F475458

General Info

Members Datasets Scaffolds Average Seq Length
690 235 1380 145

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10369267|Ga0207641_103692672
Length 178
Sequence MAEHKTFTIQERVRWGDVDAARIIFYGAYIHFFEFAETELFREAGLAYGKMFDELKIWLPRVHLECDFRRVATLDDLLEVSVYVGRFGTKSMKLNFEVRRKGEAELIATAHFVLAAVHQETFETVPLPAEIRERLAPYNANEEGWKAWTKTKSIAILLSSFNSGLTKQSRPSCRCLTR

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
208 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
209 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
215 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
218 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
219 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
220 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
221 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
224 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
225 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 96.96
Stem 0
Stem Tuber 0
Unclassified 31.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10369267 3300026088 Bacteria 1372
2 CNAas_1001096 3300000532 Bacteria 2476
3 JGI24736J21556_1025201 3300001904 Unclassified 926
4 JGI25406J46586_10009712 3300003203 Bacteria 4301
5 JGI25406J46586_10017225 3300003203 Bacteria 2992
6 rootL2_10218650 3300003322 Bacteria 1201
7 Ga0065704_10183329 3300005289 Bacteria 1226
8 Ga0065704_10251042 3300005289 Bacteria 989
9 Ga0065712_10022254 3300005290 Bacteria 1500
10 Ga0065712_10099492 3300005290 Bacteria 2090
11 Ga0065712_10493807 3300005290 Unclassified 654
12 Ga0065712_10521642 3300005290 Unclassified 622
13 Ga0065715_10007729 3300005293 Unclassified 4360
14 Ga0065715_10017387 3300005293 Bacteria 2073
15 Ga0065715_10128145 3300005293 Viruses 2072
16 Ga0065715_10298002 3300005293 Unclassified 1045
17 Ga0065715_10393366 3300005293 Unclassified 891
18 Ga0065715_10510964 3300005293 Bacteria 771
19 Ga0065715_10621952 3300005293 Bacteria 695
20 Ga0065715_11045035 3300005293 Unclassified 533
21 Ga0065707_10016711 3300005295 Unclassified 2219
22 Ga0065707_10020299 3300005295 Bacteria 1553
23 Ga0065707_10109697 3300005295 Bacteria 2451
24 Ga0065707_10216102 3300005295 Bacteria 1244
25 Ga0065707_10265919 3300005295 Bacteria 1084
26 Ga0070676_10360842 3300005328 Bacteria 1001
27 Ga0070676_10493288 3300005328 Unclassified 868
28 Ga0070690_100007813 3300005330 Bacteria 6131
29 Ga0070690_100179410 3300005330 Bacteria 1462
30 Ga0070670_100030947 3300005331 Unclassified 4609
31 Ga0070670_100038812 3300005331 Bacteria 4095
32 Ga0070670_100210637 3300005331 Bacteria 1690
33 Ga0068869_100001881 3300005334 Bacteria 12607
34 Ga0068869_100049672 3300005334 Unclassified 3038
35 Ga0068869_100146864 3300005334 Bacteria 1826
36 Ga0068869_100151262 3300005334 Bacteria 1800
37 Ga0068869_100310164 3300005334 Bacteria 1277
38 Ga0070680_100033653 3300005336 Bacteria 4133
39 Ga0070680_101755616 3300005336 Unclassified 538
40 Ga0070682_100098885 3300005337 Unclassified 1923
41 Ga0068868_100215584 3300005338 Bacteria 1606
42 Ga0068868_100720116 3300005338 Bacteria 894
43 Ga0068868_101062184 3300005338 Bacteria 743
44 Ga0068868_101330910 3300005338 Bacteria 668
45 Ga0070689_100010735 3300005340 Bacteria 6540
46 Ga0070689_100172005 3300005340 Bacteria 1755
47 Ga0070687_100134562 3300005343 Bacteria 1431
48 Ga0070687_100408892 3300005343 Unclassified 892
49 Ga0070687_100655623 3300005343 Bacteria 728
50 Ga0070692_10092488 3300005345 Bacteria 1646
51 Ga0070692_10153175 3300005345 Unclassified 1315
52 Ga0070669_100129604 3300005353 Unclassified 1933
53 Ga0070675_100192558 3300005354 Bacteria 1767
54 Ga0070675_100856694 3300005354 Unclassified 832
55 Ga0070675_100907281 3300005354 Bacteria 808
56 Ga0070671_100059591 3300005355 Unclassified 3177
57 Ga0070671_100323793 3300005355 Bacteria 1314
58 Ga0070674_100202070 3300005356 Bacteria 1535
59 Ga0070673_100329224 3300005364 Bacteria 1351
60 Ga0070673_100856468 3300005364 Unclassified 841
61 Ga0070688_100931894 3300005365 Unclassified 687
62 Ga0070659_101016563 3300005366 Unclassified 728
63 Ga0070659_101154144 3300005366 Unclassified 684
64 Ga0070667_100319047 3300005367 Unclassified 1402
65 Ga0070667_100939126 3300005367 Bacteria 806
66 Ga0070709_10545135 3300005434 Unclassified 887
67 Ga0070701_10214372 3300005438 Unclassified 1145
68 Ga0070705_100050590 3300005440 Unclassified 2418
69 Ga0070700_100000176 3300005441 Bacteria 36043
70 Ga0070700_100585398 3300005441 Bacteria 872
71 Ga0070694_100013038 3300005444 Bacteria 5185
72 Ga0070694_100013376 3300005444 Bacteria 5126
73 Ga0070694_100027881 3300005444 Bacteria 3671
74 Ga0070694_100058894 3300005444 Bacteria 2615
75 Ga0070694_100174442 3300005444 Unclassified 1586
76 Ga0070694_100437460 3300005444 Unclassified 1030
77 Ga0070694_100581922 3300005444 Unclassified 900
78 Ga0070694_101193641 3300005444 Bacteria 637
79 Ga0070694_101303441 3300005444 Bacteria 611
80 Ga0070694_101461738 3300005444 Unclassified 578
81 Ga0070708_101726048 3300005445 Unclassified 582
82 Ga0070678_100020514 3300005456 Bacteria 4338
83 Ga0070678_101531267 3300005456 Unclassified 625
84 Ga0070662_100685357 3300005457 Bacteria 866
85 Ga0070681_10005311 3300005458 Bacteria 12434
86 Ga0070681_10012040 3300005458 Bacteria 8579
87 Ga0070681_10061041 3300005458 Bacteria 3746
88 Ga0070681_10143374 3300005458 Bacteria 2318
89 Ga0070681_10336463 3300005458 Bacteria 1419
90 Ga0068867_100018401 3300005459 Bacteria 4966
91 Ga0068867_100035212 3300005459 Bacteria 3631
92 Ga0068867_100189272 3300005459 Bacteria 1641
93 Ga0068867_100285515 3300005459 Bacteria 1355
94 Ga0068867_100537162 3300005459 Bacteria 1011
95 Ga0068867_100834149 3300005459 Unclassified 825
96 Ga0068867_101023171 3300005459 Unclassified 750
97 Ga0070685_10182867 3300005466 Bacteria 1351
98 Ga0070685_10339712 3300005466 Bacteria 1023
99 Ga0070706_100000017 3300005467 Bacteria 172828
100 Ga0070706_100123488 3300005467 Bacteria 2414
101 Ga0070706_100256667 3300005467 Bacteria 1632
102 Ga0070706_100498880 3300005467 Bacteria 1133
103 Ga0070707_100019538 3300005468 Bacteria 6383
104 Ga0070707_100176073 3300005468 Unclassified 2085
105 Ga0070698_100011237 3300005471 Bacteria 9510
106 Ga0070698_101435442 3300005471 Unclassified 641
107 Ga0070698_101456599 3300005471 Bacteria 636
108 Ga0070699_100004039 3300005518 Bacteria 12970
109 Ga0070699_100029507 3300005518 Bacteria 4728
110 Ga0070699_100562691 3300005518 Bacteria 1038
111 Ga0070699_100853366 3300005518 Unclassified 834
112 Ga0070679_100001588 3300005530 Bacteria 20392
113 Ga0070679_100260851 3300005530 Bacteria 1688
114 Ga0070679_100267503 3300005530 Unclassified 1664
