842 Bacteria 4299
113 Ga0068860_100003577 3300005843 Bacteria 15976
114 Ga0068860_100129312 3300005843 Bacteria 2422
115 Ga0068862_100004350 3300005844 Bacteria 11989
116 Ga0068862_100004793 3300005844 Bacteria 11385
117 Ga0068862_100012292 3300005844 Bacteria 7079
118 Ga0068862_100022823 3300005844 Bacteria 5237
119 Ga0068862_100046444 3300005844 Bacteria 3705
120 Ga0081455_10001251 3300005937 Bacteria 31750
121 Ga0081455_10219809 3300005937 Bacteria 1409
122 Ga0081538_10003971 3300005981 Bacteria 13780
123 Ga0081539_10000092 3300005985 Bacteria 208968
124 Ga0070716_100031277 3300006173 Bacteria 2893
125 Ga0070712_100001609 3300006175 Bacteria 13807
126 Ga0070712_100274552 3300006175 Bacteria 1356
127 Ga0075428_100000421 3300006844 Bacteria 42169
128 Ga0075428_100008551 3300006844 Bacteria 11355
129 Ga0075428_100016534 3300006844 Bacteria 8146
130 Ga0075428_100029927 3300006844 Bacteria 6023
131 Ga0075428_100043256 3300006844 Bacteria 4951
132 Ga0075428_100142719 3300006844 Bacteria 2603
133 Ga0075428_100143058 3300006844 Bacteria 2600
134 Ga0075428_100146364 3300006844 Bacteria 2567
135 Ga0075428_100568227 3300006844 Bacteria 1212
136 Ga0075430_100000341 3300006846 Bacteria 33734
137 Ga0075430_100002061 3300006846 Bacteria 16580
138 Ga0075430_100005238 3300006846 Bacteria 10938
139 Ga0075430_100007544 3300006846 Bacteria 9185
140 Ga0075430_100096687 3300006846 Bacteria 2468
141 Ga0075430_100308728 3300006846 Bacteria 1308
142 Ga0075431_100000452 3300006847 Bacteria 33772
143 Ga0075431_100000470 3300006847 Bacteria 33363
144 Ga0075431_100001171 3300006847 Bacteria 23632
145 Ga0075431_100002219 3300006847 Bacteria 18607
146 Ga0075431_100002638 3300006847 Bacteria 17346
147 Ga0075431_100002902 3300006847 Bacteria 16586
148 Ga0075431_100004853 3300006847 Bacteria 13244
149 Ga0075431_100009244 3300006847 Bacteria 9893
150 Ga0075431_100103039 3300006847 Bacteria 2945
151 Ga0075431_100103692 3300006847 Bacteria 2935
152 Ga0075431_100164022 3300006847 Bacteria 2284
153 Ga0075431_100166959 3300006847 Bacteria 2262
154 Ga0075431_100175556 3300006847 Bacteria 2201
155 Ga0075431_100294664 3300006847 Bacteria 1640
156 Ga0075431_100464602 3300006847 Bacteria 1260
157 Ga0075431_100538410 3300006847 Bacteria 1156
158 Ga0075433_10001399 3300006852 Bacteria 17780
159 Ga0075433_10003027 3300006852 Bacteria 12915
160 Ga0075433_10003861 3300006852 Bacteria 11601
161 Ga0075433_10009505 3300006852 Bacteria 7770
162 Ga0075433_10028302 3300006852 Bacteria 4763
163 Ga0075433_10029437 3300006852 Bacteria 4679
164 Ga0075433_10069220 3300006852 Bacteria 3099
165 Ga0075433_10108867 3300006852 Bacteria 2458
166 Ga0075433_10120453 3300006852 Bacteria 2330
167 Ga0075433_10127796 3300006852 Bacteria 2257
168 Ga0075433_10392078 3300006852 Bacteria 1225
169 Ga0075433_10417822 3300006852 Bacteria 1183
170 Ga0075434_100000107 3300006871 Bacteria 47551
171 Ga0075434_100001918 3300006871 Bacteria 18027
172 Ga0075434_100002260 3300006871 Bacteria 16853
173 Ga0075434_100003368 3300006871 Bacteria 14308
174 Ga0075434_100036682 3300006871 Bacteria 4850
175 Ga0075434_100065643 3300006871 Bacteria 3615
176 Ga0075434_100114972 3300006871 Bacteria 2703
177 Ga0075434_100123165 3300006871 Bacteria 2609
178 Ga0075434_100244675 3300006871 Bacteria 1813
179 Ga0075434_100439041 3300006871 Bacteria 1326
180 Ga0075429_100000305 3300006880 Bacteria 34736
181 Ga0075429_100003918 3300006880 Bacteria 12716
182 Ga0075429_100010160 3300006880 Bacteria 8149
183 Ga0075429_100010628 3300006880 Bacteria 7964
184 Ga0075429_100013922 3300006880 Bacteria 6972
185 Ga0075429_100045044 3300006880 Bacteria 3838
186 Ga0075429_100062017 3300006880 Bacteria 3257
187 Ga0075429_100066718 3300006880 Bacteria 3133
188 Ga0075429_100144592 3300006880 Bacteria 2081
189 Ga0075429_100164495 3300006880 Bacteria 1944
190 Ga0075429_100266545 3300006880 Bacteria 1500
191 Ga0075436_100001117 3300006914 Bacteria 18139
192 Ga0075436_100032734 3300006914 Bacteria 3583
193 Ga0075436_100073431 3300006914 Bacteria 2368
194 Ga0075436_100124360 3300006914 Bacteria 1806
195 Ga0075436_100299249 3300006914 Bacteria 1153
196 Ga0097620_100006365 3300006931 Bacteria 11976
197 Ga0097620_100009180 3300006931 Bacteria 9986
198 Ga0097620_100134776 3300006931 Bacteria 2542
199 Ga0097620_100259721 3300006931 Bacteria 1828
200 Ga0075435_100000798 3300007076 Bacteria 19609
201 Ga0075435_100001899 3300007076 Bacteria 13598
202 Ga0075435_100004640 3300007076 Bacteria 9468
203 Ga0075435_100007188 3300007076 Bacteria 7918
204 Ga0075435_100010546 3300007076 Bacteria 6760
205 Ga0075435_100029753 3300007076 Bacteria 4288
206 Ga0075435_100163965 3300007076 Bacteria 1873
207 Ga0075435_100286482 3300007076 Bacteria 1407
208 Ga0075435_100366274 3300007076 Bacteria 1237
209 Ga0099794_10055000 3300007265 Bacteria 1922
210 Ga0111539_10000557 3300009094 Bacteria 47767
211 Ga0111539_10008896 3300009094 Bacteria 12713
212 Ga0111539_10011342 3300009094 Bacteria 11194
213 Ga0111539_10099499 3300009094 Bacteria 3415
214 Ga0111539_10109518 3300009094 Bacteria 3242
215 Ga0111539_10152793 3300009094 Bacteria 2702
216 Ga0105245_10346129 3300009098 Bacteria 1471
217 Ga0105247_10097035 3300009101 Bacteria 1879
218 Ga0114129_10000497 3300009147 Bacteria 47712
219 Ga0114129_10000704 3300009147 Bacteria 42132
220 Ga0114129_10000726 3300009147 Bacteria 41775
221 Ga0114129_10001085 3300009147 Bacteria 35711
222 Ga0114129_10002365 3300009147 Bacteria 26178
223 Ga0114129_10002578 3300009147 Bacteria 25189
224 Ga0114129_10004399 3300009147 Bacteria 19870
225 Ga0114129_10006119 3300009147 Bacteria 17065
226 Ga0114129_10006298 3300009147 Bacteria 16825
227 Ga0114129_10014740 3300009147 Bacteria 11136
228 Ga0114129_10021486 3300009147 Bacteria 9160
229 Ga0114129_10034166 3300009147 Bacteria 7181
230 Ga0114129_10044350 3300009147 Bacteria 6256
