F475488

General Info

Members Datasets Scaffolds Average Seq Length
690 341 1380 90

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_1407393|Ga0501039_1407393_166_471
Length 101
Sequence MMISGGPRGSSKHRPVFHGVVLAIGFVVGGVLTQVARRFLPPGAVKEFLTTGVTPSFGPLPIDLVILKFALGPVALDVSLLSLVGVLVAYLIARSLFWELV

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
304 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
305 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
306 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
307 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
308 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
309 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
310 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
311 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
312 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
319 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 3.19
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 29.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_1407393 3300049575 Unclassified 537
2 MBSR1b_contig_8116297 2162886012 Bacteria 1165
3 JGI25406J46586_10014112 3300003203 Bacteria 3405
4 Ga0058863_11799423 3300004799 Bacteria 1153
5 Ga0058861_10027692 3300004800 Bacteria 1114
6 Ga0058861_11318377 3300004800 Unclassified 522
7 Ga0058861_11777001 3300004800 Bacteria 776
8 Ga0058862_12621214 3300004803 Unclassified 552
9 Ga0058862_12842556 3300004803 Bacteria 652
10 Ga0065712_10295115 3300005290 Bacteria 870
11 Ga0065715_10112742 3300005293 Bacteria 2518
12 Ga0070658_10597039 3300005327 Bacteria 957
13 Ga0070676_10171216 3300005328 Bacteria 1405
14 Ga0070683_100011473 3300005329 Bacteria 7663
15 Ga0070683_100677428 3300005329 Bacteria 987
16 Ga0070683_100788366 3300005329 Bacteria 911
17 Ga0070683_100892487 3300005329 Bacteria 853
18 Ga0070683_101101072 3300005329 Unclassified 763
19 Ga0070683_101664930 3300005329 Bacteria 613
20 Ga0070683_101678505 3300005329 Bacteria 611
21 Ga0070690_100146962 3300005330 Bacteria 1605
22 Ga0068869_100342373 3300005334 Bacteria 1217
23 Ga0068869_100848485 3300005334 Unclassified 788
24 Ga0070666_11026168 3300005335 Unclassified 612
25 Ga0070680_100019199 3300005336 Bacteria 5416
26 Ga0070680_100174199 3300005336 Unclassified 1811
27 Ga0070680_100248183 3300005336 Bacteria 1505
28 Ga0070680_100305153 3300005336 Bacteria 1350
29 Ga0070680_100841628 3300005336 Bacteria 791
30 Ga0070680_100906830 3300005336 Bacteria 760
31 Ga0070682_100043357 3300005337 Unclassified 2781
32 Ga0070682_100443562 3300005337 Unclassified 992
33 Ga0068868_100019736 3300005338 Bacteria 5054
34 Ga0068868_100042234 3300005338 Bacteria 3557
35 Ga0068868_100459985 3300005338 Bacteria 1108
36 Ga0070689_100332743 3300005340 Bacteria 1270
37 Ga0070691_10023773 3300005341 Bacteria 2847
38 Ga0070691_10053326 3300005341 Bacteria 1934
39 Ga0070691_10086981 3300005341 Bacteria 1537
40 Ga0070687_101273624 3300005343 Bacteria 545
41 Ga0070661_100118570 3300005344 Bacteria 1980
42 Ga0070661_100132927 3300005344 Bacteria 1870
43 Ga0070661_100145950 3300005344 Bacteria 1786
44 Ga0070661_100447311 3300005344 Bacteria 1028
45 Ga0070661_100790428 3300005344 Bacteria 778
46 Ga0070661_100821561 3300005344 Bacteria 764
47 Ga0070692_10068806 3300005345 Unclassified 1882
48 Ga0070692_10359826 3300005345 Bacteria 907
49 Ga0070692_10382365 3300005345 Bacteria 884
50 Ga0070692_10398832 3300005345 Unclassified 868
51 Ga0070692_10510244 3300005345 Bacteria 781
52 Ga0070669_100170330 3300005353 Bacteria 1697
53 Ga0070675_100452447 3300005354 Bacteria 1152
54 Ga0070675_101282058 3300005354 Bacteria 675
55 Ga0070675_101606869 3300005354 Bacteria 600
56 Ga0070674_100016557 3300005356 Bacteria 4622
57 Ga0070674_100078155 3300005356 Bacteria 2358
58 Ga0070674_100146370 3300005356 Bacteria 1779
59 Ga0070673_101068400 3300005364 Bacteria 753
60 Ga0070673_101486133 3300005364 Bacteria 639
61 Ga0070659_101748487 3300005366 Bacteria 556
62 Ga0070667_101779237 3300005367 Unclassified 580
63 Ga0070703_10046488 3300005406 Bacteria 1372
64 Ga0070709_10312010 3300005434 Bacteria 1151
65 Ga0070709_10498259 3300005434 Bacteria 925
66 Ga0070709_10610396 3300005434 Unclassified 841
67 Ga0070714_100004782 3300005435 Bacteria 10261
68 Ga0070714_100075227 3300005435 Bacteria 2930
69 Ga0070714_100888903 3300005435 Bacteria 865
70 Ga0070714_102075426 3300005435 Bacteria 554
71 Ga0070713_100256634 3300005436 Unclassified 1596
72 Ga0070710_10260070 3300005437 Bacteria 1119
73 Ga0070710_10862816 3300005437 Unclassified 651
74 Ga0070701_10647251 3300005438 Unclassified 705
75 Ga0070711_100533347 3300005439 Bacteria 972
76 Ga0070705_100389585 3300005440 Unclassified 1028
77 Ga0070705_100675803 3300005440 Bacteria 808
78 Ga0070700_100029343 3300005441 Bacteria 3279
79 Ga0070700_100135577 3300005441 Bacteria 1666
80 Ga0070700_100259016 3300005441 Bacteria 1252
81 Ga0070700_100401045 3300005441 Bacteria 1031
82 Ga0070700_101969041 3300005441 Bacteria 506
83 Ga0070694_100349830 3300005444 Unclassified 1144
84 Ga0070694_100582448 3300005444 Bacteria 899
85 Ga0070694_100755075 3300005444 Unclassified 795
86 Ga0070694_101151802 3300005444 Unclassified 648
87 Ga0070678_100106339 3300005456 Unclassified 2186
88 Ga0070678_100107393 3300005456 Bacteria 2177
89 Ga0070678_102077630 3300005456 Bacteria 538
90 Ga0070662_100033800 3300005457 Unclassified 3602
91 Ga0070662_100220988 3300005457 Bacteria 1511
92 Ga0070662_100954610 3300005457 Bacteria 733
93 Ga0070662_101301470 3300005457 Bacteria 625
94 Ga0070681_10001135 3300005458 Bacteria 22891
95 Ga0070681_10002466 3300005458 Bacteria 16944
96 Ga0070681_10072220 3300005458 Unclassified 3414
97 Ga0070681_10228608 3300005458 Bacteria 1774
98 Ga0070681_10345675 3300005458 Bacteria 1398
99 Ga0070681_10360964 3300005458 Unclassified 1363
100 Ga0070681_10719055 3300005458 Bacteria 915
101 Ga0070681_11354947 3300005458 Unclassified 635
102 Ga0070681_11364927 3300005458 Unclassified 632
103 Ga0068867_100207188 3300005459 Bacteria 1573
104 Ga0068867_100987657 3300005459 Unclassified 762
105 Ga0070706_101332211 3300005467 Bacteria 658
106 Ga0070707_100008957 3300005468 Bacteria 9282
107 Ga0070707_100347453 3300005468 Bacteria 1441
108 Ga0070707_100517879 3300005468 Bacteria 1155
109 Ga0070698_100010819 3300005471 Bacteria 9711
110 Ga0070699_100347628 3300005518 Bacteria 1335
111 Ga0070699_100465079 3300005518 Bacteria 1147