115 Ga0070684_101976399 3300005535 Unclassified 550
116 Ga0070697_100000947 3300005536 Bacteria 21848
117 Ga0070697_100053824 3300005536 Bacteria 3271
118 Ga0070697_100069286 3300005536 Bacteria 2889
119 Ga0070697_100221800 3300005536 Bacteria 1611
120 Ga0070697_100497614 3300005536 Bacteria 1065
121 Ga0068853_101233815 3300005539 Unclassified 722
122 Ga0070672_100369640 3300005543 Bacteria 1225
123 Ga0070672_100989286 3300005543 Bacteria 745
124 Ga0070672_101015847 3300005543 Unclassified 735
125 Ga0070686_100033578 3300005544 Bacteria 3154
126 Ga0070686_101122641 3300005544 Unclassified 650
127 Ga0070695_100041923 3300005545 Bacteria 2903
128 Ga0070695_100162372 3300005545 Bacteria 1569
129 Ga0070695_100256983 3300005545 Bacteria 1274
130 Ga0070695_100539119 3300005545 Unclassified 908
131 Ga0070695_101020530 3300005545 Bacteria 674
132 Ga0070695_101276707 3300005545 Unclassified 606
133 Ga0070695_101452706 3300005545 Bacteria 570
134 Ga0070696_100075393 3300005546 Bacteria 2379
135 Ga0070696_100086743 3300005546 Unclassified 2222
136 Ga0070696_100507705 3300005546 Unclassified 960
137 Ga0070696_100663632 3300005546 Unclassified 847
138 Ga0070696_100758065 3300005546 Bacteria 796
139 Ga0070696_100790759 3300005546 Unclassified 780
140 Ga0070696_100890449 3300005546 Unclassified 738
141 Ga0070696_100894242 3300005546 Bacteria 736
142 Ga0070696_101287211 3300005546 Unclassified 620
143 Ga0070693_100006810 3300005547 Bacteria 5551
144 Ga0070693_100015330 3300005547 Bacteria 3944
145 Ga0070693_100016902 3300005547 Unclassified 3783
146 Ga0070693_100069673 3300005547 Bacteria 2068
147 Ga0070693_100215305 3300005547 Bacteria 1256
148 Ga0070693_100232097 3300005547 Bacteria 1214
149 Ga0070693_100314761 3300005547 Bacteria 1060
150 Ga0070665_100148716 3300005548 Viruses 2345
151 Ga0070704_100090600 3300005549 Unclassified 2278
152 Ga0070704_100191811 3300005549 Bacteria 1643
153 Ga0070704_100620830 3300005549 Unclassified 952
154 Ga0070704_100646058 3300005549 Unclassified 934
155 Ga0070704_102085518 3300005549 Unclassified 527
156 Ga0070664_100240541 3300005564 Bacteria 1625
157 Ga0070664_100621267 3300005564 Unclassified 1003
158 Ga0070664_100697274 3300005564 Unclassified 946
159 Ga0070664_100826701 3300005564 Unclassified 867
160 Ga0070664_100872291 3300005564 Bacteria 843
161 Ga0070664_101158255 3300005564 Bacteria 729
162 Ga0070664_101558130 3300005564 Unclassified 626
163 Ga0068857_100225478 3300005577 Bacteria 1713
164 Ga0068857_100464521 3300005577 Bacteria 1185
165 Ga0068857_100741641 3300005577 Bacteria 935
166 Ga0068857_101366011 3300005577 Bacteria 689
167 Ga0068854_100096613 3300005578 Bacteria 2208
168 Ga0068854_100582695 3300005578 Unclassified 953
169 Ga0068854_100588998 3300005578 Unclassified 948
170 Ga0068854_100590743 3300005578 Bacteria 947
171 Ga0068854_101287976 3300005578 Bacteria 657
172 Ga0070702_100043043 3300005615 Bacteria 2542
173 Ga0070702_100064777 3300005615 Bacteria 2139
174 Ga0070702_100212375 3300005615 Bacteria 1289
175 Ga0070702_100228460 3300005615 Bacteria 1249
176 Ga0070702_100238938 3300005615 Bacteria 1225
177 Ga0070702_100356685 3300005615 Bacteria 1032
178 Ga0070702_100671312 3300005615 Bacteria 786
179 Ga0070702_100844802 3300005615 Unclassified 712
180 Ga0070702_100859118 3300005615 Unclassified 707
181 Ga0068852_100188235 3300005616 Viruses 1946
182 Ga0068852_100404413 3300005616 Unclassified 1344
183 Ga0068852_100583747 3300005616 Bacteria 1121
184 Ga0068852_100780286 3300005616 Unclassified 969
185 Ga0068852_101334769 3300005616 Bacteria 739
186 Ga0068852_101556325 3300005616 Unclassified 683
187 Ga0068859_100009327 3300005617 Bacteria 9906
188 Ga0068859_100034224 3300005617 Bacteria 5100
189 Ga0068859_100035986 3300005617 Bacteria 4968
190 Ga0068859_100039591 3300005617 Bacteria 4729
191 Ga0068859_100057673 3300005617 Bacteria 3911
192 Ga0068859_100209837 3300005617 Bacteria 2034
193 Ga0068859_100231105 3300005617 Bacteria 1938
194 Ga0068859_100283338 3300005617 Bacteria 1750
195 Ga0068859_100290805 3300005617 Bacteria 1727
196 Ga0068859_100578776 3300005617 Bacteria 1216
197 Ga0068859_100788193 3300005617 Bacteria 1038
198 Ga0068859_100978141 3300005617 Unclassified 929
199 Ga0068859_101582737 3300005617 Bacteria 724
200 Ga0068859_101643308 3300005617 Unclassified 709
201 Ga0068859_102927852 3300005617 Unclassified 522
202 Ga0068864_100020331 3300005618 Bacteria 5554
203 Ga0068864_100059328 3300005618 Unclassified 3310
204 Ga0068864_100080695 3300005618 Bacteria 2851
205 Ga0068864_100158005 3300005618 Bacteria 2059
206 Ga0068864_100160324 3300005618 Bacteria 2044
207 Ga0068864_100209590 3300005618 Bacteria 1794
208 Ga0068864_100239773 3300005618 Unclassified 1680
209 Ga0068864_100297906 3300005618 Bacteria 1509
210 Ga0068864_100298906 3300005618 Bacteria 1507
211 Ga0068864_100446812 3300005618 Unclassified 1236
212 Ga0068864_100841316 3300005618 Unclassified 904
213 Ga0068864_100936443 3300005618 Bacteria 857
214 Ga0068864_101416129 3300005618 Unclassified 697
215 Ga0068866_10004856 3300005718 Bacteria 5518
216 Ga0068861_100000749 3300005719 Bacteria 19478
217 Ga0068861_100096459 3300005719 Bacteria 2343
218 Ga0068861_101150340 3300005719 Bacteria 748
219 Ga0068861_102541541 3300005719 Unclassified 516
220 Ga0068851_10068465 3300005834 Viruses 1832
221 Ga0068851_10300464 3300005834 Bacteria 923
222 Ga0068870_10029567 3300005840 Bacteria 2761
223 Ga0068870_10039578 3300005840 Unclassified 2440
224 Ga0068863_100103838 3300005841 Unclassified 2703
225 Ga0068863_100231395 3300005841 Bacteria 1783
226 Ga0068863_100244485 3300005841 Bacteria 1732
227 Ga0068863_101132508 3300005841 Unclassified 787
228 Ga0068863_101780177 3300005841 Unclassified 626
229 Ga0068863_101933760 3300005841 Bacteria 600
230 Ga0068858_100043211 3300005842 Bacteria 4178
231 Ga0068858_100048805 3300005842 Bacteria 3921
232 Ga0068858_100050162 3300005842 Bacteria 3863
233 Ga0068858_100083759 3300005842 Bacteria 2966
234 Ga0068858_100090762 3300005842 Unclassified 2843
235 Ga0068858_100242739 3300005842 Bacteria 1710
236 Ga0068858_100307410 3300005842 Bacteria 1513
237 Ga0068858_100322038 3300005842 Bacteria 1478
238 Ga0068858_100499917 3300005842 Bacteria 1175
239 Ga0068858_100504746 3300005842 Bacteria 1169
240 Ga0068858_100648222 3300005842 Bacteria 1026
241 Ga0068860_100032816 3300005843 Bacteria 4987
242 Ga0068860_100125931 3300005843 Unclassified 2455
243 Ga0068860_100178606 3300005843 Bacteria 2052
244 Ga0068860_100300035 3300005843 Bacteria 1574
245 Ga0068860_100418084 3300005843 Bacteria 1328
246 Ga0068860_101298213 3300005843 Bacteria 749