231 Ga0114129_10064549 3300009147 Bacteria 5110
232 Ga0114129_10072614 3300009147 Bacteria 4796
233 Ga0114129_10086069 3300009147 Bacteria 4360
234 Ga0114129_10164893 3300009147 Bacteria 3025
235 Ga0114129_10169162 3300009147 Bacteria 2981
236 Ga0114129_10234984 3300009147 Bacteria 2467
237 Ga0114129_10265070 3300009147 Bacteria 2300
238 Ga0114129_10271162 3300009147 Bacteria 2270
239 Ga0114129_10432212 3300009147 Bacteria 1730
240 Ga0105243_10005054 3300009148 Bacteria 10351
241 Ga0105243_10061888 3300009148 Bacteria 2995
242 Ga0105241_10002337 3300009174 Bacteria 14247
243 Ga0105241_10048576 3300009174 Bacteria 3229
244 Ga0105248_10292608 3300009177 Bacteria 1834
245 Ga0105248_10777860 3300009177 Bacteria 1080
246 Ga0105249_10018869 3300009553 Bacteria 6145
247 Ga0105249_10106027 3300009553 Unclassified 2651
248 Ga0105239_10513261 3300010375 Bacteria 1363
249 Ga0157373_10018199 3300013100 Bacteria 5117
250 Ga0157369_10028864 3300013105 Bacteria 6136
251 Ga0157378_10076143 3300013297 Bacteria 3023
252 Ga0157378_10112151 3300013297 Bacteria 2501
253 Ga0157378_10454229 3300013297 Bacteria 1272
254 Ga0163162_10028990 3300013306 Bacteria 5477
255 Ga0163162_10144116 3300013306 Bacteria 2497
256 Ga0157372_10000846 3300013307 Bacteria 33218
257 Ga0157372_10092431 3300013307 Bacteria 3442
258 Ga0157375_10041557 3300013308 Bacteria 4441
259 Ga0157375_10336270 3300013308 Bacteria 1675
260 Ga0182007_10015372 3300015262 Bacteria 2857
261 Ga0207653_10001521 3300025885 Bacteria 7507
262 Ga0207653_10007870 3300025885 Bacteria 3322
263 Ga0207647_10029432 3300025904 Bacteria 3555
264 Ga0207647_10167732 3300025904 Bacteria 1279
265 Ga0207699_10317904 3300025906 Bacteria 1091
266 Ga0207645_10000340 3300025907 Bacteria 39096
267 Ga0207645_10019898 3300025907 Bacteria 4394
268 Ga0207643_10000105 3300025908 Bacteria 57132
269 Ga0207684_10000242 3300025910 Bacteria 81735
270 Ga0207684_10009125 3300025910 Bacteria 8784
271 Ga0207684_10025708 3300025910 Bacteria 5016
272 Ga0207684_10045384 3300025910 Bacteria 3728
273 Ga0207684_10102886 3300025910 Bacteria 2442
274 Ga0207684_10110774 3300025910 Bacteria 2350
275 Ga0207684_10464493 3300025910 Bacteria 1086
276 Ga0207654_10007386 3300025911 Bacteria 5533
277 Ga0207654_10107796 3300025911 Bacteria 1727
278 Ga0207707_10000034 3300025912 Bacteria 152677
279 Ga0207693_10009502 3300025915 Bacteria 7920
280 Ga0207693_10189345 3300025915 Bacteria 1619
281 Ga0207660_10165539 3300025917 Bacteria 1709
282 Ga0207657_10000066 3300025919 Bacteria 98663
283 Ga0207649_10027797 3300025920 Bacteria 3324
284 Ga0207652_10000740 3300025921 Bacteria 31505
285 Ga0207652_10129849 3300025921 Bacteria 2247
286 Ga0207646_10000574 3300025922 Bacteria 48122
287 Ga0207646_10004220 3300025922 Bacteria 15726
288 Ga0207646_10026137 3300025922 Bacteria 5332
289 Ga0207646_10033355 3300025922 Bacteria 4658
290 Ga0207646_10043129 3300025922 Bacteria 4052
291 Ga0207646_10062589 3300025922 Bacteria 3322
292 Ga0207646_10077131 3300025922 Bacteria 2979
293 Ga0207646_10162357 3300025922 Bacteria 2016
294 Ga0207646_10261551 3300025922 Bacteria 1564
295 Ga0207681_10005715 3300025923 Bacteria 7631
296 Ga0207681_10198957 3300025923 Bacteria 1537
297 Ga0207650_10031007 3300025925 Bacteria 3857
298 Ga0207700_10219506 3300025928 Bacteria 1611
299 Ga0207690_10001729 3300025932 Bacteria 13423
300 Ga0207706_10043062 3300025933 Bacteria 4001
301 Ga0207706_10245545 3300025933 Bacteria 1564
302 Ga0207706_10273292 3300025933 Bacteria 1474
303 Ga0207706_10310932 3300025933 Bacteria 1372
304 Ga0207709_10048952 3300025935 Bacteria 2577
305 Ga0207691_10011340 3300025940 Bacteria 8552
306 Ga0207689_10000365 3300025942 Bacteria 42716
307 Ga0207689_10004878 3300025942 Bacteria 12094
308 Ga0207689_10193462 3300025942 Bacteria 1678
309 Ga0207679_10000248 3300025945 Bacteria 41174
310 Ga0207667_10000790 3300025949 Bacteria 41185
311 Ga0207651_10030135 3300025960 Bacteria 3450
312 Ga0207712_10159424 3300025961 Unclassified 1752
313 Ga0207712_10247477 3300025961 Bacteria 1439
314 Ga0207640_10003504 3300025981 Bacteria 8458
315 Ga0207703_10111134 3300026035 Bacteria 2339
316 Ga0207639_10017235 3300026041 Bacteria 5120
317 Ga0207678_10002576 3300026067 Bacteria 16517
318 Ga0207708_10011344 3300026075 Bacteria 6637
319 Ga0207648_10000856 3300026089 Bacteria 34281
320 Ga0207648_10110675 3300026089 Bacteria 2411
321 Ga0207648_10132025 3300026089 Bacteria 2198
322 Ga0207648_10469557 3300026089 Bacteria 1148
323 Ga0207676_10024755 3300026095 Bacteria 4445
324 Ga0207674_10000050 3300026116 Bacteria 116782
325 Ga0207675_100074739 3300026118 Bacteria 3171
326 Ga0207675_100466114 3300026118 Bacteria 1254
327 Ga0209981_1005557 3300027378 Bacteria 1674
328 Ga0209984_1005626 3300027424 Bacteria 1512
329 Ga0210000_1003329 3300027462 Bacteria 2316
330 Ga0209995_1005718 3300027471 Bacteria 1998
331 Ga0209968_1008697 3300027526 Bacteria 1549
332 Ga0209983_1002812 3300027665 Bacteria 3761
333 Ga0209588_1010800 3300027671 Bacteria 2751
334 Ga0209971_1000128 3300027682 Bacteria 22582
335 Ga0209966_1000071 3300027695 Bacteria 45482
336 Ga0209966_1022285 3300027695 Bacteria 1237
337 Ga0209998_10000113 3300027717 Bacteria 32266
338 Ga0209974_10022208 3300027876 Bacteria 2102
339 Ga0207428_10000033 3300027907 Bacteria 232081
340 Ga0207428_10000054 3300027907 Bacteria 175237
341 Ga0207428_10022910 3300027907 Bacteria 5262
342 Ga0207428_10174593 3300027907 Bacteria 1626
343 Ga0268265_10003185 3300028380 Bacteria 11925
344 Ga0268265_10008213 3300028380 Bacteria 7053
345 Ga0268265_10015396 3300028380 Bacteria 5234
346 Ga0268265_10082887 3300028380 Bacteria 2537
347 Ga0268264_10004690 3300028381 Bacteria 11621
348 Ga0268264_10030442 3300028381 Bacteria 4423
349 Ga0268264_10078705 3300028381 Bacteria 2811
350 Ga0268264_10095295 3300028381 Bacteria 2575