112 Ga0070699_100784725 3300005518 Unclassified 872
113 Ga0070699_102201165 3300005518 Unclassified 503
114 Ga0070699_102208857 3300005518 Unclassified 502
115 Ga0070679_100000632 3300005530 Bacteria 30006
116 Ga0070679_100009167 3300005530 Bacteria 9343
117 Ga0070679_100018930 3300005530 Bacteria 6686
118 Ga0070679_100022573 3300005530 Bacteria 6151
119 Ga0070679_100044087 3300005530 Bacteria 4443
120 Ga0070679_100099665 3300005530 Bacteria 2892
121 Ga0070679_100104713 3300005530 Bacteria 2815
122 Ga0070679_100279715 3300005530 Bacteria 1622
123 Ga0070679_100347100 3300005530 Bacteria 1432
124 Ga0070679_100422701 3300005530 Bacteria 1278
125 Ga0070679_100826388 3300005530 Bacteria 870
126 Ga0070679_101654547 3300005530 Unclassified 588
127 Ga0070679_101718784 3300005530 Bacteria 575
128 Ga0070684_100005212 3300005535 Bacteria 9942
129 Ga0070684_100024142 3300005535 Bacteria 5097
130 Ga0070684_100049140 3300005535 Bacteria 3660
131 Ga0070684_100285889 3300005535 Bacteria 1511
132 Ga0070684_100797511 3300005535 Unclassified 883
133 Ga0070684_101924111 3300005535 Bacteria 558
134 Ga0070697_100047867 3300005536 Bacteria 3466
135 Ga0070697_100118026 3300005536 Bacteria 2216
136 Ga0070697_100498167 3300005536 Bacteria 1065
137 Ga0070697_100525038 3300005536 Bacteria 1037
138 Ga0068853_100134882 3300005539 Bacteria 2212
139 Ga0068853_100617997 3300005539 Bacteria 1030
140 Ga0068853_100918393 3300005539 Bacteria 841
141 Ga0068853_101126938 3300005539 Bacteria 757
142 Ga0068853_102253117 3300005539 Unclassified 528
143 Ga0070686_100057439 3300005544 Unclassified 2500
144 Ga0070686_100473541 3300005544 Bacteria 967
145 Ga0070695_100109647 3300005545 Bacteria 1871
146 Ga0070695_100293642 3300005545 Bacteria 1199
147 Ga0070695_100542567 3300005545 Unclassified 905
148 Ga0070696_100000112 3300005546 Bacteria 41636
149 Ga0070696_100186248 3300005546 Bacteria 1542
150 Ga0070696_100387431 3300005546 Bacteria 1091
151 Ga0070696_100422506 3300005546 Bacteria 1047
152 Ga0070696_100830484 3300005546 Unclassified 762
153 Ga0070696_101331931 3300005546 Unclassified 610
154 Ga0070696_101610850 3300005546 Unclassified 558
155 Ga0070693_100003376 3300005547 Bacteria 7427
156 Ga0070693_100005815 3300005547 Bacteria 5956
157 Ga0070693_100037527 3300005547 Bacteria 2702
158 Ga0070693_100098469 3300005547 Bacteria 1777
159 Ga0068855_100011799 3300005563 Bacteria 10564
160 Ga0068855_100022430 3300005563 Bacteria 7568
161 Ga0068855_100546602 3300005563 Bacteria 1254
162 Ga0068855_101703875 3300005563 Unclassified 643
163 Ga0068855_101989599 3300005563 Bacteria 587
164 Ga0070664_100030319 3300005564 Bacteria 4512
165 Ga0070664_100236251 3300005564 Bacteria 1639
166 Ga0068857_100007730 3300005577 Bacteria 9263
167 Ga0068857_102530640 3300005577 Unclassified 504
168 Ga0068854_100318071 3300005578 Unclassified 1264
169 Ga0068854_100504178 3300005578 Bacteria 1020
170 Ga0068854_100615727 3300005578 Bacteria 929
171 Ga0068854_100831541 3300005578 Unclassified 807
172 Ga0070702_100045295 3300005615 Bacteria 2488
173 Ga0068852_100652069 3300005616 Bacteria 1060
174 Ga0068864_100481791 3300005618 Bacteria 1191
175 Ga0068864_102057398 3300005618 Unclassified 577
176 Ga0068866_10237455 3300005718 Bacteria 1108
177 Ga0068861_100832659 3300005719 Bacteria 868
178 Ga0068870_11337539 3300005840 Unclassified 523
179 Ga0068863_101670418 3300005841 Unclassified 646
180 Ga0068858_101048883 3300005842 Bacteria 800
181 Ga0068860_100430371 3300005843 Bacteria 1309
182 Ga0081455_10038853 3300005937 Unclassified 4212
183 Ga0081539_10000104 3300005985 Bacteria 197478
184 Ga0075432_10513436 3300006058 Bacteria 536
185 Ga0070716_100147859 3300006173 Bacteria 1507
186 Ga0070716_100410981 3300006173 Unclassified 976
187 Ga0070716_100467765 3300006173 Unclassified 923
188 Ga0070712_100098017 3300006175 Bacteria 2162
189 Ga0070712_100166331 3300006175 Bacteria 1707
190 Ga0097621_100415247 3300006237 Bacteria 1207
191 Ga0075370_10985419 3300006353 Unclassified 516
192 Ga0068871_100373121 3300006358 Unclassified 1266
193 Ga0075430_100000326 3300006846 Bacteria 34031
194 Ga0075430_100012295 3300006846 Bacteria 7283
195 Ga0075430_100026854 3300006846 Bacteria 4896
196 Ga0075430_100114706 3300006846 Unclassified 2245
197 Ga0075430_100397415 3300006846 Bacteria 1138
198 Ga0075431_100007659 3300006847 Bacteria 10754
199 Ga0075431_100209549 3300006847 Bacteria 1991
200 Ga0075431_100902005 3300006847 Unclassified 853
201 Ga0075431_101013557 3300006847 Unclassified 797
202 Ga0075433_10038019 3300006852 Bacteria 4155
203 Ga0075433_10703244 3300006852 Bacteria 885
204 Ga0075434_100942013 3300006871 Bacteria 878
205 Ga0075429_100138187 3300006880 Bacteria 2133
206 Ga0075429_100241064 3300006880 Bacteria 1584
207 Ga0075429_100953909 3300006880 Unclassified 750
208 Ga0068865_100041493 3300006881 Unclassified 3132
209 Ga0075436_100048673 3300006914 Bacteria 2925
210 Ga0075436_100062363 3300006914 Bacteria 2576
211 Ga0075436_100489189 3300006914 Unclassified 899
212 Ga0075436_101348680 3300006914 Bacteria 540
213 Ga0075435_100141539 3300007076 Bacteria 2018
214 Ga0075435_100195679 3300007076 Bacteria 1712
215 Ga0075435_101161991 3300007076 Bacteria 675
216 Ga0099794_10378697 3300007265 Bacteria 738
217 Ga0099795_10030239 3300007788 Bacteria 1857
218 Ga0105240_10080310 3300009093 Bacteria 4011
219 Ga0105240_10253885 3300009093 Bacteria 2032
220 Ga0111539_10043395 3300009094 Bacteria 5390
221 Ga0111539_10221260 3300009094 Bacteria 2205
222 Ga0111539_11406702 3300009094 Bacteria 809
223 Ga0105245_10315671 3300009098 Bacteria 1538
224 Ga0114129_10096733 3300009147 Bacteria 4087
225 Ga0114129_10899004 3300009147 Unclassified 1122
226 Ga0114129_13198174 3300009147 Unclassified 533
227 Ga0105243_10890795 3300009148 Bacteria 884
228 Ga0105241_10311843 3300009174 Bacteria 1353
229 Ga0105241_12356110 3300009174 Unclassified 531
230 Ga0105242_10751874 3300009176 Bacteria 960
231 Ga0105248_10526728 3300009177 Unclassified 1333
232 Ga0105237_10024807 3300009545 Bacteria 6136
233 Ga0105237_10157722 3300009545 Bacteria 2267
234 Ga0105237_11335760 3300009545 Unclassified 723
235 Ga0105238_11087444 3300009551 Bacteria 822
236 Ga0105249_10569365 3300009553 Bacteria 1185
237 Ga0105249_11617407 3300009553 Bacteria 720
238 Ga0105249_11798577 3300009553 Unclassified 685
239 Ga0099796_10039110 3300010159 Unclassified 1595
240 Ga0105239_10245145 3300010375 Bacteria 2011