247 Ga0068860_101455353 3300005843 Bacteria 706
248 Ga0068862_101408328 3300005844 Bacteria 701
249 Ga0068862_102443041 3300005844 Unclassified 534
250 Ga0081539_10000279 3300005985 Bacteria 115766
251 Ga0081539_10000591 3300005985 Bacteria 74056
252 Ga0081539_10003249 3300005985 Bacteria 20434
253 Ga0081539_10390770 3300005985 Bacteria 579
254 Ga0070716_100010642 3300006173 Bacteria 4617
255 Ga0070716_100269663 3300006173 Bacteria 1169
256 Ga0097621_100006798 3300006237 Bacteria 8129
257 Ga0097621_100022323 3300006237 Bacteria 4911
258 Ga0097621_100079955 3300006237 Bacteria 2718
259 Ga0097621_100400396 3300006237 Bacteria 1229
260 Ga0097621_100930658 3300006237 Bacteria 811
261 Ga0097621_101883350 3300006237 Bacteria 571
262 Ga0068871_100006758 3300006358 Bacteria 8148
263 Ga0068871_100012524 3300006358 Bacteria 6258
264 Ga0068871_100201010 3300006358 Bacteria 1720
265 Ga0068871_100218604 3300006358 Bacteria 1650
266 Ga0068871_100949074 3300006358 Unclassified 799
267 Ga0068871_101356867 3300006358 Unclassified 670
268 Ga0075428_100033372 3300006844 Bacteria 5684
269 Ga0075428_100037927 3300006844 Bacteria 5302
270 Ga0075428_100787971 3300006844 Bacteria 1011
271 Ga0075430_100043283 3300006846 Unclassified 3805
272 Ga0075430_100095445 3300006846 Bacteria 2485
273 Ga0075431_100015636 3300006847 Bacteria 7692
274 Ga0075431_100380988 3300006847 Unclassified 1414
275 Ga0075433_10026786 3300006852 Bacteria 4885
276 Ga0075433_10045077 3300006852 Unclassified 3833
277 Ga0075433_10223205 3300006852 Unclassified 1674
278 Ga0075433_10384096 3300006852 Unclassified 1240
279 Ga0075434_100812782 3300006871 Bacteria 951
280 Ga0075434_101939502 3300006871 Unclassified 595
281 Ga0075434_102488597 3300006871 Bacteria 519
282 Ga0075429_100019230 3300006880 Bacteria 5916
283 Ga0075429_100039239 3300006880 Bacteria 4122
284 Ga0075429_100092258 3300006880 Unclassified 2641
285 Ga0075429_100448285 3300006880 Bacteria 1131
286 Ga0068865_100068226 3300006881 Bacteria 2514
287 Ga0068865_100232816 3300006881 Bacteria 1446
288 Ga0075436_100000002 3300006914 Bacteria 475522
289 Ga0075436_100014352 3300006914 Bacteria 5424
290 Ga0097620_100009327 3300006931 Bacteria 9906
291 Ga0097620_100034222 3300006931 Bacteria 5100
292 Ga0097620_100035988 3300006931 Bacteria 4968
293 Ga0097620_100039591 3300006931 Bacteria 4729
294 Ga0097620_100057674 3300006931 Bacteria 3911
295 Ga0097620_100209832 3300006931 Bacteria 2034
296 Ga0097620_100231098 3300006931 Bacteria 1938
297 Ga0097620_100283342 3300006931 Bacteria 1750
298 Ga0097620_100290769 3300006931 Bacteria 1727
299 Ga0097620_100450714 3300006931 Bacteria 1383
300 Ga0097620_100578750 3300006931 Bacteria 1216
301 Ga0097620_100788173 3300006931 Bacteria 1038
302 Ga0097620_100978301 3300006931 Unclassified 929
303 Ga0097620_101582879 3300006931 Bacteria 724
304 Ga0097620_101643345 3300006931 Unclassified 709
305 Ga0097620_102927972 3300006931 Unclassified 522
306 Ga0075435_100004272 3300007076 Bacteria 9816
307 Ga0075435_100005948 3300007076 Bacteria 8582
308 Ga0105250_10138601 3300009092 Bacteria 1007
309 Ga0105240_10024561 3300009093 Bacteria 7943
310 Ga0105240_10552263 3300009093 Bacteria 1274
311 Ga0105240_11069557 3300009093 Unclassified 860
312 Ga0105240_11348782 3300009093 Bacteria 751
313 Ga0111539_10137926 3300009094 Bacteria 2856
314 Ga0111539_10690071 3300009094 Bacteria 1189
315 Ga0105245_10954574 3300009098 Bacteria 900
316 Ga0105245_12335083 3300009098 Bacteria 588
317 Ga0105247_10000934 3300009101 Bacteria 22005
318 Ga0105247_10111803 3300009101 Bacteria 1759
319 Ga0105247_10125650 3300009101 Unclassified 1667
320 Ga0105247_10185363 3300009101 Bacteria 1391
321 Ga0105247_10620418 3300009101 Bacteria 804
322 Ga0114129_10052231 3300009147 Bacteria 5736
323 Ga0114129_10082159 3300009147 Bacteria 4477
324 Ga0114129_10156507 3300009147 Unclassified 3116
325 Ga0114129_10440229 3300009147 Unclassified 1711
326 Ga0114129_10552620 3300009147 Bacteria 1497
327 Ga0114129_10761511 3300009147 Bacteria 1238
328 Ga0114129_13015940 3300009147 Unclassified 553
329 Ga0105243_10027460 3300009148 Unclassified 4361
330 Ga0105243_10184791 3300009148 Bacteria 1816
331 Ga0105243_10191655 3300009148 Bacteria 1786
332 Ga0105243_10390072 3300009148 Bacteria 1290
333 Ga0105243_10593649 3300009148 Unclassified 1065
334 Ga0105243_11074711 3300009148 Bacteria 811
335 Ga0105243_11351209 3300009148 Bacteria 731
336 Ga0105243_12219603 3300009148 Unclassified 586
337 Ga0105241_10037065 3300009174 Bacteria 3672
338 Ga0105241_10041175 3300009174 Bacteria 3489
339 Ga0105241_10066566 3300009174 Unclassified 2786
340 Ga0105241_10117371 3300009174 Unclassified 2138
341 Ga0105241_10230355 3300009174 Bacteria 1562
342 Ga0105241_10255044 3300009174 Bacteria 1489
343 Ga0105241_10312855 3300009174 Bacteria 1351
344 Ga0105241_10477300 3300009174 Bacteria 1108
345 Ga0105241_11015849 3300009174 Bacteria 777
346 Ga0105241_11306523 3300009174 Unclassified 691
347 Ga0105241_11410230 3300009174 Unclassified 667
348 Ga0105241_11427955 3300009174 Unclassified 663
349 Ga0105242_10002424 3300009176 Bacteria 14641
350 Ga0105242_10029125 3300009176 Unclassified 4402
351 Ga0105242_10077735 3300009176 Viruses 2769
352 Ga0105242_10582561 3300009176 Bacteria 1078
353 Ga0105242_10640751 3300009176 Bacteria 1032
354 Ga0105242_10797682 3300009176 Unclassified 934
355 Ga0105242_11004641 3300009176 Bacteria 842
356 Ga0105242_11660277 3300009176 Unclassified 674
357 Ga0105248_10087445 3300009177 Bacteria 3507
358 Ga0105248_10138095 3300009177 Bacteria 2750
359 Ga0105248_10681322 3300009177 Bacteria 1160
360 Ga0105237_10005012 3300009545 Bacteria 15075
361 Ga0105237_10022083 3300009545 Bacteria 6531
362 Ga0105237_10748129 3300009545 Bacteria 984
363 Ga0105237_12269025 3300009545 Bacteria 552
364 Ga0105238_10107313 3300009551 Bacteria 2773
365 Ga0105238_10155833 3300009551 Unclassified 2259
366 Ga0105238_11132535 3300009551 Unclassified 806
367 Ga0105249_10030904 3300009553 Bacteria 4842
368 Ga0105249_10198619 3300009553 Bacteria 1962
369 Ga0105249_10854126 3300009553 Unclassified 976
370 Ga0105239_10138038 3300010375 Bacteria 2715
371 Ga0105239_10708412 3300010375 Bacteria 1151
372 Ga0105239_11160947 3300010375 Bacteria 889
373 Ga0105239_13050231 3300010375 Unclassified 546
374 Ga0105246_10051312 3300011119 Bacteria 2832
375 Ga0105246_10082395 3300011119 Unclassified 2296
376 Ga0105246_10777719 3300011119 Bacteria 847
377 Ga0105246_10832183 3300011119 Unclassified 822
378 Ga0157373_10006204 3300013100 Bacteria 8932
379 Ga0157373_10143038 3300013100 Bacteria 1682
380 Ga0157373_10265778 3300013100 Bacteria 1214