351 Ga0268264_10143668 3300028381 Bacteria 2131
352 Ga0307408_100019764 3300031548 Bacteria 4537
353 Ga0307408_100289440 3300031548 Bacteria 1367
354 Ga0307405_10161862 3300031731 Bacteria 1586
355 Ga0307409_100018640 3300031995 Bacteria 4674
356 Ga0307409_100035154 3300031995 Bacteria 3668
357 Ga0307416_100097447 3300032002 Bacteria 2547
358 Ga0307416_100102901 3300032002 Bacteria 2492
359 Ga0307411_10528467 3300032005 Bacteria 1003
360 Ga0307415_100303893 3300032126 Bacteria 1323
361 Ga0373948_0002216 3300034817 Bacteria 2839
362 Ga0373959_0012217 3300034820 Bacteria 1529
363 Ga0373940_0082375 3300035088 Bacteria 953
364 Ga0373949_0019418 3300035090 Bacteria 1548
365 Ga0373951_0001847 3300035091 Bacteria 5473
366 Ga0373939_0016956 3300035114 Bacteria 1928
367 Ga0373939_0025450 3300035114 Bacteria 1659
368 Ga0373960_0005205 3300035121 Bacteria 3004
369 Ga0373960_0033821 3300035121 Bacteria 1443
370 Ga0373931_0015664 3300035691 Bacteria 3721
371 Ga0373931_0069245 3300035691 Bacteria 1922
372 Ga0373931_0106101 3300035691 Bacteria 1587
373 Ga0395899_0033281 3300037312 Bacteria 3871
374 Ga0395900_0003509 3300037418 Bacteria 16929
375 Ga0395898_0013339 3300037466 Bacteria 8463
376 Ga0395901_0011843 3300038443 Bacteria 8842
377 Ga0439448_0000205 3300042005 Bacteria 12290
378 Ga0439459_0012281 3300042438 Bacteria 1522
379 Ga0439464_0015396 3300042439 Bacteria 2064
380 Ga0439460_0000453 3300042461 Bacteria 8827
381 Ga0439460_0047034 3300042461 Bacteria 1283
382 Ga0451577_0011665 3300042876 Bacteria 8298
383 Ga0451577_0013723 3300042876 Bacteria 7571
384 Ga0451577_0023769 3300042876 Bacteria 5584
385 Ga0451577_0064518 3300042876 Bacteria 3266
386 Ga0451577_0163289 3300042876 Bacteria 2006
387 Ga0451577_0284928 3300042876 Bacteria 1497
388 Ga0453684_0135624 3300044712 Bacteria 2947
389 Ga0451576_0017829 3300045051 Bacteria 7798
390 Ga0451576_0030449 3300045051 Bacteria 5768
391 Ga0451576_0040536 3300045051 Bacteria 4927
392 Ga0451576_0042261 3300045051 Bacteria 4813
393 Ga0451576_0085237 3300045051 Bacteria 3287
394 Ga0451576_0087339 3300045051 Bacteria 3243
395 Ga0451576_0111360 3300045051 Bacteria 2849
396 Ga0451576_0141805 3300045051 Bacteria 2505
397 Ga0495580_0005537 3300046472 Bacteria 10420
398 Ga0495580_0351528 3300046472 Bacteria 998
399 Ga0495584_0115460 3300046491 Bacteria 1359
400 Ga0495642_0104950 3300046528 Bacteria 1205
401 Ga0495598_0026656 3300046537 Bacteria 1586
402 Ga0495669_0020026 3300046684 Bacteria 2891
403 Ga0495669_0089338 3300046684 Bacteria 1421
404 Ga0495636_0048646 3300047318 Bacteria 1772
405 Ga0496103_0200311 3300048906 Bacteria 1284
406 Ga0496106_0186716 3300048909 Bacteria 1647
407 Ga0496106_0210911 3300048909 Bacteria 1547
408 Ga0496108_0268576 3300048911 Bacteria 1485
409 Ga0496112_0141679 3300048915 Bacteria 2373
410 Ga0501033_0063804 3300049570 Bacteria 2711
411 Ga0501033_0254184 3300049570 Bacteria 1245
412 Ga0501033_0261497 3300049570 Bacteria 1225
413 Ga0501036_0040793 3300049572 Bacteria 3927
414 Ga0501036_0049407 3300049572 Bacteria 3562
415 Ga0501036_0070650 3300049572 Bacteria 2952
416 Ga0501036_0088180 3300049572 Bacteria 2622
417 Ga0501036_0187665 3300049572 Bacteria 1740
418 Ga0501036_0400432 3300049572 Bacteria 1145
419 Ga0501038_0007239 3300049574 Bacteria 10249
420 Ga0501038_0040088 3300049574 Bacteria 4093
421 Ga0501038_0125500 3300049574 Bacteria 2113
422 Ga0501038_0152989 3300049574 Bacteria 1880
423 Ga0501038_0219693 3300049574 Bacteria 1517
424 Ga0501038_0255750 3300049574 Bacteria 1386
425 Ga0501039_0003008 3300049575 Bacteria 12600
426 Ga0501039_0020459 3300049575 Bacteria 5072
427 Ga0501039_0040095 3300049575 Bacteria 3616
428 Ga0501039_0109802 3300049575 Bacteria 2156
429 Ga0501040_0000372 3300049576 Bacteria 26457
430 Ga0501040_0002803 3300049576 Bacteria 11240
431 Ga0501040_0012033 3300049576 Bacteria 5661
432 Ga0501040_0021721 3300049576 Bacteria 4291
433 Ga0501040_0045132 3300049576 Bacteria 3005
434 Ga0501040_0088301 3300049576 Bacteria 2153
435 Ga0501040_0111366 3300049576 Bacteria 1914
436 Ga0501040_0173969 3300049576 Bacteria 1525
437 Ga0501040_0230401 3300049576 Bacteria 1319
438 Ga0501040_0353630 3300049576 Bacteria 1053
439 Ga0501041_0000313 3300049577 Bacteria 23678
440 Ga0501041_0003933 3300049577 Bacteria 8569
441 Ga0501041_0004305 3300049577 Bacteria 8236
442 Ga0501041_0090684 3300049577 Bacteria 1887
443 Ga0501041_0167657 3300049577 Bacteria 1374
444 Ga0501042_0001568 3300049578 Bacteria 13533
445 Ga0501042_0006045 3300049578 Bacteria 7839
446 Ga0501042_0127595 3300049578 Bacteria 1832
447 Ga0501042_0172982 3300049578 Bacteria 1558
448 Ga0501042_0174868 3300049578 Bacteria 1549
449 Ga0501042_0269252 3300049578 Bacteria 1230
450 Ga0501043_0036352 3300049579 Bacteria 3874
451 Ga0501046_0000084 3300049580 Bacteria 100971
452 Ga0501046_0004108 3300049580 Bacteria 13262
453 Ga0501046_0036544 3300049580 Bacteria 3952
454 Ga0501046_0038740 3300049580 Bacteria 3823
455 Ga0501046_0174207 3300049580 Bacteria 1613
456 Ga0501046_0249105 3300049580 Bacteria 1308
457 Ga0501046_0331720 3300049580 Bacteria 1107
458 Ga0501048_0003731 3300049582 Bacteria 11615
459 Ga0501048_0007331 3300049582 Bacteria 8363
460 Ga0501048_0008354 3300049582 Bacteria 7826
461 Ga0501068_0050008 3300049584 Bacteria 2526
462 Ga0501068_0071379 3300049584 Bacteria 2120
463 Ga0501068_0143782 3300049584 Bacteria 1496
464 Ga0501068_0166247 3300049584 Bacteria 1391
465 Ga0501069_0055638 3300049585 Bacteria 2204
466 Ga0501071_0004236 3300049587 Bacteria 9084
467 Ga0501071_0022346 3300049587 Bacteria 4410
468 Ga0501071_0181561 3300049587 Bacteria 1577
469 Ga0501071_0187157 3300049587 Bacteria 1552
470 Ga0501071_0396971 3300049587 Bacteria 1053
471 Ga0501072_0002328 3300049588 Bacteria 14251
472 Ga0501072_0006474 3300049588 Bacteria 8918