241 Ga0105239_10744560 3300010375 Bacteria 1122
242 Ga0105239_11041897 3300010375 Bacteria 941
243 Ga0105239_11254921 3300010375 Unclassified 854
244 Ga0105246_10646872 3300011119 Bacteria 920
245 Ga0157373_10276246 3300013100 Bacteria 1190
246 Ga0157373_10366529 3300013100 Unclassified 1029
247 Ga0157373_10384763 3300013100 Bacteria 1004
248 Ga0157373_10842212 3300013100 Bacteria 678
249 Ga0157373_11532238 3300013100 Unclassified 509
250 Ga0157371_10379747 3300013102 Bacteria 1032
251 Ga0157371_11337385 3300013102 Unclassified 555
252 Ga0157370_10048640 3300013104 Unclassified 4062
253 Ga0157369_10019510 3300013105 Bacteria 7587
254 Ga0157369_10606904 3300013105 Unclassified 1129
255 Ga0157369_11053524 3300013105 Bacteria 832
256 Ga0157369_12483900 3300013105 Unclassified 525
257 Ga0157374_10035130 3300013296 Unclassified 4584
258 Ga0157374_10053312 3300013296 Bacteria 3770
259 Ga0157378_10045413 3300013297 Unclassified 3903
260 Ga0157378_10220020 3300013297 Bacteria 1805
261 Ga0157378_12668340 3300013297 Unclassified 552
262 Ga0163162_11139971 3300013306 Bacteria 884
263 Ga0163162_12841382 3300013306 Bacteria 557
264 Ga0157372_10025764 3300013307 Bacteria 6397
265 Ga0157372_10054352 3300013307 Bacteria 4466
266 Ga0157372_10249575 3300013307 Unclassified 2060
267 Ga0157372_10486798 3300013307 Unclassified 1438
268 Ga0157372_10501689 3300013307 Unclassified 1415
269 Ga0157372_10852897 3300013307 Unclassified 1057
270 Ga0157372_13144215 3300013307 Unclassified 527
271 Ga0157375_12606973 3300013308 Bacteria 604
272 Ga0157380_11040112 3300014326 Bacteria 855
273 Ga0157380_11941999 3300014326 Unclassified 650
274 Ga0157377_10203569 3300014745 Bacteria 1258
275 Ga0157377_10285728 3300014745 Unclassified 1083
276 Ga0182007_10246074 3300015262 Unclassified 640
277 Ga0182007_10355827 3300015262 Bacteria 551
278 Ga0163161_11793278 3300017792 Unclassified 545
279 Ga0197907_10074091 3300020069 Unclassified 536
280 Ga0206356_11077348 3300020070 Unclassified 859
281 Ga0206356_11763208 3300020070 Bacteria 2431
282 Ga0206352_10215765 3300020078 Bacteria 2559
283 Ga0206352_11184165 3300020078 Bacteria 703
284 Ga0213876_10111178 3300021384 Bacteria 1454
285 Ga0224712_10436516 3300022467 Unclassified 627
286 Ga0207653_10289472 3300025885 Unclassified 633
287 Ga0207642_10272143 3300025899 Bacteria 970
288 Ga0207710_10635185 3300025900 Bacteria 559
289 Ga0207699_10149968 3300025906 Bacteria 1542
290 Ga0207699_10316225 3300025906 Bacteria 1094
291 Ga0207699_10866280 3300025906 Unclassified 666
292 Ga0207645_10007217 3300025907 Bacteria 7871
293 Ga0207645_10137369 3300025907 Bacteria 1592
294 Ga0207645_10163135 3300025907 Bacteria 1458
295 Ga0207705_10494410 3300025909 Bacteria 950
296 Ga0207705_11510966 3300025909 Unclassified 508
297 Ga0207684_10016933 3300025910 Bacteria 6261
298 Ga0207684_10317655 3300025910 Bacteria 1342
299 Ga0207654_10696928 3300025911 Unclassified 729
300 Ga0207654_10699637 3300025911 Unclassified 728
301 Ga0207707_10001737 3300025912 Bacteria 20030
302 Ga0207707_10001810 3300025912 Bacteria 19629
303 Ga0207707_10009380 3300025912 Bacteria 8489
304 Ga0207707_10015911 3300025912 Bacteria 6560
305 Ga0207707_10177484 3300025912 Bacteria 1860
306 Ga0207707_10258077 3300025912 Bacteria 1513
307 Ga0207707_10444001 3300025912 Bacteria 1110
308 Ga0207707_10462229 3300025912 Unclassified 1085
309 Ga0207707_10474066 3300025912 Bacteria 1069
310 Ga0207707_10511675 3300025912 Unclassified 1023
311 Ga0207707_10842257 3300025912 Unclassified 761
312 Ga0207707_11065090 3300025912 Bacteria 661
313 Ga0207695_10021491 3300025913 Bacteria 7361
314 Ga0207695_10306370 3300025913 Bacteria 1479
315 Ga0207695_10546377 3300025913 Bacteria 1040
316 Ga0207671_10027789 3300025914 Unclassified 4229
317 Ga0207671_10170768 3300025914 Bacteria 1688
318 Ga0207693_10034668 3300025915 Unclassified 3981
319 Ga0207663_10575816 3300025916 Bacteria 882
320 Ga0207663_11571723 3300025916 Unclassified 529
321 Ga0207660_10006824 3300025917 Bacteria 7391
322 Ga0207660_10052118 3300025917 Bacteria 2912
323 Ga0207660_10136803 3300025917 Unclassified 1870
324 Ga0207660_10355593 3300025917 Bacteria 1174
325 Ga0207660_10597799 3300025917 Unclassified 898
326 Ga0207660_10968689 3300025917 Unclassified 694
327 Ga0207657_10639747 3300025919 Bacteria 828
328 Ga0207649_10014824 3300025920 Bacteria 4371
329 Ga0207649_10359261 3300025920 Unclassified 1080
330 Ga0207649_10398785 3300025920 Bacteria 1029
331 Ga0207652_10006744 3300025921 Bacteria 9254
332 Ga0207652_10018156 3300025921 Bacteria 5765
333 Ga0207652_10026442 3300025921 Bacteria 4834
334 Ga0207652_10057821 3300025921 Bacteria 3340
335 Ga0207652_10077922 3300025921 Bacteria 2893
336 Ga0207652_10345003 3300025921 Bacteria 1344
337 Ga0207652_10380017 3300025921 Bacteria 1275
338 Ga0207652_10963484 3300025921 Bacteria 751
339 Ga0207652_11172542 3300025921 Bacteria 670
340 Ga0207652_11379470 3300025921 Bacteria 608
341 Ga0207646_10060876 3300025922 Bacteria 3371
342 Ga0207646_10435250 3300025922 Unclassified 1183
343 Ga0207646_10805958 3300025922 Bacteria 836
344 Ga0207681_10235708 3300025923 Bacteria 1422
345 Ga0207694_10899105 3300025924 Bacteria 749
346 Ga0207687_10079034 3300025927 Bacteria 2370
347 Ga0207687_10617300 3300025927 Bacteria 915
348 Ga0207687_11378220 3300025927 Unclassified 606
349 Ga0207700_10378865 3300025928 Unclassified 1237
350 Ga0207700_10485723 3300025928 Bacteria 1092
351 Ga0207664_10092538 3300025929 Unclassified 2482
352 Ga0207664_10752210 3300025929 Bacteria 876
353 Ga0207644_10372355 3300025931 Bacteria 1164
354 Ga0207644_10997340 3300025931 Unclassified 703
355 Ga0207690_10525648 3300025932 Unclassified 959
356 Ga0207690_10924276 3300025932 Bacteria 724
357 Ga0207706_10033043 3300025933 Unclassified 4605
358 Ga0207706_10238511 3300025933 Bacteria 1590
359 Ga0207686_10759338 3300025934 Bacteria 775
360 Ga0207670_10209187 3300025936 Bacteria 1487
361 Ga0207669_10047033 3300025937 Bacteria 2553
362 Ga0207669_10057845 3300025937 Bacteria 2363
363 Ga0207669_11218211 3300025937 Bacteria 638
364 Ga0207669_11513019 3300025937 Unclassified 572
365 Ga0207704_10064956 3300025938 Unclassified 2283
366 Ga0207665_10055688 3300025939 Bacteria 2669
367 Ga0207665_10504770 3300025939 Unclassified 935
368 Ga0207711_10549680 3300025941 Bacteria 1077
369 Ga0207661_10012599 3300025944 Bacteria 6153
370 Ga0207661_10039533 3300025944 Bacteria 3702
371 Ga0207661_10107421 3300025944 Unclassified 2354