381 Ga0157373_10390823 3300013100 Bacteria 996
382 Ga0157373_11173403 3300013100 Bacteria 578
383 Ga0157371_10136668 3300013102 Bacteria 1746
384 Ga0157371_10420676 3300013102 Unclassified 980
385 Ga0157371_10513815 3300013102 Unclassified 885
386 Ga0157371_10815489 3300013102 Bacteria 704
387 Ga0157374_10016417 3300013296 Bacteria 6507
388 Ga0157378_10007514 3300013297 Bacteria 9516
389 Ga0157378_10013469 3300013297 Bacteria 7152
390 Ga0157378_10284804 3300013297 Bacteria 1594
391 Ga0157378_10305210 3300013297 Bacteria 1542
392 Ga0157378_10379673 3300013297 Bacteria 1387
393 Ga0157378_10585145 3300013297 Unclassified 1126
394 Ga0157378_10643450 3300013297 Bacteria 1075
395 Ga0163162_10002741 3300013306 Bacteria 16707
396 Ga0163162_10050647 3300013306 Unclassified 4164
397 Ga0163162_10077377 3300013306 Bacteria 3390
398 Ga0163162_10139600 3300013306 Bacteria 2536
399 Ga0163162_10226505 3300013306 Bacteria 1999
400 Ga0163162_10853674 3300013306 Bacteria 1025
401 Ga0163162_11337035 3300013306 Bacteria 815
402 Ga0163162_11425858 3300013306 Unclassified 788
403 Ga0163162_11557203 3300013306 Bacteria 753
404 Ga0163162_11655192 3300013306 Unclassified 730
405 Ga0163162_12964071 3300013306 Unclassified 546
406 Ga0157372_10005043 3300013307 Bacteria 14024
407 Ga0157372_10303787 3300013307 Bacteria 1856
408 Ga0157372_10506558 3300013307 Bacteria 1407
409 Ga0157372_11699318 3300013307 Unclassified 726
410 Ga0157372_11980170 3300013307 Bacteria 669
411 Ga0157375_10004459 3300013308 Bacteria 12157
412 Ga0157375_10551932 3300013308 Bacteria 1314
413 Ga0157375_10696675 3300013308 Bacteria 1170
414 Ga0157375_10792939 3300013308 Bacteria 1096
415 Ga0157375_10898872 3300013308 Bacteria 1030
416 Ga0157375_11921286 3300013308 Unclassified 703
417 Ga0163163_10003771 3300014325 Bacteria 12911
418 Ga0163163_10027113 3300014325 Bacteria 5483
419 Ga0163163_10028477 3300014325 Bacteria 5365
420 Ga0163163_10308204 3300014325 Bacteria 1636
421 Ga0163163_10473971 3300014325 Bacteria 1312
422 Ga0163163_10952787 3300014325 Bacteria 922
423 Ga0163163_11141575 3300014325 Unclassified 842
424 Ga0163163_11356228 3300014325 Unclassified 773
425 Ga0163163_12431032 3300014325 Unclassified 582
426 Ga0157380_10053932 3300014326 Bacteria 3189
427 Ga0157380_10161939 3300014326 Unclassified 1945
428 Ga0157380_10262809 3300014326 Bacteria 1569
429 Ga0157380_10472316 3300014326 Bacteria 1210
430 Ga0157380_10919443 3300014326 Bacteria 902
431 Ga0182008_10140125 3300014497 Bacteria 1209
432 Ga0157377_10082618 3300014745 Bacteria 1881
433 Ga0157377_10149886 3300014745 Bacteria 1441
434 Ga0157377_10263688 3300014745 Bacteria 1122
435 Ga0157377_10917120 3300014745 Unclassified 656
436 Ga0157379_10086618 3300014968 Bacteria 2808
437 Ga0157379_10292902 3300014968 Bacteria 1482
438 Ga0157379_10638134 3300014968 Unclassified 996
439 Ga0157376_10024920 3300014969 Bacteria 4705
440 Ga0157376_10069582 3300014969 Bacteria 2984
441 Ga0163161_10013400 3300017792 Bacteria 5705
442 Ga0163161_10036483 3300017792 Bacteria 3520
443 Ga0163161_10083414 3300017792 Bacteria 2355
444 Ga0163161_10985599 3300017792 Bacteria 719
445 Ga0207666_1025140 3300025271 Unclassified 892
446 Ga0207697_10001736 3300025315 Bacteria 11708
447 Ga0207653_10001548 3300025885 Bacteria 7443
448 Ga0207653_10197149 3300025885 Bacteria 758
449 Ga0207642_10119647 3300025899 Bacteria 1356
450 Ga0207642_10301161 3300025899 Unclassified 929
451 Ga0207688_10698363 3300025901 Unclassified 641
452 Ga0207647_10009193 3300025904 Bacteria 7031
453 Ga0207647_10010570 3300025904 Bacteria 6513
454 Ga0207643_10001098 3300025908 Bacteria 16032
455 Ga0207643_10195200 3300025908 Bacteria 1230
456 Ga0207643_10434832 3300025908 Unclassified 833
457 Ga0207684_10061059 3300025910 Bacteria 3201
458 Ga0207684_10673154 3300025910 Unclassified 881
459 Ga0207654_10024990 3300025911 Bacteria 3217
460 Ga0207654_10601275 3300025911 Bacteria 785
461 Ga0207707_10000008 3300025912 Bacteria 330313
462 Ga0207707_10241388 3300025912 Bacteria 1571
463 Ga0207707_10330318 3300025912 Bacteria 1315
464 Ga0207671_10003178 3300025914 Bacteria 16584
465 Ga0207671_10573442 3300025914 Bacteria 900
466 Ga0207660_10001715 3300025917 Bacteria 14699
467 Ga0207662_10007536 3300025918 Bacteria 5925
468 Ga0207662_10690144 3300025918 Bacteria 715
469 Ga0207649_10510457 3300025920 Unclassified 915
470 Ga0207649_10678076 3300025920 Bacteria 798
471 Ga0207652_10000149 3300025921 Bacteria 75494
472 Ga0207652_10264327 3300025921 Bacteria 1552
473 Ga0207646_11068392 3300025922 Unclassified 711
474 Ga0207681_10696505 3300025923 Bacteria 844
475 Ga0207650_10055245 3300025925 Unclassified 2947
476 Ga0207650_10168355 3300025925 Bacteria 1740
477 Ga0207650_10203429 3300025925 Bacteria 1587
478 Ga0207659_10319137 3300025926 Bacteria 1281
479 Ga0207659_10482564 3300025926 Bacteria 1047
480 Ga0207687_10696690 3300025927 Unclassified 862
481 Ga0207644_10010914 3300025931 Bacteria 6001
482 Ga0207644_10480301 3300025931 Viruses 1023
483 Ga0207690_10337155 3300025932 Bacteria 1189
484 Ga0207690_10851872 3300025932 Unclassified 755
485 Ga0207690_11270441 3300025932 Unclassified 615
486 Ga0207706_10528880 3300025933 Bacteria 1016
487 Ga0207686_10000132 3300025934 Bacteria 58994
488 Ga0207686_10141604 3300025934 Bacteria 1663
489 Ga0207686_10200583 3300025934 Unclassified 1429
490 Ga0207686_10526207 3300025934 Bacteria 921
491 Ga0207709_10039412 3300025935 Unclassified 2821
492 Ga0207709_10052244 3300025935 Bacteria 2509
493 Ga0207709_10280675 3300025935 Unclassified 1230
494 Ga0207709_10717960 3300025935 Bacteria 801
495 Ga0207709_11229442 3300025935 Bacteria 618
496 Ga0207670_10002260 3300025936 Bacteria 10086
497 Ga0207670_10336551 3300025936 Bacteria 1192
498 Ga0207669_10095633 3300025937 Bacteria 1948
499 Ga0207669_10302957 3300025937 Bacteria 1215
500 Ga0207704_10557819 3300025938 Bacteria 932
501 Ga0207665_10196403 3300025939 Bacteria 1468
502 Ga0207665_10774069 3300025939 Bacteria 757
503 Ga0207691_10001293 3300025940 Bacteria 24971
504 Ga0207711_10514052 3300025941 Bacteria 1116
505 Ga0207711_10890932 3300025941 Unclassified 827
506 Ga0207689_10008189 3300025942 Bacteria 9108
507 Ga0207689_10010471 3300025942 Bacteria 7986
508 Ga0207689_10066685 3300025942 Bacteria 2958
509 Ga0207689_10253643 3300025942 Bacteria 1455
510 Ga0207689_10534234 3300025942 Unclassified 984
511 Ga0207689_11025063 3300025942 Bacteria 696
512 Ga0207679_10162368 3300025945 Bacteria 1830
513 Ga0207679_10227068 3300025945 Bacteria 1574
514 Ga0207679_10236519 3300025945 Unclassified 1545
515 Ga0207679_10293076 3300025945 Unclassified 1399
516 Ga0207679_10845755 3300025945 Unclassified 836