473 Ga0501072_0011064 3300049588 Bacteria 6885
474 Ga0501072_0011625 3300049588 Bacteria 6726
475 Ga0501072_0021799 3300049588 Bacteria 4968
476 Ga0501072_0038391 3300049588 Bacteria 3758
477 Ga0501072_0043833 3300049588 Bacteria 3517
478 Ga0501072_0076813 3300049588 Bacteria 2643
479 Ga0501072_0273737 3300049588 Bacteria 1343
480 Ga0501072_0279597 3300049588 Bacteria 1328
481 Ga0501072_0491669 3300049588 Bacteria 970
482 Ga0501074_0002552 3300049590 Bacteria 12706
483 Ga0501074_0002904 3300049590 Bacteria 12025
484 Ga0501074_0159699 3300049590 Bacteria 1610
485 Ga0501074_0191218 3300049590 Bacteria 1459
486 Ga0501074_0300827 3300049590 Bacteria 1139
487 Ga0501075_0000734 3300049591 Bacteria 20322
488 Ga0501075_0000742 3300049591 Bacteria 20270
489 Ga0501075_0002306 3300049591 Bacteria 12664
490 Ga0501075_0024482 3300049591 Bacteria 4428
491 Ga0501075_0024488 3300049591 Bacteria 4427
492 Ga0501075_0025151 3300049591 Bacteria 4374
493 Ga0501075_0026883 3300049591 Bacteria 4238
494 Ga0501075_0030009 3300049591 Bacteria 4024
495 Ga0501075_0037620 3300049591 Bacteria 3616
496 Ga0501075_0051359 3300049591 Bacteria 3100
497 Ga0501075_0063924 3300049591 Bacteria 2775
498 Ga0501075_0210943 3300049591 Bacteria 1481
499 Ga0501075_0257741 3300049591 Bacteria 1329
500 Ga0501075_0280989 3300049591 Bacteria 1268
501 Ga0501075_0323316 3300049591 Bacteria 1175
502 Ga0501076_0001282 3300049592 Bacteria 16737
503 Ga0501076_0001694 3300049592 Bacteria 14878
504 Ga0501076_0002350 3300049592 Bacteria 12941
505 Ga0501076_0016721 3300049592 Bacteria 5565
506 Ga0501076_0017009 3300049592 Bacteria 5522
507 Ga0501076_0021097 3300049592 Bacteria 4992
508 Ga0501076_0042702 3300049592 Bacteria 3570
509 Ga0501076_0103543 3300049592 Bacteria 2296
510 Ga0501076_0103709 3300049592 Bacteria 2294
511 Ga0501076_0299531 3300049592 Bacteria 1318
512 Ga0501077_0001222 3300049593 Bacteria 15514
513 Ga0501077_0001630 3300049593 Bacteria 13483
514 Ga0501077_0022560 3300049593 Bacteria 3987
515 Ga0501077_0035033 3300049593 Bacteria 3196
516 Ga0501077_0036677 3300049593 Bacteria 3124
517 Ga0501077_0045127 3300049593 Bacteria 2799
518 Ga0501077_0192003 3300049593 Bacteria 1297
519 Ga0501079_0000347 3300049741 Bacteria 29466
520 Ga0501079_0000847 3300049741 Bacteria 20853
521 Ga0501079_0001826 3300049741 Bacteria 15236
522 Ga0501079_0003926 3300049741 Bacteria 10986
523 Ga0501079_0005662 3300049741 Bacteria 9327
524 Ga0501079_0024179 3300049741 Bacteria 4662
525 Ga0501079_0031768 3300049741 Bacteria 4057
526 Ga0501079_0040790 3300049741 Bacteria 3582
527 Ga0501079_0044595 3300049741 Bacteria 3422
528 Ga0501079_0076646 3300049741 Bacteria 2586
529 Ga0501079_0133394 3300049741 Bacteria 1933
530 Ga0501079_0183508 3300049741 Bacteria 1633
531 Ga0501079_0200500 3300049741 Bacteria 1559
532 Ga0501079_0207297 3300049741 Bacteria 1531
533 Ga0501080_0000373 3300049742 Bacteria 34505
534 Ga0501080_0060310 3300049742 Bacteria 3531
535 Ga0501080_0106207 3300049742 Bacteria 2602
536 Ga0501080_0117195 3300049742 Bacteria 2468
537 Ga0501080_0155503 3300049742 Bacteria 2113
538 Ga0501080_0257528 3300049742 Bacteria 1590
539 Ga0501081_0002261 3300049743 Bacteria 12115
540 Ga0501081_0002829 3300049743 Bacteria 11009
541 Ga0501081_0003242 3300049743 Bacteria 10354
542 Ga0501081_0005570 3300049743 Bacteria 8132
543 Ga0501081_0013375 3300049743 Bacteria 5398
544 Ga0501081_0030144 3300049743 Bacteria 3670
545 Ga0501081_0038636 3300049743 Bacteria 3262
546 Ga0501081_0048334 3300049743 Bacteria 2928
547 Ga0501081_0056095 3300049743 Bacteria 2722
548 Ga0501081_0089925 3300049743 Bacteria 2158
549 Ga0501081_0102409 3300049743 Bacteria 2025
550 Ga0501081_0317062 3300049743 Bacteria 1145
551 Ga0501081_0337409 3300049743 Bacteria 1109
552 Ga0501083_0003803 3300049744 Bacteria 10601
553 Ga0501083_0080269 3300049744 Bacteria 2163
554 Ga0501083_0135426 3300049744 Bacteria 1614
555 Ga0501045_0000024 3300049824 Bacteria 63402
556 Ga0501045_0001154 3300049824 Bacteria 17499
557 Ga0501045_0202453 3300049824 Bacteria 1479
558 Ga0501045_0218662 3300049824 Bacteria 1419
559 Ga0501045_0239977 3300049824 Bacteria 1349
560 Ga0501045_0303483 3300049824 Bacteria 1188
561 nmdc:mga05p37_114160_c1 3300050507 Bacteria 2873
562 nmdc:mga05p37_19006_c1 3300050507 Bacteria 8310
563 nmdc:mga05p37_227346_c1 3300050507 Bacteria 2249
564 nmdc:mga05p37_239485_c1 3300050507 Bacteria 2183
565 nmdc:mga05p37_240176_c1 3300050507 Bacteria 2179
566 nmdc:mga05p37_280974_c1 3300050507 Bacteria 1985
567 nmdc:mga05p37_33272_c1 3300050507 Bacteria 6314
568 nmdc:mga05p37_3760_c1 3300050507 Bacteria 17767
569 nmdc:mga05p37_423819_c1 3300050507 Bacteria 1548
570 nmdc:mga05p37_46194_c1 3300050507 Bacteria 5355
571 nmdc:mga05p37_4740_c1 3300050507 Bacteria 15888
572 nmdc:mga05p37_50612_c1 3300050507 Bacteria 5109
573 nmdc:mga05p37_51237_c1 3300050507 Bacteria 5077
574 nmdc:mga05p37_54516_c1 3300050507 Bacteria 4919
575 nmdc:mga05p37_55867_c1 3300050507 Bacteria 4860
576 nmdc:mga05p37_571_c1 3300050507 Bacteria 40489
577 nmdc:mga05p37_7326_c1 3300050507 Bacteria 13022
578 nmdc:mga05p37_733_c1 3300050507 Bacteria 36361
579 nmdc:mga05p37_7533_c1 3300050507 Bacteria 12833
580 nmdc:mga05p37_9265_c1 3300050507 Bacteria 11639
581 nmdc:mga09592_10815_c1 3300050508 Bacteria 7422
582 nmdc:mga09592_13717_c1 3300050508 Bacteria 6622
583 nmdc:mga09592_13762_c1 3300050508 Bacteria 6610
584 nmdc:mga09592_218002_c1 3300050508 Bacteria 1653
585 nmdc:mga09592_227935_c1 3300050508 Bacteria 1614
586 nmdc:mga09592_32609_c1 3300050508 Bacteria 4343
587 nmdc:mga09592_33695_c1 3300050508 Bacteria 4277
588 nmdc:mga09592_36768_c1 3300050508 Bacteria 4103
589 nmdc:mga09592_44015_c1 3300050508 Bacteria 3756
590 nmdc:mga09592_47056_c1 3300050508 Bacteria 3634
591 nmdc:mga09592_5510_c1 3300050508 Bacteria 10298