372 Ga0207661_10292656 3300025944 Unclassified 1458
373 Ga0207661_11899023 3300025944 Bacteria 541
374 Ga0207661_12045224 3300025944 Bacteria 519
375 Ga0207679_10235103 3300025945 Bacteria 1549
376 Ga0207679_10433579 3300025945 Bacteria 1162
377 Ga0207679_10892011 3300025945 Bacteria 813
378 Ga0207667_10099482 3300025949 Bacteria 3000
379 Ga0207667_10545510 3300025949 Bacteria 1173
380 Ga0207667_10814757 3300025949 Bacteria 929
381 Ga0207651_10693268 3300025960 Bacteria 897
382 Ga0207651_10785102 3300025960 Bacteria 844
383 Ga0207640_10315283 3300025981 Unclassified 1243
384 Ga0207640_10691847 3300025981 Bacteria 873
385 Ga0207640_10702259 3300025981 Bacteria 867
386 Ga0207640_11781171 3300025981 Bacteria 556
387 Ga0207658_10637324 3300025986 Bacteria 960
388 Ga0207677_10020968 3300026023 Bacteria 3983
389 Ga0207677_10394506 3300026023 Bacteria 1172
390 Ga0207677_10413698 3300026023 Bacteria 1147
391 Ga0207677_10480110 3300026023 Unclassified 1071
392 Ga0207703_10389076 3300026035 Bacteria 1291
393 Ga0207639_11350557 3300026041 Bacteria 669
394 Ga0207678_10559198 3300026067 Bacteria 1001
395 Ga0207678_10759784 3300026067 Bacteria 855
396 Ga0207708_10087668 3300026075 Bacteria 2397
397 Ga0207708_10104060 3300026075 Unclassified 2199
398 Ga0207708_10232179 3300026075 Bacteria 1481
399 Ga0207702_10400869 3300026078 Unclassified 1323
400 Ga0207648_10683815 3300026089 Bacteria 950
401 Ga0207648_11079052 3300026089 Unclassified 753
402 Ga0207674_10042993 3300026116 Bacteria 4661
403 Ga0207675_100321291 3300026118 Bacteria 1511
404 Ga0207675_100852379 3300026118 Bacteria 926
405 Ga0207683_10001656 3300026121 Bacteria 19930
406 Ga0207683_11061140 3300026121 Bacteria 752
407 Ga0207683_12083392 3300026121 Unclassified 515
408 Ga0209981_1004969 3300027378 Bacteria 1759
409 Ga0209996_1024573 3300027395 Bacteria 859
410 Ga0209995_1024471 3300027471 Bacteria 1005
411 Ga0209179_1134858 3300027512 Unclassified 552
412 Ga0209968_1029076 3300027526 Unclassified 919
413 Ga0209999_1081061 3300027543 Unclassified 626
414 Ga0210002_1054275 3300027617 Unclassified 694
415 Ga0209983_1047532 3300027665 Unclassified 935
416 Ga0209966_1065838 3300027695 Unclassified 788
417 Ga0209974_10022347 3300027876 Bacteria 2095
418 Ga0268265_11251738 3300028380 Bacteria 741
419 Ga0268264_10979859 3300028381 Bacteria 851
420 Ga0265332_10005750 3300031238 Bacteria 5696
421 Ga0265327_10018835 3300031251 Bacteria 4265
422 Ga0307408_100012011 3300031548 Bacteria 5734
423 Ga0307408_100012101 3300031548 Bacteria 5713
424 Ga0307408_100219286 3300031548 Unclassified 1551
425 Ga0307408_101508781 3300031548 Unclassified 636
426 Ga0307408_101566504 3300031548 Bacteria 625
427 Ga0307408_101858171 3300031548 Bacteria 577
428 Ga0265314_10005807 3300031711 Bacteria 11056
429 Ga0307405_10007912 3300031731 Bacteria 5357
430 Ga0307405_10161071 3300031731 Unclassified 1589
431 Ga0307405_10212676 3300031731 Bacteria 1413
432 Ga0307413_10014651 3300031824 Bacteria 3991
433 Ga0307413_10037017 3300031824 Unclassified 2815
434 Ga0307413_12149997 3300031824 Unclassified 505
435 Ga0307410_10001526 3300031852 Bacteria 10535
436 Ga0307410_10023288 3300031852 Unclassified 3847
437 Ga0307410_10312039 3300031852 Bacteria 1245
438 Ga0307410_10379063 3300031852 Bacteria 1138
439 Ga0307406_10007384 3300031901 Bacteria 6094
440 Ga0307406_10024698 3300031901 Bacteria 3592
441 Ga0307406_10026330 3300031901 Bacteria 3491
442 Ga0307406_10583163 3300031901 Unclassified 920
443 Ga0307406_10593073 3300031901 Bacteria 913
444 Ga0307406_10687340 3300031901 Bacteria 853
445 Ga0307407_10019250 3300031903 Bacteria 3472
446 Ga0307407_10042332 3300031903 Unclassified 2553
447 Ga0307407_10288326 3300031903 Bacteria 1140
448 Ga0307407_10426857 3300031903 Bacteria 957
449 Ga0307407_11106584 3300031903 Unclassified 616
450 Ga0307412_10031963 3300031911 Unclassified 3329
451 Ga0307412_10562964 3300031911 Bacteria 959
452 Ga0307412_10640941 3300031911 Bacteria 905
453 Ga0307412_10665063 3300031911 Bacteria 890
454 Ga0307412_10771618 3300031911 Unclassified 832
455 Ga0307409_100000517 3300031995 Bacteria 16635
456 Ga0307409_100012829 3300031995 Bacteria 5359
457 Ga0307409_100026166 3300031995 Bacteria 4110
458 Ga0307409_100602353 3300031995 Unclassified 1086
459 Ga0307409_101626808 3300031995 Bacteria 674
460 Ga0307409_102348555 3300031995 Unclassified 562
461 Ga0307416_100003561 3300032002 Bacteria 9186
462 Ga0307416_100094342 3300032002 Unclassified 2580
463 Ga0307416_100115482 3300032002 Bacteria 2377
464 Ga0307416_100231684 3300032002 Bacteria 1781
465 Ga0307416_100281949 3300032002 Bacteria 1639
466 Ga0307416_100334598 3300032002 Unclassified 1523
467 Ga0307416_100561884 3300032002 Bacteria 1216
468 Ga0307416_100579825 3300032002 Unclassified 1199
469 Ga0307416_100594376 3300032002 Unclassified 1186
470 Ga0307416_100904225 3300032002 Bacteria 983
471 Ga0307416_101722235 3300032002 Bacteria 731
472 Ga0307416_101939821 3300032002 Bacteria 692
473 Ga0307416_103088782 3300032002 Unclassified 557
474 Ga0307416_103868242 3300032002 Unclassified 501
475 Ga0307414_10002703 3300032004 Bacteria 9335
476 Ga0307414_10012916 3300032004 Bacteria 4958
477 Ga0307414_10757774 3300032004 Bacteria 883
478 Ga0307411_10018030 3300032005 Bacteria 4040
479 Ga0307411_10039327 3300032005 Bacteria 2991
480 Ga0307411_10195232 3300032005 Unclassified 1549
481 Ga0307411_11083923 3300032005 Unclassified 721
482 Ga0307415_100000354 3300032126 Bacteria 19542
483 Ga0307415_100005289 3300032126 Bacteria 6836
484 Ga0307415_100374178 3300032126 Bacteria 1207
485 Ga0307415_100786459 3300032126 Bacteria 867
486 Ga0373938_0174227 3300034957 Bacteria 584
487 Ga0373926_0030042 3300035083 Bacteria 1911
488 Ga0373928_0041849 3300035084 Bacteria 1055
489 Ga0373934_0002486 3300035086 Bacteria 6779
490 Ga0373940_0123082 3300035088 Unclassified 806
491 Ga0373940_0338813 3300035088 Bacteria 525
492 Ga0373944_0003674 3300035089 Bacteria 3966
493 Ga0373944_0007091 3300035089 Bacteria 2996
494 Ga0373949_0111998 3300035090 Bacteria 758
495 Ga0373951_0028199 3300035091 Bacteria 1315
496 Ga0373951_0075580 3300035091 Bacteria 864
497 Ga0373923_0012003 3300035111 Unclassified 3192
498 Ga0373939_0082571 3300035114 Bacteria 1070
499 Ga0373941_0041167 3300035115 Bacteria 1429
500 Ga0373941_0110395 3300035115 Bacteria 969
501 Ga0373945_0003785 3300035116 Bacteria 4776
502 Ga0373953_0010779 3300035117 Unclassified 3191