517 Ga0207679_11809047 3300025945 Unclassified 558
518 Ga0207667_10161747 3300025949 Bacteria 2303
519 Ga0207667_10539646 3300025949 Bacteria 1180
520 Ga0207651_10284647 3300025960 Bacteria 1368
521 Ga0207651_10698575 3300025960 Unclassified 893
522 Ga0207712_10081494 3300025961 Unclassified 2356
523 Ga0207712_10843893 3300025961 Unclassified 807
524 Ga0207640_10384237 3300025981 Bacteria 1138
525 Ga0207640_10491348 3300025981 Bacteria 1020
526 Ga0207640_10590723 3300025981 Unclassified 939
527 Ga0207640_10599219 3300025981 Unclassified 932
528 Ga0207640_10791044 3300025981 Unclassified 821
529 Ga0207640_10865673 3300025981 Unclassified 787
530 Ga0207677_10682939 3300026023 Bacteria 909
531 Ga0207677_11050606 3300026023 Unclassified 740
532 Ga0207677_11266677 3300026023 Unclassified 676
533 Ga0207703_10113454 3300026035 Bacteria 2316
534 Ga0207703_10361224 3300026035 Bacteria 1339
535 Ga0207703_10539406 3300026035 Bacteria 1099
536 Ga0207703_10617156 3300026035 Bacteria 1027
537 Ga0207703_10691893 3300026035 Unclassified 969
538 Ga0207703_10834794 3300026035 Bacteria 881
539 Ga0207639_10341073 3300026041 Bacteria 1336
540 Ga0207639_10902212 3300026041 Unclassified 826
541 Ga0207708_10057693 3300026075 Bacteria 2962
542 Ga0207708_10089444 3300026075 Bacteria 2373
543 Ga0207708_10614899 3300026075 Bacteria 922
544 Ga0207708_10921196 3300026075 Bacteria 757
545 Ga0207641_10127424 3300026088 Unclassified 2281
546 Ga0207641_10170586 3300026088 Bacteria 1985
547 Ga0207641_10209910 3300026088 Bacteria 1800
548 Ga0207641_10393824 3300026088 Bacteria 1329
549 Ga0207641_10484530 3300026088 Bacteria 1199
550 Ga0207641_10502924 3300026088 Bacteria 1177
551 Ga0207648_10058205 3300026089 Bacteria 3370
552 Ga0207648_10282499 3300026089 Bacteria 1484
553 Ga0207648_11436245 3300026089 Unclassified 648
554 Ga0207676_10159832 3300026095 Bacteria 1950
555 Ga0207676_10173694 3300026095 Unclassified 1880
556 Ga0207676_10296622 3300026095 Bacteria 1474
557 Ga0207676_10306900 3300026095 Unclassified 1451
558 Ga0207676_10476476 3300026095 Bacteria 1181
559 Ga0207676_10550997 3300026095 Bacteria 1102
560 Ga0207676_10808820 3300026095 Bacteria 915
561 Ga0207676_11552779 3300026095 Bacteria 659
562 Ga0207676_11813816 3300026095 Bacteria 609
563 Ga0207676_12418903 3300026095 Bacteria 522
564 Ga0207674_10021063 3300026116 Bacteria 7031
565 Ga0207674_10158867 3300026116 Bacteria 2215
566 Ga0207674_10437368 3300026116 Bacteria 1264
567 Ga0207674_10549535 3300026116 Unclassified 1116
568 Ga0207674_10615257 3300026116 Unclassified 1049
569 Ga0207674_10762590 3300026116 Unclassified 934
570 Ga0207675_100008731 3300026118 Bacteria 9518
571 Ga0207675_100460612 3300026118 Bacteria 1261
572 Ga0207683_10540890 3300026121 Bacteria 1077
573 Ga0207683_10754741 3300026121 Unclassified 903
574 Ga0207698_11295075 3300026142 Bacteria 743
575 Ga0268265_10345654 3300028380 Bacteria 1356
576 Ga0268265_11337684 3300028380 Unclassified 717
577 Ga0268265_11357659 3300028380 Unclassified 712
578 Ga0268265_11881438 3300028380 Bacteria 605
579 Ga0268264_10042893 3300028381 Bacteria 3746
580 Ga0268264_10067763 3300028381 Unclassified 3013
581 Ga0268264_10565866 3300028381 Bacteria 1117
582 Ga0307408_100427783 3300031548 Bacteria 1143
583 Ga0307405_10166860 3300031731 Bacteria 1566
584 Ga0307413_11509191 3300031824 Unclassified 594
585 Ga0307410_10310214 3300031852 Bacteria 1248
586 Ga0307407_10309971 3300031903 Bacteria 1104
587 Ga0307407_10786705 3300031903 Unclassified 723
588 Ga0307412_10399345 3300031911 Unclassified 1118
589 Ga0307412_10451083 3300031911 Bacteria 1060
590 Ga0307412_11461740 3300031911 Unclassified 620
591 Ga0307409_100039232 3300031995 Bacteria 3512
592 Ga0307416_100973847 3300032002 Unclassified 951
593 Ga0307416_101734816 3300032002 Unclassified 729
594 Ga0307414_10856381 3300032004 Unclassified 831
595 Ga0307411_10083187 3300032005 Unclassified 2210
596 Ga0307415_100046582 3300032126 Bacteria 2914
597 Ga0307415_100136450 3300032126 Unclassified 1866
598 Ga0373940_0322671 3300035088 Unclassified 536
599 Ga0373951_0000860 3300035091 Bacteria 8214
600 Ga0373951_0208611 3300035091 Unclassified 572
601 Ga0373937_0311356 3300036401 Unclassified 1489
602 Ga0395899_0264204 3300037312 Unclassified 1176
603 Ga0395900_0990140 3300037418 Unclassified 761
604 Ga0395898_0246717 3300037466 Bacteria 1703
605 Ga0395901_0049484 3300038443 Bacteria 4367
606 Ga0242422_00126 3300038699 Bacteria 3872
607 Ga0242420_013515 3300038996 Bacteria 1393
608 Ga0242420_062226 3300038996 Unclassified 746
609 Ga0436362_0487810 3300039453 Bacteria 1557
610 Ga0450923_130297 3300042125 Unclassified 598
611 Ga0451577_1248473 3300042876 Unclassified 662
612 Ga0453683_0379712 3300044673 Bacteria 910
613 Ga0451576_0293247 3300045051 Unclassified 1701
614 Ga0451576_0670331 3300045051 Bacteria 1090
615 Ga0495651_0336368 3300046462 Unclassified 1002
616 Ga0495582_0195721 3300046473 Bacteria 1154
617 Ga0495664_0092302 3300046477 Unclassified 1821
618 Ga0495584_0551925 3300046491 Unclassified 587
619 Ga0495643_0092580 3300046522 Bacteria 1558
620 Ga0495642_0350631 3300046528 Bacteria 649
621 Ga0495658_0203430 3300046683 Bacteria 1235
622 Ga0495600_0195560 3300046809 Bacteria 1300
623 Ga0495581_0478282 3300047315 Unclassified 725
624 Ga0495636_0120364 3300047318 Unclassified 1161
625 Ga0495636_0323217 3300047318 Unclassified 725
626 Ga0496100_0189681 3300048903 Bacteria 1492
627 Ga0496103_0337503 3300048906 Bacteria 969
628 Ga0496104_0157049 3300048907 Unclassified 2183
629 Ga0496106_0041160 3300048909 Bacteria 3462
630 Ga0496106_0246948 3300048909 Bacteria 1426
631 Ga0496106_1484123 3300048909 Unclassified 522
632 Ga0496107_0484466 3300048910 Bacteria 918
633 Ga0496108_0033450 3300048911 Bacteria 4272
634 Ga0496108_0101926 3300048911 Bacteria 2449
635 Ga0496108_0816449 3300048911 Unclassified 804
636 Ga0496109_0335467 3300048912 Bacteria 1428
637 Ga0496110_0152897 3300048913 Bacteria 2090
638 Ga0496110_0395181 3300048913 Bacteria 1260
639 Ga0496111_0313748 3300048914 Bacteria 1162
640 Ga0496112_0045725 3300048915 Bacteria 4292
641 Ga0496112_0173291 3300048915 Unclassified 2123
642 Ga0496112_0273049 3300048915 Bacteria 1639
643 Ga0496112_0929811 3300048915 Bacteria 791
644 Ga0496112_1449829 3300048915 Bacteria 601
645 Ga0496113_0687778 3300048916 Bacteria 817
646 Ga0501298_001680 3300049521 Unclassified 3283
647 Ga0501299_010427 3300049522 Unclassified 1551
648 Ga0501299_177515 3300049522 Unclassified 554
649 Ga0501300_025948 3300049523 Bacteria 860
650 Ga0501038_0006231 3300049574 Bacteria 11030
651 Ga0501077_0117616 3300049593 Bacteria 1685