592 nmdc:mga09592_56_c1 3300050508 Bacteria 62143
593 nmdc:mga09592_6707_c1 3300050508 Bacteria 9377
594 nmdc:mga0qj67_18157_c1 3300050509 Bacteria 5360
595 nmdc:mga0qj67_28264_c1 3300050509 Bacteria 4352
596 nmdc:mga0qj67_300724_c1 3300050509 Bacteria 1300
597 nmdc:mga0qj67_3409_c1 3300050509 Bacteria 11467
598 nmdc:mga0qj67_4522_c1 3300050509 Bacteria 10072
599 nmdc:mga0qj67_639520_c1 3300050509 Bacteria 849
600 nmdc:mga0qj67_711_c1 3300050509 Bacteria 22648
601 nmdc:mga0qj67_761_c1 3300050509 Bacteria 21944
602 nmdc:mga0qj67_85066_c1 3300050509 Bacteria 2536
603 nmdc:mga06r32_1136_c1 3300050510 Bacteria 23891
604 nmdc:mga06r32_12631_c1 3300050510 Bacteria 7630
605 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
606 nmdc:mga06r32_214774_c1 3300050510 Bacteria 1911
607 nmdc:mga06r32_295283_c1 3300050510 Bacteria 1607
608 nmdc:mga06r32_344052_c1 3300050510 Bacteria 1476
609 nmdc:mga06r32_37690_c1 3300050510 Bacteria 4574
610 nmdc:mga06r32_380548_c1 3300050510 Bacteria 1394
611 nmdc:mga06r32_428_c1 3300050510 Bacteria 35405
612 nmdc:mga06r32_48513_c1 3300050510 Bacteria 4059
613 nmdc:mga06r32_53897_c1 3300050510 Bacteria 3855
614 nmdc:mga06r32_701929_c1 3300050510 Bacteria 977
615 nmdc:mga06r32_8388_c1 3300050510 Bacteria 9306
616 nmdc:mga08y16_101940_c1 3300050511 Bacteria 2988
617 nmdc:mga08y16_13982_c1 3300050511 Bacteria 8449
618 nmdc:mga08y16_15975_c1 3300050511 Bacteria 7890
619 nmdc:mga08y16_165516_c1 3300050511 Bacteria 2297
620 nmdc:mga08y16_272246_c1 3300050511 Bacteria 1748
621 nmdc:mga08y16_3397_c1 3300050511 Bacteria 16517
622 nmdc:mga08y16_589741_c1 3300050511 Bacteria 1121
623 nmdc:mga0n895_10415_c1 3300050512 Bacteria 8210
624 nmdc:mga0n895_162730_c1 3300050512 Bacteria 2263
625 nmdc:mga0n895_176712_c1 3300050512 Bacteria 2166
626 nmdc:mga0n895_191_c1 3300050512 Bacteria 38035
627 nmdc:mga0n895_232972_c1 3300050512 Bacteria 1869
628 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
629 nmdc:mga0n895_2702_c1 3300050512 Bacteria 14000
630 nmdc:mga0n895_356462_c1 3300050512 Bacteria 1481
631 nmdc:mga0n895_37967_c1 3300050512 Bacteria 4664
632 nmdc:mga0n895_74710_c1 3300050512 Bacteria 3368
633 nmdc:mga0n895_79039_c1 3300050512 Bacteria 3275
634 nmdc:mga0n895_91060_c1 3300050512 Bacteria 3052
635 nmdc:mga0rr50_17563_c1 3300050513 Bacteria 4780
636 nmdc:mga0rr50_1853_c1 3300050513 Bacteria 11718
637 nmdc:mga0rr50_23170_c1 3300050513 Bacteria 4276
638 nmdc:mga0rr50_25401_c1 3300050513 Bacteria 4118
639 nmdc:mga0rr50_5485_c1 3300050513 Bacteria 7575
640 nmdc:mga0rr50_79664_c1 3300050513 Bacteria 2523
641 nmdc:mga0rr50_95422_c1 3300050513 Bacteria 2325
642 nmdc:mga08x19_106914_c1 3300050514 Bacteria 1862
643 nmdc:mga08x19_111959_c1 3300050514 Bacteria 1821
644 nmdc:mga08x19_132107_c1 3300050514 Bacteria 1680
645 nmdc:mga08x19_223715_c1 3300050514 Bacteria 1294
646 nmdc:mga08x19_224099_c1 3300050514 Bacteria 1293
647 nmdc:mga08x19_3113_c1 3300050514 Bacteria 9971
648 nmdc:mga08x19_399_c1 3300050514 Bacteria 30610
649 nmdc:mga08x19_87694_c1 3300050514 Bacteria 2050
650 nmdc:mga0a205_123092_c1 3300050515 Bacteria 2493
651 nmdc:mga0a205_225470_c1 3300050515 Bacteria 1759
652 nmdc:mga0a205_25642_c1 3300050515 Bacteria 5618
653 nmdc:mga0a205_25936_c1 3300050515 Bacteria 4768
654 nmdc:mga0a205_3171_c1 3300050515 Bacteria 14605
655 nmdc:mga0a205_329_c1 3300050515 Bacteria 35516
656 nmdc:mga0a205_32_c1 3300050515 Bacteria 79060
657 nmdc:mga0a205_332962_c1 3300050515 Bacteria 1388
658 nmdc:mga0a205_47042_c1 3300050515 Bacteria 4161
659 nmdc:mga0a205_5347_c1 3300050515 Bacteria 11573
660 Ga0495601_0000902 3300053077 Bacteria 16197
661 Ga0495595_0051409 3300053084 Bacteria 1910
662 Ga0495619_0021234 3300053085 Bacteria 4143
663 Ga0501084_0000494 3300054114 Bacteria 30250
664 Ga0501084_0002049 3300054114 Bacteria 16089
665 Ga0501084_0002997 3300054114 Bacteria 13675
666 Ga0501084_0004153 3300054114 Bacteria 11804
667 Ga0501084_0007499 3300054114 Bacteria 8993
668 Ga0501084_0082136 3300054114 Bacteria 2704
669 Ga0501084_0125913 3300054114 Bacteria 2156
670 Ga0501084_0137166 3300054114 Bacteria 2059
671 Ga0501084_0148808 3300054114 Bacteria 1973
672 Ga0501084_0197689 3300054114 Bacteria 1696
673 Ga0501084_0239813 3300054114 Bacteria 1530
674 Ga0501084_0250168 3300054114 Bacteria 1496
675 Ga0501082_0000376 3300060353 Bacteria 39540
676 Ga0501082_0009499 3300060353 Bacteria 8371
677 Ga0501082_0018857 3300060353 Bacteria 5943
678 Ga0501082_0028785 3300060353 Bacteria 4785
679 Ga0501082_0029329 3300060353 Bacteria 4739
680 Ga0501082_0284181 3300060353 Bacteria 1440
681 Ga0530510_0000045 3300061734 Bacteria 56772
682 Ga0530510_0000460 3300061734 Bacteria 26308
683 Ga0530510_0002276 3300061734 Bacteria 13172
684 Ga0530510_0002539 3300061734 Bacteria 12540
685 Ga0530510_0015160 3300061734 Bacteria 5442
686 Ga0530510_0017498 3300061734 Bacteria 5081
687 Ga0530510_0037506 3300061734 Bacteria 3496
688 Ga0530510_0069846 3300061734 Bacteria 2549
689 Ga0530510_0092696 3300061734 Bacteria 2205
690 Ga0530510_0134482 3300061734 Bacteria 1820
691 Ga0501082_0256403
692 Ga0065715_10140814
693 Ga0070676_10004889
694 Ga0070676_10019457
695 Ga0070690_100207673
696 Ga0070670_100002651
697 Ga0068869_100000454
698 Ga0068869_100002372
699 Ga0068869_100125073
700 Ga0070680_100025007
701 Ga0070680_100053833
702 Ga0070680_100065726
703 Ga0070682_100000164
704 Ga0070660_100001192
705 Ga0070689_100022172
706 Ga0070691_10049471
707 Ga0070691_10108061
708 Ga0070661_100007596
709 Ga0070692_10000185
710 Ga0070692_10004690
711 Ga0070692_10019280
712 Ga0070669_100069938
713 Ga0070669_100155814
714 Ga0070673_100006759
715 Ga0070688_100085022
716 Ga0070659_100000169
717 Ga0070703_10001360
718 Ga0070703_10067019
719 Ga0070709_10420300
720 Ga0070713_100269868
721 Ga0070701_10000434
722 Ga0070701_10021820
723 Ga0070701_10061258