503 Ga0373954_0120748 3300035118 Unclassified 1272
504 Ga0373956_0012998 3300035119 Unclassified 3459
505 Ga0373943_0001139 3300035170 Bacteria 11856
506 Ga0373943_0117881 3300035170 Bacteria 1408
507 Ga0373946_0001189 3300035171 Bacteria 9017
508 Ga0373946_0241589 3300035171 Unclassified 878
509 Ga0373946_0474165 3300035171 Unclassified 639
510 Ga0373955_0003323 3300035172 Bacteria 7065
511 Ga0373962_0082166 3300035242 Bacteria 980
512 Ga0373924_0093027 3300035410 Unclassified 1291
513 Ga0373931_0035195 3300035691 Bacteria 2602
514 Ga0373931_0396204 3300035691 Bacteria 873
515 Ga0373931_1173941 3300035691 Bacteria 525
516 Ga0373935_0002527 3300035692 Bacteria 10481
517 Ga0373927_0002489 3300035695 Bacteria 13444
518 Ga0373933_0000111 3300035724 Bacteria 52402
519 Ga0373947_0001941 3300035725 Bacteria 12666
520 Ga0373947_0208501 3300035725 Unclassified 1281
521 Ga0373937_0001287 3300036401 Bacteria 20998
522 Ga0373925_0011685 3300037068 Bacteria 6349
523 Ga0373925_0555167 3300037068 Bacteria 945
524 Ga0395905_0868047 3300037471 Bacteria 805
525 Ga0436365_0349243 3300039437 Bacteria 922
526 Ga0436365_0668878 3300039437 Bacteria 1764
527 Ga0436365_1879509 3300039437 Bacteria 5382
528 Ga0451793_1782672 3300041452 Unclassified 634
529 Ga0439457_140303 3300042014 Unclassified 578
530 Ga0450897_016818 3300042128 Bacteria 757
531 Ga0466971_0346101 3300044719 Unclassified 719
532 Ga0466960_0129168 3300044901 Unclassified 1332
533 Ga0466967_0915930 3300045976 Bacteria 872
534 Ga0495592_0041329 3300046454 Unclassified 3455
535 Ga0495603_0002313 3300046455 Bacteria 11180
536 Ga0495629_0027381 3300046459 Bacteria 4046
537 Ga0495629_0037957 3300046459 Unclassified 3395
538 Ga0495641_0400447 3300046461 Bacteria 623
539 Ga0495651_0035144 3300046462 Unclassified 3903
540 Ga0495653_0004473 3300046463 Bacteria 11286
541 Ga0495580_0023523 3300046472 Bacteria 4522
542 Ga0495582_0009477 3300046473 Bacteria 5363
543 Ga0495639_0000173 3300046475 Bacteria 33769
544 Ga0495664_0236387 3300046477 Unclassified 1105
545 Ga0495594_0051344 3300046499 Unclassified 2269
546 Ga0495608_0000412 3300046511 Bacteria 29899
547 Ga0495628_0003031 3300046516 Bacteria 15057
548 Ga0495630_0007738 3300046517 Bacteria 7689
549 Ga0495630_0011038 3300046517 Bacteria 6533
550 Ga0495652_0003649 3300046529 Bacteria 15079
551 Ga0495665_0002352 3300046531 Bacteria 10212
552 Ga0495586_0160904 3300046535 Unclassified 1266
553 Ga0495587_0002984 3300046536 Bacteria 11311
554 Ga0495645_0000449 3300046543 Bacteria 28285
555 Ga0495622_0330784 3300046557 Unclassified 661
556 Ga0495667_0012169 3300046559 Bacteria 5830
557 Ga0495656_0043875 3300046615 Bacteria 1880
558 Ga0495635_0013648 3300046663 Bacteria 5687
559 Ga0495659_0158697 3300046664 Bacteria 912
560 Ga0495588_0065394 3300046674 Unclassified 1886
561 Ga0495657_0009301 3300046675 Bacteria 7458
562 Ga0495599_0046696 3300046678 Unclassified 2715
563 Ga0495623_0166825 3300046679 Unclassified 1289
564 Ga0495646_0003101 3300046680 Bacteria 10314
565 Ga0495658_0007176 3300046683 Bacteria 5504
566 Ga0495613_0003005 3300046689 Bacteria 12632
567 Ga0495613_0093397 3300046689 Unclassified 2178
568 Ga0495600_0000067 3300046809 Bacteria 59521
569 Ga0495581_0001138 3300047315 Bacteria 14569
570 Ga0495581_0029481 3300047315 Bacteria 3180
571 Ga0495581_0119020 3300047315 Unclassified 1537
572 Ga0495604_0000192 3300047317 Bacteria 54981
573 Ga0495674_0008406 3300047319 Bacteria 9835
574 Ga0495674_0499455 3300047319 Bacteria 973
575 Ga0495676_0204966 3300047321 Bacteria 1368
576 Ga0495680_0002161 3300047322 Bacteria 20367
577 Ga0495675_0085645 3300047444 Unclassified 1981
578 Ga0495684_0002809 3300047471 Bacteria 13730
579 Ga0495593_0001537 3300047673 Bacteria 13596
580 Ga0495602_0003013 3300048088 Bacteria 17284
581 Ga0495614_0004764 3300048089 Bacteria 6122
582 Ga0496100_0092192 3300048903 Bacteria 2070
583 Ga0496100_0244968 3300048903 Unclassified 1324
584 Ga0496101_0926454 3300048904 Bacteria 686
585 Ga0496102_0172767 3300048905 Bacteria 2034
586 Ga0496102_0781544 3300048905 Unclassified 877
587 Ga0496104_0026738 3300048907 Bacteria 5332
588 Ga0496106_0040498 3300048909 Unclassified 3490
589 Ga0496106_0499047 3300048909 Bacteria 978
590 Ga0496107_0164287 3300048910 Unclassified 1646
591 Ga0496107_0594326 3300048910 Bacteria 818
592 Ga0496108_0011974 3300048911 Bacteria 7057
593 Ga0496109_0010729 3300048912 Bacteria 7841
594 Ga0496110_0016989 3300048913 Bacteria 6082
595 Ga0496111_0056308 3300048914 Unclassified 2844
596 Ga0496112_0108244 3300048915 Unclassified 2749
597 Ga0496112_0371909 3300048915 Bacteria 1371
598 Ga0496112_0410241 3300048915 Bacteria 1294
599 Ga0496112_1395303 3300048915 Bacteria 615
600 Ga0496113_0004563 3300048916 Bacteria 8531
601 Ga0496113_0853095 3300048916 Bacteria 722
602 Ga0496114_1140059 3300048917 Bacteria 665
603 Ga0501299_139823 3300049522 Unclassified 601
604 Ga0501031_0473934 3300049568 Bacteria 808
605 Ga0501034_0114691 3300049571 Bacteria 2683
606 Ga0501034_0163193 3300049571 Bacteria 2198
607 Ga0501036_0031799 3300049572 Bacteria 4459
608 Ga0501037_0113069 3300049573 Bacteria 1955
609 Ga0501038_0029341 3300049574 Bacteria 4876
610 Ga0501039_0086534 3300049575 Bacteria 2441
611 Ga0501040_0194593 3300049576 Bacteria 1439
612 Ga0501041_0110027 3300049577 Bacteria 1709
613 Ga0501043_0832768 3300049579 Unclassified 666
614 Ga0501046_0742442 3300049580 Bacteria 690
615 Ga0501047_0069067 3300049581 Bacteria 3403
616 Ga0501047_0159198 3300049581 Bacteria 2130
617 Ga0501067_0590738 3300049583 Bacteria 622
618 Ga0501069_0033229 3300049585 Bacteria 2841
619 Ga0501070_0085422 3300049586 Bacteria 2613
620 Ga0501070_0232086 3300049586 Bacteria 1512
621 Ga0501070_0257516 3300049586 Bacteria 1427
622 Ga0501071_0350259 3300049587 Bacteria 1124
623 Ga0501072_0607265 3300049588 Unclassified 862
624 Ga0501072_1210018 3300049588 Bacteria 587
625 Ga0501074_0062605 3300049590 Bacteria 2680
626 Ga0501075_0260360 3300049591 Bacteria 1322
627 Ga0501075_1113000 3300049591 Bacteria 600
628 Ga0501076_0539016 3300049592 Unclassified 962
629 Ga0501077_0375073 3300049593 Bacteria 909
630 Ga0501209_187303 3300049656 Unclassified 633
631 Ga0501216_169454 3300049660 Unclassified 528
632 Ga0501217_058900 3300049661 Unclassified 1021
633 Ga0501235_151465 3300049669 Bacteria 601
634 Ga0501243_017147 3300049675 Unclassified 1174
635 Ga0501257_212293 3300049686 Unclassified 561
636 Ga0501260_032796 3300049689 Bacteria 605