652 Ga0501198_095594 3300049649 Unclassified 595
653 Ga0501207_080902 3300049654 Bacteria 625
654 Ga0501208_054533 3300049655 Unclassified 770
655 Ga0501216_005822 3300049660 Bacteria 1871
656 Ga0501217_296904 3300049661 Unclassified 532
657 Ga0501224_010902 3300049664 Bacteria 1335
658 Ga0501233_002058 3300049668 Bacteria 3509
659 Ga0501233_035884 3300049668 Bacteria 1144
660 Ga0501233_171772 3300049668 Unclassified 616
661 Ga0501235_050739 3300049669 Unclassified 961
662 Ga0501240_003234 3300049673 Bacteria 1798
663 Ga0501243_049542 3300049675 Bacteria 755
664 Ga0501249_028200 3300049679 Bacteria 1244
665 Ga0501259_017830 3300049688 Bacteria 1234
666 Ga0501221_020949 3300049704 Bacteria 1283
667 Ga0501245_023640 3300049708 Bacteria 977
668 Ga0501283_024384 3300049779 Bacteria 986
669 Ga0501283_075187 3300049779 Unclassified 628
670 nmdc:mga05p37_1278410_c1 3300050507 Bacteria 750
671 nmdc:mga05p37_155535_c1 3300050507 Unclassified 2794
672 nmdc:mga05p37_30988_c1 3300050507 Bacteria 6530
673 nmdc:mga09592_138139_c1 3300050508 Unclassified 2100
674 nmdc:mga09592_237527_c1 3300050508 Bacteria 1579
675 nmdc:mga09592_643569_c1 3300050508 Unclassified 906
676 nmdc:mga09592_765744_c1 3300050508 Unclassified 818
677 nmdc:mga0qj67_1158116_c1 3300050509 Unclassified 603
678 nmdc:mga0qj67_421074_c1 3300050509 Bacteria 1077
679 nmdc:mga0qj67_668756_c1 3300050509 Bacteria 828
680 nmdc:mga06r32_216317_c1 3300050510 Bacteria 1904
681 nmdc:mga06r32_313283_c1 3300050510 Bacteria 1555
682 nmdc:mga08y16_379072_c1 3300050511 Unclassified 1450
683 nmdc:mga0n895_1262181_c1 3300050512 Unclassified 711
684 nmdc:mga0n895_85878_c1 3300050512 Bacteria 3142
685 nmdc:mga0rr50_3996_c1 3300050513 Bacteria 8593
686 nmdc:mga08x19_11296_c1 3300050514 Bacteria 5375
687 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
688 nmdc:mga0a205_246328_c1 3300050515 Bacteria 1667
689 nmdc:mga0a205_442393_c1 3300050515 Bacteria 1160
690 nmdc:mga0a205_83520_c1 3300050515 Unclassified 3085
691 Ga0207641_10369267
692 CNAas_1001096
693 JGI24736J21556_1025201
694 JGI25406J46586_10009712
695 JGI25406J46586_10017225
696 rootL2_10218650
697 Ga0065704_10183329
698 Ga0065704_10251042
699 Ga0065712_10022254
700 Ga0065712_10099492
701 Ga0065712_10493807
702 Ga0065712_10521642
703 Ga0065715_10007729
704 Ga0065715_10017387
705 Ga0065715_10128145
706 Ga0065715_10298002
707 Ga0065715_10393366
708 Ga0065715_10510964
709 Ga0065715_10621952
710 Ga0065715_11045035
711 Ga0065707_10016711
712 Ga0065707_10020299
713 Ga0065707_10109697
714 Ga0065707_10216102
715 Ga0065707_10265919
716 Ga0070676_10360842
717 Ga0070676_10493288
718 Ga0070690_100007813
719 Ga0070690_100179410
720 Ga0070670_100030947
721 Ga0070670_100038812
722 Ga0070670_100210637
723 Ga0068869_100001881
724 Ga0068869_100049672
725 Ga0068869_100146864
726 Ga0068869_100151262
727 Ga0068869_100310164
728 Ga0070680_100033653
729 Ga0070680_101755616
730 Ga0070682_100098885
731 Ga0068868_100215584
732 Ga0068868_100720116
733 Ga0068868_101062184
734 Ga0068868_101330910
735 Ga0070689_100010735
736 Ga0070689_100172005
737 Ga0070687_100134562
738 Ga0070687_100408892
739 Ga0070687_100655623
740 Ga0070692_10092488
741 Ga0070692_10153175
742 Ga0070669_100129604
743 Ga0070675_100192558
744 Ga0070675_100856694
745 Ga0070675_100907281
746 Ga0070671_100059591
747 Ga0070671_100323793
748 Ga0070674_100202070
749 Ga0070673_100329224
750 Ga0070673_100856468
751 Ga0070688_100931894
752 Ga0070659_101016563
753 Ga0070659_101154144
754 Ga0070667_100319047
755 Ga0070667_100939126
756 Ga0070709_10545135
757 Ga0070701_10214372
758 Ga0070705_100050590
759 Ga0070700_100000176
760 Ga0070700_100585398
761 Ga0070694_100013038
762 Ga0070694_100013376
763 Ga0070694_100027881
764 Ga0070694_100058894
765 Ga0070694_100174442
766 Ga0070694_100437460
767 Ga0070694_100581922
768 Ga0070694_101193641
769 Ga0070694_101303441
770 Ga0070694_101461738
771 Ga0070708_101726048
772 Ga0070678_100020514
773 Ga0070678_101531267
774 Ga0070662_100685357
775 Ga0070681_10005311
776 Ga0070681_10012040
777 Ga0070681_10061041
778 Ga0070681_10143374
779 Ga0070681_10336463
780 Ga0068867_100018401
781 Ga0068867_100035212
782 Ga0068867_100189272
783 Ga0068867_100285515
784 Ga0068867_100537162
785 Ga0068867_100834149
786 Ga0068867_101023171
787 Ga0070685_10182867
788 Ga0070685_10339712
789 Ga0070706_100000017
790 Ga0070706_100123488
791 Ga0070706_100256667
792 Ga0070706_100498880
793 Ga0070707_100019538
794 Ga0070707_100176073
795 Ga0070698_100011237
796 Ga0070698_101435442
797 Ga0070698_101456599
798 Ga0070699_100004039
799 Ga0070699_100029507
800 Ga0070699_100562691
801 Ga0070699_100853366
802 Ga0070679_100001588
803 Ga0070679_100260851
804 Ga0070679_100267503
805 Ga0070684_101976399
806 Ga0070697_100000947
807 Ga0070697_100053824
808 Ga0070697_100069286
809 Ga0070697_100221800
810 Ga0070697_100497614
811 Ga0068853_101233815
812 Ga0070672_100369640
813 Ga0070672_100989286
814 Ga0070672_101015847
815 Ga0070686_100033578
816 Ga0070686_101122641
817 Ga0070695_100041923
818 Ga0070695_100162372
819 Ga0070695_100256983
820 Ga0070695_100539119
821 Ga0070695_101020530
822 Ga0070695_101276707
823 Ga0070695_101452706
824 Ga0070696_100075393
825 Ga0070696_100086743
826 Ga0070696_100507705
827 Ga0070696_100663632
828 Ga0070696_100758065
829 Ga0070696_100790759
830 Ga0070696_100890449
831 Ga0070696_100894242
832 Ga0070696_101287211
833 Ga0070693_100006810
834 Ga0070693_100015330
835 Ga0070693_100016902
836 Ga0070693_100069673
837 Ga0070693_100215305
838 Ga0070693_100232097
839 Ga0070693_100314761
840 Ga0070665_100148716
841 Ga0070704_100090600
842 Ga0070704_100191811
843 Ga0070704_100620830
844 Ga0070704_100646058
845 Ga0070704_102085518
846 Ga0070664_100240541
847 Ga0070664_100621267
848 Ga0070664_100697274
849 Ga0070664_100826701
850 Ga0070664_100872291
851 Ga0070664_101158255
852 Ga0070664_101558130
853 Ga0068857_100225478
854 Ga0068857_100464521
855 Ga0068857_100741641
856 Ga0068857_101366011
857 Ga0068854_100096613
858 Ga0068854_100582695
859 Ga0068854_100588998
860 Ga0068854_100590743
861 Ga0068854_101287976
862 Ga0070702_100043043
863 Ga0070702_100064777
864 Ga0070702_100212375
865 Ga0070702_100228460
866 Ga0070702_100238938
867 Ga0070702_100356685
868 Ga0070702_100671312
869 Ga0070702_100844802
870 Ga0070702_100859118
871 Ga0068852_100188235
872 Ga0068852_100404413
873 Ga0068852_100583747
874 Ga0068852_100780286
875 Ga0068852_101334769
876 Ga0068852_101556325
877 Ga0068859_100009327
878 Ga0068859_100034224
879 Ga0068859_100035986
880 Ga0068859_100039591
881 Ga0068859_100057673
882 Ga0068859_100209837
883 Ga0068859_100231105