724 Ga0070705_100000303
725 Ga0070705_100420662
726 Ga0070694_100000153
727 Ga0070694_100000394
728 Ga0070694_100029446
729 Ga0070694_100031508
730 Ga0070708_100002805
731 Ga0070708_100012658
732 Ga0070708_100027139
733 Ga0070708_100098682
734 Ga0070708_100234326
735 Ga0070663_100001895
736 Ga0070662_100090033
737 Ga0070681_10000730
738 Ga0068867_100070635
739 Ga0070706_100002480
740 Ga0070706_100006899
741 Ga0070706_100039579
742 Ga0070706_100067102
743 Ga0070706_100101981
744 Ga0070706_100397654
745 Ga0070707_100003230
746 Ga0070707_100004373
747 Ga0070707_100004480
748 Ga0070707_100006735
749 Ga0070707_100133507
750 Ga0070707_100149079
751 Ga0070707_100220071
752 Ga0070698_100002229
753 Ga0070698_100009682
754 Ga0070698_100015432
755 Ga0070698_100045359
756 Ga0070698_100112955
757 Ga0070698_100246894
758 Ga0070699_100002125
759 Ga0070699_100010069
760 Ga0070699_100016368
761 Ga0070699_100028568
762 Ga0070699_100034353
763 Ga0070699_100057958
764 Ga0070699_100425884
765 Ga0070679_100000780
766 Ga0070679_100151411
767 Ga0070697_100007241
768 Ga0070697_100020405
769 Ga0070697_100043288
770 Ga0070697_100054038
771 Ga0070697_100144847
772 Ga0068853_100001544
773 Ga0070686_100120636
774 Ga0070686_100243678
775 Ga0070695_100002060
776 Ga0070695_100003497
777 Ga0070695_100004742
778 Ga0070695_100005853
779 Ga0070695_100009011
780 Ga0070696_100001302
781 Ga0070696_100032605
782 Ga0070696_100065384
783 Ga0070696_100072427
784 Ga0070696_100178770
785 Ga0070693_100000018
786 Ga0070693_100036024
787 Ga0070704_100008622
788 Ga0070704_100049443
789 Ga0070704_100135223
790 Ga0068855_100000233
791 Ga0070664_100010975
792 Ga0068857_100009717
793 Ga0068854_100001715
794 Ga0068856_100000806
795 Ga0070702_100255630
796 Ga0068859_100006365
797 Ga0068859_100009180
798 Ga0068859_100259722
799 Ga0068864_100004417
800 Ga0068861_100200085
801 Ga0068870_10000059
802 Ga0068858_100040912
803 Ga0068860_100003577
804 Ga0068860_100129312
805 Ga0068862_100004350
806 Ga0068862_100004793
807 Ga0068862_100012292
808 Ga0068862_100022823
809 Ga0068862_100046444
810 Ga0081455_10001251
811 Ga0081455_10219809
812 Ga0081538_10003971
813 Ga0081539_10000092
814 Ga0070716_100031277
815 Ga0070712_100001609
816 Ga0070712_100274552
817 Ga0075428_100000421
818 Ga0075428_100008551
819 Ga0075428_100016534
820 Ga0075428_100029927
821 Ga0075428_100043256
822 Ga0075428_100142719
823 Ga0075428_100143058
824 Ga0075428_100146364
825 Ga0075428_100568227
826 Ga0075430_100000341
827 Ga0075430_100002061
828 Ga0075430_100005238
829 Ga0075430_100007544
830 Ga0075430_100096687
831 Ga0075430_100308728
832 Ga0075431_100000452
833 Ga0075431_100000470
834 Ga0075431_100001171
835 Ga0075431_100002219
836 Ga0075431_100002638
837 Ga0075431_100002902
838 Ga0075431_100004853
839 Ga0075431_100009244
840 Ga0075431_100103039
841 Ga0075431_100103692
842 Ga0075431_100164022
843 Ga0075431_100166959
844 Ga0075431_100175556
845 Ga0075431_100294664
846 Ga0075431_100464602
847 Ga0075431_100538410
848 Ga0075433_10001399
849 Ga0075433_10003027
850 Ga0075433_10003861
851 Ga0075433_10009505
852 Ga0075433_10028302
853 Ga0075433_10029437
854 Ga0075433_10069220
855 Ga0075433_10108867
856 Ga0075433_10120453
857 Ga0075433_10127796
858 Ga0075433_10392078
859 Ga0075433_10417822
860 Ga0075434_100000107
861 Ga0075434_100001918
862 Ga0075434_100002260
863 Ga0075434_100003368
864 Ga0075434_100036682
865 Ga0075434_100065643
866 Ga0075434_100114972
867 Ga0075434_100123165
868 Ga0075434_100244675
869 Ga0075434_100439041
870 Ga0075429_100000305
871 Ga0075429_100003918
872 Ga0075429_100010160
873 Ga0075429_100010628
874 Ga0075429_100013922
875 Ga0075429_100045044
876 Ga0075429_100062017
877 Ga0075429_100066718
878 Ga0075429_100144592
879 Ga0075429_100164495
880 Ga0075429_100266545
881 Ga0075436_100001117
882 Ga0075436_100032734
883 Ga0075436_100073431
884 Ga0075436_100124360
885 Ga0075436_100299249
886 Ga0097620_100006365
887 Ga0097620_100009180
888 Ga0097620_100134776
889 Ga0097620_100259721
890 Ga0075435_100000798
891 Ga0075435_100001899
892 Ga0075435_100004640
893 Ga0075435_100007188
894 Ga0075435_100010546
895 Ga0075435_100029753
896 Ga0075435_100163965
897 Ga0075435_100286482
898 Ga0075435_100366274
899 Ga0099794_10055000
900 Ga0111539_10000557
901 Ga0111539_10008896
902 Ga0111539_10011342
903 Ga0111539_10099499
904 Ga0111539_10109518
905 Ga0111539_10152793
906 Ga0105245_10346129
907 Ga0105247_10097035
908 Ga0114129_10000497
909 Ga0114129_10000704
910 Ga0114129_10000726
911 Ga0114129_10001085
912 Ga0114129_10002365
913 Ga0114129_10002578
914 Ga0114129_10004399
915 Ga0114129_10006119
916 Ga0114129_10006298
917 Ga0114129_10014740
918 Ga0114129_10021486
919 Ga0114129_10034166
920 Ga0114129_10044350
921 Ga0114129_10064549
922 Ga0114129_10072614
923 Ga0114129_10086069
924 Ga0114129_10164893
925 Ga0114129_10169162
926 Ga0114129_10234984
927 Ga0114129_10265070
928 Ga0114129_10271162
929 Ga0114129_10432212
930 Ga0105243_10005054
931 Ga0105243_10061888
932 Ga0105241_10002337
933 Ga0105241_10048576
934 Ga0105248_10292608
935 Ga0105248_10777860
936 Ga0105249_10018869
937 Ga0105249_10106027
938 Ga0105239_10513261
939 Ga0157373_10018199
940 Ga0157369_10028864
941 Ga0157378_10076143
942 Ga0157378_10112151
943 Ga0157378_10454229
944 Ga0163162_10028990
945 Ga0163162_10144116
946 Ga0157372_10000846
947 Ga0157372_10092431
948 Ga0157375_10041557
949 Ga0157375_10336270
950 Ga0182007_10015372
951 Ga0207653_10001521
952 Ga0207653_10007870
953 Ga0207647_10029432
954 Ga0207647_10167732
955 Ga0207699_10317904
956 Ga0207645_10000340
957 Ga0207645_10019898
958 Ga0207643_10000105
959 Ga0207684_10000242
960 Ga0207684_10009125
961 Ga0207684_10025708
962 Ga0207684_10045384
963 Ga0207684_10102886
964 Ga0207684_10110774
965 Ga0207684_10464493
966 Ga0207654_10007386
967 Ga0207654_10107796
968 Ga0207707_10000034