637 Ga0501261_105828 3300049690 Bacteria 541
638 Ga0501225_0080971 3300049705 Unclassified 932
639 Ga0501245_056163 3300049708 Unclassified 709
640 Ga0501079_0069377 3300049741 Bacteria 2721
641 Ga0501079_0145326 3300049741 Bacteria 1848
642 Ga0501080_0087794 3300049742 Bacteria 2889
643 Ga0501080_0641863 3300049742 Bacteria 940
644 Ga0501081_0567330 3300049743 Bacteria 848
645 Ga0501081_0671959 3300049743 Bacteria 777
646 Ga0501083_0578753 3300049744 Unclassified 731
647 Ga0501268_107990 3300049765 Unclassified 604
648 Ga0501273_092369 3300049770 Bacteria 516
649 Ga0501283_121240 3300049779 Unclassified 524
650 Ga0501035_0239457 3300049822 Bacteria 1544
651 Ga0501035_0511153 3300049822 Unclassified 988
652 Ga0501044_0051158 3300049823 Bacteria 4260
653 Ga0501044_0325702 3300049823 Bacteria 1460
654 Ga0501045_0159828 3300049824 Bacteria 1677
655 Ga0501045_0171204 3300049824 Bacteria 1617
656 nmdc:mga07m45_869743_c1 3300050496 Unclassified 516
657 nmdc:mga05p37_830418_c1 3300050507 Unclassified 1006
658 nmdc:mga09592_244750_c1 3300050508 Bacteria 1554
659 nmdc:mga09592_282590_c1 3300050508 Bacteria 1439
660 nmdc:mga09592_963609_c1 3300050508 Unclassified 715
661 nmdc:mga0qj67_1336250_c1 3300050509 Unclassified 555
662 nmdc:mga0qj67_17848_c1 3300050509 Bacteria 5399
663 nmdc:mga0qj67_2195_c1 3300050509 Bacteria 13871
664 nmdc:mga0qj67_546959_c1 3300050509 Unclassified 929
665 nmdc:mga06r32_1317898_c1 3300050510 Bacteria 666
666 nmdc:mga06r32_13676_c1 3300050510 Bacteria 7360
667 nmdc:mga06r32_1718743_c1 3300050510 Unclassified 564
668 nmdc:mga06r32_420802_c1 3300050510 Bacteria 1317
669 nmdc:mga06r32_612905_c1 3300050510 Unclassified 1059
670 nmdc:mga08y16_1040980_c1 3300050511 Bacteria 796
671 nmdc:mga08y16_1604727_c1 3300050511 Bacteria 608
672 nmdc:mga08y16_26965_c1 3300050511 Bacteria 6055
673 nmdc:mga0n895_1850709_c1 3300050512 Bacteria 563
674 nmdc:mga0rr50_113283_c1 3300050513 Bacteria 2149
675 nmdc:mga0rr50_1256998_c1 3300050513 Bacteria 628
676 nmdc:mga08x19_451235_c1 3300050514 Unclassified 905
677 nmdc:mga08x19_5721_c1 3300050514 Bacteria 7347
678 nmdc:mga0a205_2427_c1 3300050515 Bacteria 16432
679 nmdc:mga0a205_504804_c1 3300050515 Bacteria 1066
680 Ga0495612_0128827 3300053078 Unclassified 1092
681 Ga0495595_0049763 3300053084 Unclassified 1939
682 Ga0495619_0596966 3300053085 Bacteria 755
683 Ga0501084_0718026 3300054114 Bacteria 843
684 Ga0501084_1195663 3300054114 Bacteria 638
685 Ga0590071_036991 3300059421 Bacteria 1171
686 Ga0590075_068236 3300059424 Bacteria 918
687 Ga0590077_153845 3300059426 Unclassified 551
688 Ga0501082_0648108 3300060353 Bacteria 924
689 Ga0530510_0089471 3300061734 Bacteria 2245
690 Ga0530510_1148087 3300061734 Bacteria 595
691 Ga0501039_1407393
692 MBSR1b_contig_8116297
693 JGI25406J46586_10014112
694 Ga0058863_11799423
695 Ga0058861_10027692
696 Ga0058861_11318377
697 Ga0058861_11777001
698 Ga0058862_12621214
699 Ga0058862_12842556
700 Ga0065712_10295115
701 Ga0065715_10112742
702 Ga0070658_10597039
703 Ga0070676_10171216
704 Ga0070683_100011473
705 Ga0070683_100677428
706 Ga0070683_100788366
707 Ga0070683_100892487
708 Ga0070683_101101072
709 Ga0070683_101664930
710 Ga0070683_101678505
711 Ga0070690_100146962
712 Ga0068869_100342373
713 Ga0068869_100848485
714 Ga0070666_11026168
715 Ga0070680_100019199
716 Ga0070680_100174199
717 Ga0070680_100248183
718 Ga0070680_100305153
719 Ga0070680_100841628
720 Ga0070680_100906830
721 Ga0070682_100043357
722 Ga0070682_100443562
723 Ga0068868_100019736
724 Ga0068868_100042234
725 Ga0068868_100459985
726 Ga0070689_100332743
727 Ga0070691_10023773
728 Ga0070691_10053326
729 Ga0070691_10086981
730 Ga0070687_101273624
731 Ga0070661_100118570
732 Ga0070661_100132927
733 Ga0070661_100145950
734 Ga0070661_100447311
735 Ga0070661_100790428
736 Ga0070661_100821561
737 Ga0070692_10068806
738 Ga0070692_10359826
739 Ga0070692_10382365
740 Ga0070692_10398832
741 Ga0070692_10510244
742 Ga0070669_100170330
743 Ga0070675_100452447
744 Ga0070675_101282058
745 Ga0070675_101606869
746 Ga0070674_100016557
747 Ga0070674_100078155
748 Ga0070674_100146370
749 Ga0070673_101068400
750 Ga0070673_101486133
751 Ga0070659_101748487
752 Ga0070667_101779237
753 Ga0070703_10046488
754 Ga0070709_10312010
755 Ga0070709_10498259
756 Ga0070709_10610396
757 Ga0070714_100004782
758 Ga0070714_100075227
759 Ga0070714_100888903
760 Ga0070714_102075426
761 Ga0070713_100256634
762 Ga0070710_10260070
763 Ga0070710_10862816
764 Ga0070701_10647251
765 Ga0070711_100533347
766 Ga0070705_100389585
767 Ga0070705_100675803
768 Ga0070700_100029343
769 Ga0070700_100135577
770 Ga0070700_100259016
771 Ga0070700_100401045
772 Ga0070700_101969041
773 Ga0070694_100349830
774 Ga0070694_100582448
775 Ga0070694_100755075
776 Ga0070694_101151802
777 Ga0070678_100106339
778 Ga0070678_100107393
779 Ga0070678_102077630
780 Ga0070662_100033800
781 Ga0070662_100220988
782 Ga0070662_100954610
783 Ga0070662_101301470
784 Ga0070681_10001135
785 Ga0070681_10002466
786 Ga0070681_10072220
787 Ga0070681_10228608
788 Ga0070681_10345675
789 Ga0070681_10360964
790 Ga0070681_10719055
791 Ga0070681_11354947
792 Ga0070681_11364927
793 Ga0068867_100207188
794 Ga0068867_100987657
795 Ga0070706_101332211
796 Ga0070707_100008957
797 Ga0070707_100347453
798 Ga0070707_100517879
799 Ga0070698_100010819
800 Ga0070699_100347628
801 Ga0070699_100465079
802 Ga0070699_100784725
803 Ga0070699_102201165
804 Ga0070699_102208857
805 Ga0070679_100000632
806 Ga0070679_100009167
807 Ga0070679_100018930
808 Ga0070679_100022573
809 Ga0070679_100044087
810 Ga0070679_100099665
811 Ga0070679_100104713
812 Ga0070679_100279715
813 Ga0070679_100347100
814 Ga0070679_100422701
815 Ga0070679_100826388
816 Ga0070679_101654547
817 Ga0070679_101718784
818 Ga0070684_100005212
819 Ga0070684_100024142
820 Ga0070684_100049140
821 Ga0070684_100285889
822 Ga0070684_100797511
823 Ga0070684_101924111
824 Ga0070697_100047867
825 Ga0070697_100118026
826 Ga0070697_100498167
827 Ga0070697_100525038
828 Ga0068853_100134882
829 Ga0068853_100617997
830 Ga0068853_100918393
831 Ga0068853_101126938
832 Ga0068853_102253117
833 Ga0070686_100057439
834 Ga0070686_100473541
835 Ga0070695_100109647
836 Ga0070695_100293642
837 Ga0070695_100542567
838 Ga0070696_100000112
839 Ga0070696_100186248
840 Ga0070696_100387431
841 Ga0070696_100422506
842 Ga0070696_100830484
843 Ga0070696_101331931
844 Ga0070696_101610850
845 Ga0070693_100003376