884 Ga0068859_100283338
885 Ga0068859_100290805
886 Ga0068859_100578776
887 Ga0068859_100788193
888 Ga0068859_100978141
889 Ga0068859_101582737
890 Ga0068859_101643308
891 Ga0068859_102927852
892 Ga0068864_100020331
893 Ga0068864_100059328
894 Ga0068864_100080695
895 Ga0068864_100158005
896 Ga0068864_100160324
897 Ga0068864_100209590
898 Ga0068864_100239773
899 Ga0068864_100297906
900 Ga0068864_100298906
901 Ga0068864_100446812
902 Ga0068864_100841316
903 Ga0068864_100936443
904 Ga0068864_101416129
905 Ga0068866_10004856
906 Ga0068861_100000749
907 Ga0068861_100096459
908 Ga0068861_101150340
909 Ga0068861_102541541
910 Ga0068851_10068465
911 Ga0068851_10300464
912 Ga0068870_10029567
913 Ga0068870_10039578
914 Ga0068863_100103838
915 Ga0068863_100231395
916 Ga0068863_100244485
917 Ga0068863_101132508
918 Ga0068863_101780177
919 Ga0068863_101933760
920 Ga0068858_100043211
921 Ga0068858_100048805
922 Ga0068858_100050162
923 Ga0068858_100083759
924 Ga0068858_100090762
925 Ga0068858_100242739
926 Ga0068858_100307410
927 Ga0068858_100322038
928 Ga0068858_100499917
929 Ga0068858_100504746
930 Ga0068858_100648222
931 Ga0068860_100032816
932 Ga0068860_100125931
933 Ga0068860_100178606
934 Ga0068860_100300035
935 Ga0068860_100418084
936 Ga0068860_101298213
937 Ga0068860_101455353
938 Ga0068862_101408328
939 Ga0068862_102443041
940 Ga0081539_10000279
941 Ga0081539_10000591
942 Ga0081539_10003249
943 Ga0081539_10390770
944 Ga0070716_100010642
945 Ga0070716_100269663
946 Ga0097621_100006798
947 Ga0097621_100022323
948 Ga0097621_100079955
949 Ga0097621_100400396
950 Ga0097621_100930658
951 Ga0097621_101883350
952 Ga0068871_100006758
953 Ga0068871_100012524
954 Ga0068871_100201010
955 Ga0068871_100218604
956 Ga0068871_100949074
957 Ga0068871_101356867
958 Ga0075428_100033372
959 Ga0075428_100037927
960 Ga0075428_100787971
961 Ga0075430_100043283
962 Ga0075430_100095445
963 Ga0075431_100015636
964 Ga0075431_100380988
965 Ga0075433_10026786
966 Ga0075433_10045077
967 Ga0075433_10223205
968 Ga0075433_10384096
969 Ga0075434_100812782
970 Ga0075434_101939502
971 Ga0075434_102488597
972 Ga0075429_100019230
973 Ga0075429_100039239
974 Ga0075429_100092258
975 Ga0075429_100448285
976 Ga0068865_100068226
977 Ga0068865_100232816
978 Ga0075436_100000002
979 Ga0075436_100014352
980 Ga0097620_100009327
981 Ga0097620_100034222
982 Ga0097620_100035988
983 Ga0097620_100039591
984 Ga0097620_100057674
985 Ga0097620_100209832
986 Ga0097620_100231098
987 Ga0097620_100283342
988 Ga0097620_100290769
989 Ga0097620_100450714
990 Ga0097620_100578750
991 Ga0097620_100788173
992 Ga0097620_100978301
993 Ga0097620_101582879
994 Ga0097620_101643345
995 Ga0097620_102927972
996 Ga0075435_100004272
997 Ga0075435_100005948
998 Ga0105250_10138601
999 Ga0105240_10024561
1000 Ga0105240_10552263
1001 Ga0105240_11069557
1002 Ga0105240_11348782
1003 Ga0111539_10137926
1004 Ga0111539_10690071
1005 Ga0105245_10954574
1006 Ga0105245_12335083
1007 Ga0105247_10000934
1008 Ga0105247_10111803
1009 Ga0105247_10125650
1010 Ga0105247_10185363
1011 Ga0105247_10620418
1012 Ga0114129_10052231
1013 Ga0114129_10082159
1014 Ga0114129_10156507
1015 Ga0114129_10440229
1016 Ga0114129_10552620
1017 Ga0114129_10761511
1018 Ga0114129_13015940
1019 Ga0105243_10027460
1020 Ga0105243_10184791
1021 Ga0105243_10191655
1022 Ga0105243_10390072
1023 Ga0105243_10593649
1024 Ga0105243_11074711
1025 Ga0105243_11351209
1026 Ga0105243_12219603
1027 Ga0105241_10037065
1028 Ga0105241_10041175
1029 Ga0105241_10066566
1030 Ga0105241_10117371
1031 Ga0105241_10230355
1032 Ga0105241_10255044
1033 Ga0105241_10312855
1034 Ga0105241_10477300
1035 Ga0105241_11015849
1036 Ga0105241_11306523
1037 Ga0105241_11410230
1038 Ga0105241_11427955
1039 Ga0105242_10002424
1040 Ga0105242_10029125
1041 Ga0105242_10077735
1042 Ga0105242_10582561
1043 Ga0105242_10640751
1044 Ga0105242_10797682
1045 Ga0105242_11004641
1046 Ga0105242_11660277
1047 Ga0105248_10087445
1048 Ga0105248_10138095
1049 Ga0105248_10681322
1050 Ga0105237_10005012
1051 Ga0105237_10022083
1052 Ga0105237_10748129
1053 Ga0105237_12269025
1054 Ga0105238_10107313
1055 Ga0105238_10155833
1056 Ga0105238_11132535
1057 Ga0105249_10030904
1058 Ga0105249_10198619
1059 Ga0105249_10854126
1060 Ga0105239_10138038
1061 Ga0105239_10708412
1062 Ga0105239_11160947
1063 Ga0105239_13050231
1064 Ga0105246_10051312
1065 Ga0105246_10082395
1066 Ga0105246_10777719
1067 Ga0105246_10832183
1068 Ga0157373_10006204
1069 Ga0157373_10143038
1070 Ga0157373_10265778
1071 Ga0157373_10390823
1072 Ga0157373_11173403
1073 Ga0157371_10136668
1074 Ga0157371_10420676
1075 Ga0157371_10513815
1076 Ga0157371_10815489
1077 Ga0157374_10016417
1078 Ga0157378_10007514
1079 Ga0157378_10013469
1080 Ga0157378_10284804
1081 Ga0157378_10305210
1082 Ga0157378_10379673
1083 Ga0157378_10585145
1084 Ga0157378_10643450
1085 Ga0163162_10002741
1086 Ga0163162_10050647
1087 Ga0163162_10077377
1088 Ga0163162_10139600
1089 Ga0163162_10226505
1090 Ga0163162_10853674
1091 Ga0163162_11337035
1092 Ga0163162_11425858
1093 Ga0163162_11557203
1094 Ga0163162_11655192
1095 Ga0163162_12964071
1096 Ga0157372_10005043
1097 Ga0157372_10303787
1098 Ga0157372_10506558
1099 Ga0157372_11699318
1100 Ga0157372_11980170
1101 Ga0157375_10004459
1102 Ga0157375_10551932
1103 Ga0157375_10696675
1104 Ga0157375_10792939
1105 Ga0157375_10898872
1106 Ga0157375_11921286
1107 Ga0163163_10003771
1108 Ga0163163_10027113
1109 Ga0163163_10028477
1110 Ga0163163_10308204
1111 Ga0163163_10473971
1112 Ga0163163_10952787
1113 Ga0163163_11141575
1114 Ga0163163_11356228
1115 Ga0163163_12431032
1116 Ga0157380_10053932
1117 Ga0157380_10161939
1118 Ga0157380_10262809
1119 Ga0157380_10472316
1120 Ga0157380_10919443
1121 Ga0182008_10140125
1122 Ga0157377_10082618
1123 Ga0157377_10149886
1124 Ga0157377_10263688
1125 Ga0157377_10917120
1126 Ga0157379_10086618
1127 Ga0157379_10292902
1128 Ga0157379_10638134
1129 Ga0157376_10024920
1130 Ga0157376_10069582
1131 Ga0163161_10013400
1132 Ga0163161_10036483
1133 Ga0163161_10083414
1134 Ga0163161_10985599
1135 Ga0207666_1025140
1136 Ga0207697_10001736
1137 Ga0207653_10001548
1138 Ga0207653_10197149
1139 Ga0207642_10119647
1140 Ga0207642_10301161
1141 Ga0207688_10698363
1142 Ga0207647_10009193
1143 Ga0207647_10010570
1144 Ga0207643_10001098
1145 Ga0207643_10195200
1146 Ga0207643_10434832
1147 Ga0207684_10061059
1148 Ga0207684_10673154
1149 Ga0207654_10024990
1150 Ga0207654_10601275
1151 Ga0207707_10000008
1152 Ga0207707_10241388
1153 Ga0207707_10330318
1154 Ga0207671_10003178
1155 Ga0207671_10573442
1156 Ga0207660_10001715
1157 Ga0207662_10007536
1158 Ga0207662_10690144