969 Ga0207693_10009502
970 Ga0207693_10189345
971 Ga0207660_10165539
972 Ga0207657_10000066
973 Ga0207649_10027797
974 Ga0207652_10000740
975 Ga0207652_10129849
976 Ga0207646_10000574
977 Ga0207646_10004220
978 Ga0207646_10026137
979 Ga0207646_10033355
980 Ga0207646_10043129
981 Ga0207646_10062589
982 Ga0207646_10077131
983 Ga0207646_10162357
984 Ga0207646_10261551
985 Ga0207681_10005715
986 Ga0207681_10198957
987 Ga0207650_10031007
988 Ga0207700_10219506
989 Ga0207690_10001729
990 Ga0207706_10043062
991 Ga0207706_10245545
992 Ga0207706_10273292
993 Ga0207706_10310932
994 Ga0207709_10048952
995 Ga0207691_10011340
996 Ga0207689_10000365
997 Ga0207689_10004878
998 Ga0207689_10193462
999 Ga0207679_10000248
1000 Ga0207667_10000790
1001 Ga0207651_10030135
1002 Ga0207712_10159424
1003 Ga0207712_10247477
1004 Ga0207640_10003504
1005 Ga0207703_10111134
1006 Ga0207639_10017235
1007 Ga0207678_10002576
1008 Ga0207708_10011344
1009 Ga0207648_10000856
1010 Ga0207648_10110675
1011 Ga0207648_10132025
1012 Ga0207648_10469557
1013 Ga0207676_10024755
1014 Ga0207674_10000050
1015 Ga0207675_100074739
1016 Ga0207675_100466114
1017 Ga0209981_1005557
1018 Ga0209984_1005626
1019 Ga0210000_1003329
1020 Ga0209995_1005718
1021 Ga0209968_1008697
1022 Ga0209983_1002812
1023 Ga0209588_1010800
1024 Ga0209971_1000128
1025 Ga0209966_1000071
1026 Ga0209966_1022285
1027 Ga0209998_10000113
1028 Ga0209974_10022208
1029 Ga0207428_10000033
1030 Ga0207428_10000054
1031 Ga0207428_10022910
1032 Ga0207428_10174593
1033 Ga0268265_10003185
1034 Ga0268265_10008213
1035 Ga0268265_10015396
1036 Ga0268265_10082887
1037 Ga0268264_10004690
1038 Ga0268264_10030442
1039 Ga0268264_10078705
1040 Ga0268264_10095295
1041 Ga0268264_10143668
1042 Ga0307408_100019764
1043 Ga0307408_100289440
1044 Ga0307405_10161862
1045 Ga0307409_100018640
1046 Ga0307409_100035154
1047 Ga0307416_100097447
1048 Ga0307416_100102901
1049 Ga0307411_10528467
1050 Ga0307415_100303893
1051 Ga0373948_0002216
1052 Ga0373959_0012217
1053 Ga0373940_0082375
1054 Ga0373949_0019418
1055 Ga0373951_0001847
1056 Ga0373939_0016956
1057 Ga0373939_0025450
1058 Ga0373960_0005205
1059 Ga0373960_0033821
1060 Ga0373931_0015664
1061 Ga0373931_0069245
1062 Ga0373931_0106101
1063 Ga0395899_0033281
1064 Ga0395900_0003509
1065 Ga0395898_0013339
1066 Ga0395901_0011843
1067 Ga0439448_0000205
1068 Ga0439459_0012281
1069 Ga0439464_0015396
1070 Ga0439460_0000453
1071 Ga0439460_0047034
1072 Ga0451577_0011665
1073 Ga0451577_0013723
1074 Ga0451577_0023769
1075 Ga0451577_0064518
1076 Ga0451577_0163289
1077 Ga0451577_0284928
1078 Ga0453684_0135624
1079 Ga0451576_0017829
1080 Ga0451576_0030449
1081 Ga0451576_0040536
1082 Ga0451576_0042261
1083 Ga0451576_0085237
1084 Ga0451576_0087339
1085 Ga0451576_0111360
1086 Ga0451576_0141805
1087 Ga0495580_0005537
1088 Ga0495580_0351528
1089 Ga0495584_0115460
1090 Ga0495642_0104950
1091 Ga0495598_0026656
1092 Ga0495669_0020026
1093 Ga0495669_0089338
1094 Ga0495636_0048646
1095 Ga0496103_0200311
1096 Ga0496106_0186716
1097 Ga0496106_0210911
1098 Ga0496108_0268576
1099 Ga0496112_0141679
1100 Ga0501033_0063804
1101 Ga0501033_0254184
1102 Ga0501033_0261497
1103 Ga0501036_0040793
1104 Ga0501036_0049407
1105 Ga0501036_0070650
1106 Ga0501036_0088180
1107 Ga0501036_0187665
1108 Ga0501036_0400432
1109 Ga0501038_0007239
1110 Ga0501038_0040088
1111 Ga0501038_0125500
1112 Ga0501038_0152989
1113 Ga0501038_0219693
1114 Ga0501038_0255750
1115 Ga0501039_0003008
1116 Ga0501039_0020459
1117 Ga0501039_0040095
1118 Ga0501039_0109802
1119 Ga0501040_0000372
1120 Ga0501040_0002803
1121 Ga0501040_0012033
1122 Ga0501040_0021721
1123 Ga0501040_0045132
1124 Ga0501040_0088301
1125 Ga0501040_0111366
1126 Ga0501040_0173969
1127 Ga0501040_0230401
1128 Ga0501040_0353630
1129 Ga0501041_0000313
1130 Ga0501041_0003933
1131 Ga0501041_0004305
1132 Ga0501041_0090684
1133 Ga0501041_0167657
1134 Ga0501042_0001568
1135 Ga0501042_0006045
1136 Ga0501042_0127595
1137 Ga0501042_0172982
1138 Ga0501042_0174868
1139 Ga0501042_0269252
1140 Ga0501043_0036352
1141 Ga0501046_0000084
1142 Ga0501046_0004108
1143 Ga0501046_0036544
1144 Ga0501046_0038740
1145 Ga0501046_0174207
1146 Ga0501046_0249105
1147 Ga0501046_0331720
1148 Ga0501048_0003731
1149 Ga0501048_0007331
1150 Ga0501048_0008354
1151 Ga0501068_0050008
1152 Ga0501068_0071379
1153 Ga0501068_0143782
1154 Ga0501068_0166247
1155 Ga0501069_0055638
1156 Ga0501071_0004236
1157 Ga0501071_0022346
1158 Ga0501071_0181561
1159 Ga0501071_0187157
1160 Ga0501071_0396971
1161 Ga0501072_0002328
1162 Ga0501072_0006474
1163 Ga0501072_0011064
1164 Ga0501072_0011625
1165 Ga0501072_0021799
1166 Ga0501072_0038391
1167 Ga0501072_0043833
1168 Ga0501072_0076813
1169 Ga0501072_0273737
1170 Ga0501072_0279597
1171 Ga0501072_0491669
1172 Ga0501074_0002552
1173 Ga0501074_0002904
1174 Ga0501074_0159699
1175 Ga0501074_0191218
1176 Ga0501074_0300827
1177 Ga0501075_0000734
1178 Ga0501075_0000742
1179 Ga0501075_0002306
1180 Ga0501075_0024482
1181 Ga0501075_0024488
1182 Ga0501075_0025151
1183 Ga0501075_0026883
1184 Ga0501075_0030009
1185 Ga0501075_0037620
1186 Ga0501075_0051359
1187 Ga0501075_0063924
1188 Ga0501075_0210943
1189 Ga0501075_0257741
1190 Ga0501075_0280989
1191 Ga0501075_0323316
1192 Ga0501076_0001282
1193 Ga0501076_0001694
1194 Ga0501076_0002350
1195 Ga0501076_0016721
1196 Ga0501076_0017009
1197 Ga0501076_0021097
1198 Ga0501076_0042702
1199 Ga0501076_0103543
1200 Ga0501076_0103709
1201 Ga0501076_0299531
1202 Ga0501077_0001222
1203 Ga0501077_0001630
1204 Ga0501077_0022560
1205 Ga0501077_0035033
1206 Ga0501077_0036677
1207 Ga0501077_0045127
1208 Ga0501077_0192003
1209 Ga0501079_0000347
1210 Ga0501079_0000847
1211 Ga0501079_0001826
1212 Ga0501079_0003926
1213 Ga0501079_0005662
1214 Ga0501079_0024179
1215 Ga0501079_0031768
1216 Ga0501079_0040790
1217 Ga0501079_0044595
1218 Ga0501079_0076646