846 Ga0070693_100005815
847 Ga0070693_100037527
848 Ga0070693_100098469
849 Ga0068855_100011799
850 Ga0068855_100022430
851 Ga0068855_100546602
852 Ga0068855_101703875
853 Ga0068855_101989599
854 Ga0070664_100030319
855 Ga0070664_100236251
856 Ga0068857_100007730
857 Ga0068857_102530640
858 Ga0068854_100318071
859 Ga0068854_100504178
860 Ga0068854_100615727
861 Ga0068854_100831541
862 Ga0070702_100045295
863 Ga0068852_100652069
864 Ga0068864_100481791
865 Ga0068864_102057398
866 Ga0068866_10237455
867 Ga0068861_100832659
868 Ga0068870_11337539
869 Ga0068863_101670418
870 Ga0068858_101048883
871 Ga0068860_100430371
872 Ga0081455_10038853
873 Ga0081539_10000104
874 Ga0075432_10513436
875 Ga0070716_100147859
876 Ga0070716_100410981
877 Ga0070716_100467765
878 Ga0070712_100098017
879 Ga0070712_100166331
880 Ga0097621_100415247
881 Ga0075370_10985419
882 Ga0068871_100373121
883 Ga0075430_100000326
884 Ga0075430_100012295
885 Ga0075430_100026854
886 Ga0075430_100114706
887 Ga0075430_100397415
888 Ga0075431_100007659
889 Ga0075431_100209549
890 Ga0075431_100902005
891 Ga0075431_101013557
892 Ga0075433_10038019
893 Ga0075433_10703244
894 Ga0075434_100942013
895 Ga0075429_100138187
896 Ga0075429_100241064
897 Ga0075429_100953909
898 Ga0068865_100041493
899 Ga0075436_100048673
900 Ga0075436_100062363
901 Ga0075436_100489189
902 Ga0075436_101348680
903 Ga0075435_100141539
904 Ga0075435_100195679
905 Ga0075435_101161991
906 Ga0099794_10378697
907 Ga0099795_10030239
908 Ga0105240_10080310
909 Ga0105240_10253885
910 Ga0111539_10043395
911 Ga0111539_10221260
912 Ga0111539_11406702
913 Ga0105245_10315671
914 Ga0114129_10096733
915 Ga0114129_10899004
916 Ga0114129_13198174
917 Ga0105243_10890795
918 Ga0105241_10311843
919 Ga0105241_12356110
920 Ga0105242_10751874
921 Ga0105248_10526728
922 Ga0105237_10024807
923 Ga0105237_10157722
924 Ga0105237_11335760
925 Ga0105238_11087444
926 Ga0105249_10569365
927 Ga0105249_11617407
928 Ga0105249_11798577
929 Ga0099796_10039110
930 Ga0105239_10245145
931 Ga0105239_10744560
932 Ga0105239_11041897
933 Ga0105239_11254921
934 Ga0105246_10646872
935 Ga0157373_10276246
936 Ga0157373_10366529
937 Ga0157373_10384763
938 Ga0157373_10842212
939 Ga0157373_11532238
940 Ga0157371_10379747
941 Ga0157371_11337385
942 Ga0157370_10048640
943 Ga0157369_10019510
944 Ga0157369_10606904
945 Ga0157369_11053524
946 Ga0157369_12483900
947 Ga0157374_10035130
948 Ga0157374_10053312
949 Ga0157378_10045413
950 Ga0157378_10220020
951 Ga0157378_12668340
952 Ga0163162_11139971
953 Ga0163162_12841382
954 Ga0157372_10025764
955 Ga0157372_10054352
956 Ga0157372_10249575
957 Ga0157372_10486798
958 Ga0157372_10501689
959 Ga0157372_10852897
960 Ga0157372_13144215
961 Ga0157375_12606973
962 Ga0157380_11040112
963 Ga0157380_11941999
964 Ga0157377_10203569
965 Ga0157377_10285728
966 Ga0182007_10246074
967 Ga0182007_10355827
968 Ga0163161_11793278
969 Ga0197907_10074091
970 Ga0206356_11077348
971 Ga0206356_11763208
972 Ga0206352_10215765
973 Ga0206352_11184165
974 Ga0213876_10111178
975 Ga0224712_10436516
976 Ga0207653_10289472
977 Ga0207642_10272143
978 Ga0207710_10635185
979 Ga0207699_10149968
980 Ga0207699_10316225
981 Ga0207699_10866280
982 Ga0207645_10007217
983 Ga0207645_10137369
984 Ga0207645_10163135
985 Ga0207705_10494410
986 Ga0207705_11510966
987 Ga0207684_10016933
988 Ga0207684_10317655
989 Ga0207654_10696928
990 Ga0207654_10699637
991 Ga0207707_10001737
992 Ga0207707_10001810
993 Ga0207707_10009380
994 Ga0207707_10015911
995 Ga0207707_10177484
996 Ga0207707_10258077
997 Ga0207707_10444001
998 Ga0207707_10462229
999 Ga0207707_10474066
1000 Ga0207707_10511675
1001 Ga0207707_10842257
1002 Ga0207707_11065090
1003 Ga0207695_10021491
1004 Ga0207695_10306370
1005 Ga0207695_10546377
1006 Ga0207671_10027789
1007 Ga0207671_10170768
1008 Ga0207693_10034668
1009 Ga0207663_10575816
1010 Ga0207663_11571723
1011 Ga0207660_10006824
1012 Ga0207660_10052118
1013 Ga0207660_10136803
1014 Ga0207660_10355593
1015 Ga0207660_10597799
1016 Ga0207660_10968689
1017 Ga0207657_10639747
1018 Ga0207649_10014824
1019 Ga0207649_10359261
1020 Ga0207649_10398785
1021 Ga0207652_10006744
1022 Ga0207652_10018156
1023 Ga0207652_10026442
1024 Ga0207652_10057821
1025 Ga0207652_10077922
1026 Ga0207652_10345003
1027 Ga0207652_10380017
1028 Ga0207652_10963484
1029 Ga0207652_11172542
1030 Ga0207652_11379470
1031 Ga0207646_10060876
1032 Ga0207646_10435250
1033 Ga0207646_10805958
1034 Ga0207681_10235708
1035 Ga0207694_10899105
1036 Ga0207687_10079034
1037 Ga0207687_10617300
1038 Ga0207687_11378220
1039 Ga0207700_10378865
1040 Ga0207700_10485723
1041 Ga0207664_10092538
1042 Ga0207664_10752210
1043 Ga0207644_10372355
1044 Ga0207644_10997340
1045 Ga0207690_10525648
1046 Ga0207690_10924276
1047 Ga0207706_10033043
1048 Ga0207706_10238511
1049 Ga0207686_10759338
1050 Ga0207670_10209187
1051 Ga0207669_10047033
1052 Ga0207669_10057845
1053 Ga0207669_11218211
1054 Ga0207669_11513019
1055 Ga0207704_10064956
1056 Ga0207665_10055688
1057 Ga0207665_10504770
1058 Ga0207711_10549680
1059 Ga0207661_10012599
1060 Ga0207661_10039533
1061 Ga0207661_10107421
1062 Ga0207661_10292656
1063 Ga0207661_11899023
1064 Ga0207661_12045224
1065 Ga0207679_10235103
1066 Ga0207679_10433579
1067 Ga0207679_10892011
1068 Ga0207667_10099482
1069 Ga0207667_10545510
1070 Ga0207667_10814757
1071 Ga0207651_10693268
1072 Ga0207651_10785102
1073 Ga0207640_10315283
1074 Ga0207640_10691847
1075 Ga0207640_10702259
1076 Ga0207640_11781171
1077 Ga0207658_10637324
1078 Ga0207677_10020968
1079 Ga0207677_10394506
1080 Ga0207677_10413698
1081 Ga0207677_10480110
1082 Ga0207703_10389076
1083 Ga0207639_11350557
1084 Ga0207678_10559198
1085 Ga0207678_10759784
1086 Ga0207708_10087668
1087 Ga0207708_10104060
1088 Ga0207708_10232179
1089 Ga0207702_10400869
1090 Ga0207648_10683815
1091 Ga0207648_11079052
1092 Ga0207674_10042993
1093 Ga0207675_100321291
1094 Ga0207675_100852379
1095 Ga0207683_10001656
1096 Ga0207683_11061140
1097 Ga0207683_12083392
1098 Ga0209981_1004969
1099 Ga0209996_1024573
1100 Ga0209995_1024471
1101 Ga0209179_1134858
1102 Ga0209968_1029076
1103 Ga0209999_1081061
1104 Ga0210002_1054275
1105 Ga0209983_1047532
1106 Ga0209966_1065838
1107 Ga0209974_10022347
1108 Ga0268265_11251738
1109 Ga0268264_10979859
1110 Ga0265332_10005750
1111 Ga0265327_10018835
1112 Ga0307408_100012011
1113 Ga0307408_100012101
1114 Ga0307408_100219286
1115 Ga0307408_101508781
1116 Ga0307408_101566504