1159 Ga0207649_10510457
1160 Ga0207649_10678076
1161 Ga0207652_10000149
1162 Ga0207652_10264327
1163 Ga0207646_11068392
1164 Ga0207681_10696505
1165 Ga0207650_10055245
1166 Ga0207650_10168355
1167 Ga0207650_10203429
1168 Ga0207659_10319137
1169 Ga0207659_10482564
1170 Ga0207687_10696690
1171 Ga0207644_10010914
1172 Ga0207644_10480301
1173 Ga0207690_10337155
1174 Ga0207690_10851872
1175 Ga0207690_11270441
1176 Ga0207706_10528880
1177 Ga0207686_10000132
1178 Ga0207686_10141604
1179 Ga0207686_10200583
1180 Ga0207686_10526207
1181 Ga0207709_10039412
1182 Ga0207709_10052244
1183 Ga0207709_10280675
1184 Ga0207709_10717960
1185 Ga0207709_11229442
1186 Ga0207670_10002260
1187 Ga0207670_10336551
1188 Ga0207669_10095633
1189 Ga0207669_10302957
1190 Ga0207704_10557819
1191 Ga0207665_10196403
1192 Ga0207665_10774069
1193 Ga0207691_10001293
1194 Ga0207711_10514052
1195 Ga0207711_10890932
1196 Ga0207689_10008189
1197 Ga0207689_10010471
1198 Ga0207689_10066685
1199 Ga0207689_10253643
1200 Ga0207689_10534234
1201 Ga0207689_11025063
1202 Ga0207679_10162368
1203 Ga0207679_10227068
1204 Ga0207679_10236519
1205 Ga0207679_10293076
1206 Ga0207679_10845755
1207 Ga0207679_11809047
1208 Ga0207667_10161747
1209 Ga0207667_10539646
1210 Ga0207651_10284647
1211 Ga0207651_10698575
1212 Ga0207712_10081494
1213 Ga0207712_10843893
1214 Ga0207640_10384237
1215 Ga0207640_10491348
1216 Ga0207640_10590723
1217 Ga0207640_10599219
1218 Ga0207640_10791044
1219 Ga0207640_10865673
1220 Ga0207677_10682939
1221 Ga0207677_11050606
1222 Ga0207677_11266677
1223 Ga0207703_10113454
1224 Ga0207703_10361224
1225 Ga0207703_10539406
1226 Ga0207703_10617156
1227 Ga0207703_10691893
1228 Ga0207703_10834794
1229 Ga0207639_10341073
1230 Ga0207639_10902212
1231 Ga0207708_10057693
1232 Ga0207708_10089444
1233 Ga0207708_10614899
1234 Ga0207708_10921196
1235 Ga0207641_10127424
1236 Ga0207641_10170586
1237 Ga0207641_10209910
1238 Ga0207641_10393824
1239 Ga0207641_10484530
1240 Ga0207641_10502924
1241 Ga0207648_10058205
1242 Ga0207648_10282499
1243 Ga0207648_11436245
1244 Ga0207676_10159832
1245 Ga0207676_10173694
1246 Ga0207676_10296622
1247 Ga0207676_10306900
1248 Ga0207676_10476476
1249 Ga0207676_10550997
1250 Ga0207676_10808820
1251 Ga0207676_11552779
1252 Ga0207676_11813816
1253 Ga0207676_12418903
1254 Ga0207674_10021063
1255 Ga0207674_10158867
1256 Ga0207674_10437368
1257 Ga0207674_10549535
1258 Ga0207674_10615257
1259 Ga0207674_10762590
1260 Ga0207675_100008731
1261 Ga0207675_100460612
1262 Ga0207683_10540890
1263 Ga0207683_10754741
1264 Ga0207698_11295075
1265 Ga0268265_10345654
1266 Ga0268265_11337684
1267 Ga0268265_11357659
1268 Ga0268265_11881438
1269 Ga0268264_10042893
1270 Ga0268264_10067763
1271 Ga0268264_10565866
1272 Ga0307408_100427783
1273 Ga0307405_10166860
1274 Ga0307413_11509191
1275 Ga0307410_10310214
1276 Ga0307407_10309971
1277 Ga0307407_10786705
1278 Ga0307412_10399345
1279 Ga0307412_10451083
1280 Ga0307412_11461740
1281 Ga0307409_100039232
1282 Ga0307416_100973847
1283 Ga0307416_101734816
1284 Ga0307414_10856381
1285 Ga0307411_10083187
1286 Ga0307415_100046582
1287 Ga0307415_100136450
1288 Ga0373940_0322671
1289 Ga0373951_0000860
1290 Ga0373951_0208611
1291 Ga0373937_0311356
1292 Ga0395899_0264204
1293 Ga0395900_0990140
1294 Ga0395898_0246717
1295 Ga0395901_0049484
1296 Ga0242422_00126
1297 Ga0242420_013515
1298 Ga0242420_062226
1299 Ga0436362_0487810
1300 Ga0450923_130297
1301 Ga0451577_1248473
1302 Ga0453683_0379712
1303 Ga0451576_0293247
1304 Ga0451576_0670331
1305 Ga0495651_0336368
1306 Ga0495582_0195721
1307 Ga0495664_0092302
1308 Ga0495584_0551925
1309 Ga0495643_0092580
1310 Ga0495642_0350631
1311 Ga0495658_0203430
1312 Ga0495600_0195560
1313 Ga0495581_0478282
1314 Ga0495636_0120364
1315 Ga0495636_0323217
1316 Ga0496100_0189681
1317 Ga0496103_0337503
1318 Ga0496104_0157049
1319 Ga0496106_0041160
1320 Ga0496106_0246948
1321 Ga0496106_1484123
1322 Ga0496107_0484466
1323 Ga0496108_0033450
1324 Ga0496108_0101926
1325 Ga0496108_0816449
1326 Ga0496109_0335467
1327 Ga0496110_0152897
1328 Ga0496110_0395181
1329 Ga0496111_0313748
1330 Ga0496112_0045725
1331 Ga0496112_0173291
1332 Ga0496112_0273049
1333 Ga0496112_0929811
1334 Ga0496112_1449829
1335 Ga0496113_0687778
1336 Ga0501298_001680
1337 Ga0501299_010427
1338 Ga0501299_177515
1339 Ga0501300_025948
1340 Ga0501038_0006231
1341 Ga0501077_0117616
1342 Ga0501198_095594
1343 Ga0501207_080902
1344 Ga0501208_054533
1345 Ga0501216_005822
1346 Ga0501217_296904
1347 Ga0501224_010902
1348 Ga0501233_002058
1349 Ga0501233_035884
1350 Ga0501233_171772
1351 Ga0501235_050739
1352 Ga0501240_003234
1353 Ga0501243_049542
1354 Ga0501249_028200
1355 Ga0501259_017830
1356 Ga0501221_020949
1357 Ga0501245_023640
1358 Ga0501283_024384
1359 Ga0501283_075187
1360 nmdc:mga05p37_1278410_c1
1361 nmdc:mga05p37_155535_c1
1362 nmdc:mga05p37_30988_c1
1363 nmdc:mga09592_138139_c1
1364 nmdc:mga09592_237527_c1
1365 nmdc:mga09592_643569_c1
1366 nmdc:mga09592_765744_c1
1367 nmdc:mga0qj67_1158116_c1
1368 nmdc:mga0qj67_421074_c1
1369 nmdc:mga0qj67_668756_c1
1370 nmdc:mga06r32_216317_c1
1371 nmdc:mga06r32_313283_c1
1372 nmdc:mga08y16_379072_c1
1373 nmdc:mga0n895_1262181_c1
1374 nmdc:mga0n895_85878_c1
1375 nmdc:mga0rr50_3996_c1
1376 nmdc:mga08x19_11296_c1
1377 nmdc:mga08x19_9_c1
1378 nmdc:mga0a205_246328_c1
1379 nmdc:mga0a205_442393_c1
1380 nmdc:mga0a205_83520_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13279

4HBT_2

Thioesterase-like superfamily

13

135

0.97

PF03061

4HBT

Thioesterase superfamily

22

107

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9553 6 134
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9512 7 135
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9504 5 135
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9429 7 135
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9364 5 135
ID Description Score Start End Superfamily
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9553 6 134 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9512 7 135 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9303 7 135 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.93 7 115 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9265 6 134 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V7WKL6-F1-model_v4 Uncharacterized protein 0.991 5 139 GO:0047617
AF-A0A7W0UZJ2-F1-model_v4 Acyl-CoA thioesterase 0.9877 9 142 GO:0047617
AF-A0A2V8M106-F1-model_v4 Uncharacterized protein 0.9858 5 140 GO:0047617
AF-A0A2V7XNH8-F1-model_v4 Thioesterase domain-containing protein 0.9839 4 139 GO:0047617
AF-A0A2V2R855-F1-model_v4 Acyl-CoA thioesterase 0.9826 1 139 GO:0047617

Map