1219 Ga0501079_0133394
1220 Ga0501079_0183508
1221 Ga0501079_0200500
1222 Ga0501079_0207297
1223 Ga0501080_0000373
1224 Ga0501080_0060310
1225 Ga0501080_0106207
1226 Ga0501080_0117195
1227 Ga0501080_0155503
1228 Ga0501080_0257528
1229 Ga0501081_0002261
1230 Ga0501081_0002829
1231 Ga0501081_0003242
1232 Ga0501081_0005570
1233 Ga0501081_0013375
1234 Ga0501081_0030144
1235 Ga0501081_0038636
1236 Ga0501081_0048334
1237 Ga0501081_0056095
1238 Ga0501081_0089925
1239 Ga0501081_0102409
1240 Ga0501081_0317062
1241 Ga0501081_0337409
1242 Ga0501083_0003803
1243 Ga0501083_0080269
1244 Ga0501083_0135426
1245 Ga0501045_0000024
1246 Ga0501045_0001154
1247 Ga0501045_0202453
1248 Ga0501045_0218662
1249 Ga0501045_0239977
1250 Ga0501045_0303483
1251 nmdc:mga05p37_114160_c1
1252 nmdc:mga05p37_19006_c1
1253 nmdc:mga05p37_227346_c1
1254 nmdc:mga05p37_239485_c1
1255 nmdc:mga05p37_240176_c1
1256 nmdc:mga05p37_280974_c1
1257 nmdc:mga05p37_33272_c1
1258 nmdc:mga05p37_3760_c1
1259 nmdc:mga05p37_423819_c1
1260 nmdc:mga05p37_46194_c1
1261 nmdc:mga05p37_4740_c1
1262 nmdc:mga05p37_50612_c1
1263 nmdc:mga05p37_51237_c1
1264 nmdc:mga05p37_54516_c1
1265 nmdc:mga05p37_55867_c1
1266 nmdc:mga05p37_571_c1
1267 nmdc:mga05p37_7326_c1
1268 nmdc:mga05p37_733_c1
1269 nmdc:mga05p37_7533_c1
1270 nmdc:mga05p37_9265_c1
1271 nmdc:mga09592_10815_c1
1272 nmdc:mga09592_13717_c1
1273 nmdc:mga09592_13762_c1
1274 nmdc:mga09592_218002_c1
1275 nmdc:mga09592_227935_c1
1276 nmdc:mga09592_32609_c1
1277 nmdc:mga09592_33695_c1
1278 nmdc:mga09592_36768_c1
1279 nmdc:mga09592_44015_c1
1280 nmdc:mga09592_47056_c1
1281 nmdc:mga09592_5510_c1
1282 nmdc:mga09592_56_c1
1283 nmdc:mga09592_6707_c1
1284 nmdc:mga0qj67_18157_c1
1285 nmdc:mga0qj67_28264_c1
1286 nmdc:mga0qj67_300724_c1
1287 nmdc:mga0qj67_3409_c1
1288 nmdc:mga0qj67_4522_c1
1289 nmdc:mga0qj67_639520_c1
1290 nmdc:mga0qj67_711_c1
1291 nmdc:mga0qj67_761_c1
1292 nmdc:mga0qj67_85066_c1
1293 nmdc:mga06r32_1136_c1
1294 nmdc:mga06r32_12631_c1
1295 nmdc:mga06r32_132_c1
1296 nmdc:mga06r32_214774_c1
1297 nmdc:mga06r32_295283_c1
1298 nmdc:mga06r32_344052_c1
1299 nmdc:mga06r32_37690_c1
1300 nmdc:mga06r32_380548_c1
1301 nmdc:mga06r32_428_c1
1302 nmdc:mga06r32_48513_c1
1303 nmdc:mga06r32_53897_c1
1304 nmdc:mga06r32_701929_c1
1305 nmdc:mga06r32_8388_c1
1306 nmdc:mga08y16_101940_c1
1307 nmdc:mga08y16_13982_c1
1308 nmdc:mga08y16_15975_c1
1309 nmdc:mga08y16_165516_c1
1310 nmdc:mga08y16_272246_c1
1311 nmdc:mga08y16_3397_c1
1312 nmdc:mga08y16_589741_c1
1313 nmdc:mga0n895_10415_c1
1314 nmdc:mga0n895_162730_c1
1315 nmdc:mga0n895_176712_c1
1316 nmdc:mga0n895_191_c1
1317 nmdc:mga0n895_232972_c1
1318 nmdc:mga0n895_26_c1
1319 nmdc:mga0n895_2702_c1
1320 nmdc:mga0n895_356462_c1
1321 nmdc:mga0n895_37967_c1
1322 nmdc:mga0n895_74710_c1
1323 nmdc:mga0n895_79039_c1
1324 nmdc:mga0n895_91060_c1
1325 nmdc:mga0rr50_17563_c1
1326 nmdc:mga0rr50_1853_c1
1327 nmdc:mga0rr50_23170_c1
1328 nmdc:mga0rr50_25401_c1
1329 nmdc:mga0rr50_5485_c1
1330 nmdc:mga0rr50_79664_c1
1331 nmdc:mga0rr50_95422_c1
1332 nmdc:mga08x19_106914_c1
1333 nmdc:mga08x19_111959_c1
1334 nmdc:mga08x19_132107_c1
1335 nmdc:mga08x19_223715_c1
1336 nmdc:mga08x19_224099_c1
1337 nmdc:mga08x19_3113_c1
1338 nmdc:mga08x19_399_c1
1339 nmdc:mga08x19_87694_c1
1340 nmdc:mga0a205_123092_c1
1341 nmdc:mga0a205_225470_c1
1342 nmdc:mga0a205_25642_c1
1343 nmdc:mga0a205_25936_c1
1344 nmdc:mga0a205_3171_c1
1345 nmdc:mga0a205_329_c1
1346 nmdc:mga0a205_32_c1
1347 nmdc:mga0a205_332962_c1
1348 nmdc:mga0a205_47042_c1
1349 nmdc:mga0a205_5347_c1
1350 Ga0495601_0000902
1351 Ga0495595_0051409
1352 Ga0495619_0021234
1353 Ga0501084_0000494
1354 Ga0501084_0002049
1355 Ga0501084_0002997
1356 Ga0501084_0004153
1357 Ga0501084_0007499
1358 Ga0501084_0082136
1359 Ga0501084_0125913
1360 Ga0501084_0137166
1361 Ga0501084_0148808
1362 Ga0501084_0197689
1363 Ga0501084_0239813
1364 Ga0501084_0250168
1365 Ga0501082_0000376
1366 Ga0501082_0009499
1367 Ga0501082_0018857
1368 Ga0501082_0028785
1369 Ga0501082_0029329
1370 Ga0501082_0284181
1371 Ga0530510_0000045
1372 Ga0530510_0000460
1373 Ga0530510_0002276
1374 Ga0530510_0002539
1375 Ga0530510_0015160
1376 Ga0530510_0017498
1377 Ga0530510_0037506
1378 Ga0530510_0069846
1379 Ga0530510_0092696
1380 Ga0530510_0134482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

23

310

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aec-assembly1.cif.gz_B crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c 0.9611 12 313
2eco-assembly1.cif.gz_A crystal structure of t.th. hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate 0.9597 17 313
7n2t-assembly1.cif.gz_A-2 o-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound 0.959 12 310
3spx-assembly1.cif.gz_A crystal structure of o-acetyl serine sulfhydrylase from leishmania donovani 0.9584 15 313
1z7y-assembly1.cif.gz_A crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant 0.9576 12 313
ID Description Score Start End Superfamily
af_K7L749_143_229_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9647 158 244 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9631 57 157 3.40.50.1100
3dkiB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9581 56 165 3.40.50.1100
af_A0A0P0WXY8_178_256_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9575 158 223 3.40.50.1100
af_K7L749_14_232_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.956 21 246 2.10.25.10
ID Description Score Start End GO Terms
AF-A0A5K1GAW8-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9926 76 161
AF-A0A5K1BS56-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.992 76 162
AF-B7TQG2-F1-model_v4 Putative mitochondrial cysteine synthase 0.9825 56 267
AF-A0A7S0JKB7-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.981 70 169 GO:0016020
AF-C6SAH1-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9798 63 234 GO:0004124

Map