1117 Ga0307408_101858171
1118 Ga0265314_10005807
1119 Ga0307405_10007912
1120 Ga0307405_10161071
1121 Ga0307405_10212676
1122 Ga0307413_10014651
1123 Ga0307413_10037017
1124 Ga0307413_12149997
1125 Ga0307410_10001526
1126 Ga0307410_10023288
1127 Ga0307410_10312039
1128 Ga0307410_10379063
1129 Ga0307406_10007384
1130 Ga0307406_10024698
1131 Ga0307406_10026330
1132 Ga0307406_10583163
1133 Ga0307406_10593073
1134 Ga0307406_10687340
1135 Ga0307407_10019250
1136 Ga0307407_10042332
1137 Ga0307407_10288326
1138 Ga0307407_10426857
1139 Ga0307407_11106584
1140 Ga0307412_10031963
1141 Ga0307412_10562964
1142 Ga0307412_10640941
1143 Ga0307412_10665063
1144 Ga0307412_10771618
1145 Ga0307409_100000517
1146 Ga0307409_100012829
1147 Ga0307409_100026166
1148 Ga0307409_100602353
1149 Ga0307409_101626808
1150 Ga0307409_102348555
1151 Ga0307416_100003561
1152 Ga0307416_100094342
1153 Ga0307416_100115482
1154 Ga0307416_100231684
1155 Ga0307416_100281949
1156 Ga0307416_100334598
1157 Ga0307416_100561884
1158 Ga0307416_100579825
1159 Ga0307416_100594376
1160 Ga0307416_100904225
1161 Ga0307416_101722235
1162 Ga0307416_101939821
1163 Ga0307416_103088782
1164 Ga0307416_103868242
1165 Ga0307414_10002703
1166 Ga0307414_10012916
1167 Ga0307414_10757774
1168 Ga0307411_10018030
1169 Ga0307411_10039327
1170 Ga0307411_10195232
1171 Ga0307411_11083923
1172 Ga0307415_100000354
1173 Ga0307415_100005289
1174 Ga0307415_100374178
1175 Ga0307415_100786459
1176 Ga0373938_0174227
1177 Ga0373926_0030042
1178 Ga0373928_0041849
1179 Ga0373934_0002486
1180 Ga0373940_0123082
1181 Ga0373940_0338813
1182 Ga0373944_0003674
1183 Ga0373944_0007091
1184 Ga0373949_0111998
1185 Ga0373951_0028199
1186 Ga0373951_0075580
1187 Ga0373923_0012003
1188 Ga0373939_0082571
1189 Ga0373941_0041167
1190 Ga0373941_0110395
1191 Ga0373945_0003785
1192 Ga0373953_0010779
1193 Ga0373954_0120748
1194 Ga0373956_0012998
1195 Ga0373943_0001139
1196 Ga0373943_0117881
1197 Ga0373946_0001189
1198 Ga0373946_0241589
1199 Ga0373946_0474165
1200 Ga0373955_0003323
1201 Ga0373962_0082166
1202 Ga0373924_0093027
1203 Ga0373931_0035195
1204 Ga0373931_0396204
1205 Ga0373931_1173941
1206 Ga0373935_0002527
1207 Ga0373927_0002489
1208 Ga0373933_0000111
1209 Ga0373947_0001941
1210 Ga0373947_0208501
1211 Ga0373937_0001287
1212 Ga0373925_0011685
1213 Ga0373925_0555167
1214 Ga0395905_0868047
1215 Ga0436365_0349243
1216 Ga0436365_0668878
1217 Ga0436365_1879509
1218 Ga0451793_1782672
1219 Ga0439457_140303
1220 Ga0450897_016818
1221 Ga0466971_0346101
1222 Ga0466960_0129168
1223 Ga0466967_0915930
1224 Ga0495592_0041329
1225 Ga0495603_0002313
1226 Ga0495629_0027381
1227 Ga0495629_0037957
1228 Ga0495641_0400447
1229 Ga0495651_0035144
1230 Ga0495653_0004473
1231 Ga0495580_0023523
1232 Ga0495582_0009477
1233 Ga0495639_0000173
1234 Ga0495664_0236387
1235 Ga0495594_0051344
1236 Ga0495608_0000412
1237 Ga0495628_0003031
1238 Ga0495630_0007738
1239 Ga0495630_0011038
1240 Ga0495652_0003649
1241 Ga0495665_0002352
1242 Ga0495586_0160904
1243 Ga0495587_0002984
1244 Ga0495645_0000449
1245 Ga0495622_0330784
1246 Ga0495667_0012169
1247 Ga0495656_0043875
1248 Ga0495635_0013648
1249 Ga0495659_0158697
1250 Ga0495588_0065394
1251 Ga0495657_0009301
1252 Ga0495599_0046696
1253 Ga0495623_0166825
1254 Ga0495646_0003101
1255 Ga0495658_0007176
1256 Ga0495613_0003005
1257 Ga0495613_0093397
1258 Ga0495600_0000067
1259 Ga0495581_0001138
1260 Ga0495581_0029481
1261 Ga0495581_0119020
1262 Ga0495604_0000192
1263 Ga0495674_0008406
1264 Ga0495674_0499455
1265 Ga0495676_0204966
1266 Ga0495680_0002161
1267 Ga0495675_0085645
1268 Ga0495684_0002809
1269 Ga0495593_0001537
1270 Ga0495602_0003013
1271 Ga0495614_0004764
1272 Ga0496100_0092192
1273 Ga0496100_0244968
1274 Ga0496101_0926454
1275 Ga0496102_0172767
1276 Ga0496102_0781544
1277 Ga0496104_0026738
1278 Ga0496106_0040498
1279 Ga0496106_0499047
1280 Ga0496107_0164287
1281 Ga0496107_0594326
1282 Ga0496108_0011974
1283 Ga0496109_0010729
1284 Ga0496110_0016989
1285 Ga0496111_0056308
1286 Ga0496112_0108244
1287 Ga0496112_0371909
1288 Ga0496112_0410241
1289 Ga0496112_1395303
1290 Ga0496113_0004563
1291 Ga0496113_0853095
1292 Ga0496114_1140059
1293 Ga0501299_139823
1294 Ga0501031_0473934
1295 Ga0501034_0114691
1296 Ga0501034_0163193
1297 Ga0501036_0031799
1298 Ga0501037_0113069
1299 Ga0501038_0029341
1300 Ga0501039_0086534
1301 Ga0501040_0194593
1302 Ga0501041_0110027
1303 Ga0501043_0832768
1304 Ga0501046_0742442
1305 Ga0501047_0069067
1306 Ga0501047_0159198
1307 Ga0501067_0590738
1308 Ga0501069_0033229
1309 Ga0501070_0085422
1310 Ga0501070_0232086
1311 Ga0501070_0257516
1312 Ga0501071_0350259
1313 Ga0501072_0607265
1314 Ga0501072_1210018
1315 Ga0501074_0062605
1316 Ga0501075_0260360
1317 Ga0501075_1113000
1318 Ga0501076_0539016
1319 Ga0501077_0375073
1320 Ga0501209_187303
1321 Ga0501216_169454
1322 Ga0501217_058900
1323 Ga0501235_151465
1324 Ga0501243_017147
1325 Ga0501257_212293
1326 Ga0501260_032796
1327 Ga0501261_105828
1328 Ga0501225_0080971
1329 Ga0501245_056163
1330 Ga0501079_0069377
1331 Ga0501079_0145326
1332 Ga0501080_0087794
1333 Ga0501080_0641863
1334 Ga0501081_0567330
1335 Ga0501081_0671959
1336 Ga0501083_0578753
1337 Ga0501268_107990
1338 Ga0501273_092369
1339 Ga0501283_121240
1340 Ga0501035_0239457
1341 Ga0501035_0511153
1342 Ga0501044_0051158
1343 Ga0501044_0325702
1344 Ga0501045_0159828
1345 Ga0501045_0171204
1346 nmdc:mga07m45_869743_c1
1347 nmdc:mga05p37_830418_c1
1348 nmdc:mga09592_244750_c1
1349 nmdc:mga09592_282590_c1
1350 nmdc:mga09592_963609_c1
1351 nmdc:mga0qj67_1336250_c1
1352 nmdc:mga0qj67_17848_c1
1353 nmdc:mga0qj67_2195_c1
1354 nmdc:mga0qj67_546959_c1
1355 nmdc:mga06r32_1317898_c1
1356 nmdc:mga06r32_13676_c1
1357 nmdc:mga06r32_1718743_c1
1358 nmdc:mga06r32_420802_c1
1359 nmdc:mga06r32_612905_c1
1360 nmdc:mga08y16_1040980_c1
1361 nmdc:mga08y16_1604727_c1
1362 nmdc:mga08y16_26965_c1
1363 nmdc:mga0n895_1850709_c1
1364 nmdc:mga0rr50_113283_c1
1365 nmdc:mga0rr50_1256998_c1
1366 nmdc:mga08x19_451235_c1
1367 nmdc:mga08x19_5721_c1
1368 nmdc:mga0a205_2427_c1
1369 nmdc:mga0a205_504804_c1
1370 Ga0495612_0128827
1371 Ga0495595_0049763
1372 Ga0495619_0596966
1373 Ga0501084_0718026
1374 Ga0501084_1195663
1375 Ga0590071_036991
1376 Ga0590075_068236
1377 Ga0590077_153845
1378 Ga0501082_0648108
1379 Ga0530510_0089471
1380 Ga0530510_1148087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14209

DUF4321

Domain of unknown function (DUF4321)

46

92

0.97

Map