F475442

General Info

Members Datasets Scaffolds Average Seq Length
690 305 1380 224

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100545106|Ga0075435_1005451062
Length 257
Sequence MAQNTIKIAPSILAADFARLGEQVAEAEQAGADRIHVDVMDGHFVPNISLGAPIIKSLRQVTRLPLETHLMISDPDFFFDEFVEAGSDSFLVHWEGNNNLHRTVQRVKSLGKQVGVVINPATPASVLEEILSELDLVLVMTVNPGFGHQHFIHTTLPKIKRVRQMIEQRRPECELELDGGIDAATVRLGVEAGADVLVAGTSIFGGNESVDAAMKRLRAAINDAVNKVSSLASSNPEGIASSSPGLRETSYSGPSRH

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 6.38
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100545106 3300007076 Bacteria 1004
2 SwRhRL2b_contig_3656164 2162886007 Unclassified 1188
3 JGI24745J21846_1001170 3300002073 Bacteria 2511
4 JGI24738J21930_10010024 3300002075 Bacteria 2119
5 JGI24749J21850_1014777 3300002076 Bacteria 1095
6 JGI24742J22300_10001465 3300002244 Bacteria 3723
7 JGI25406J46586_10027657 3300003203 Bacteria 2171
8 Ga0065704_10008130 3300005289 Bacteria 2739
9 Ga0065704_10096008 3300005289 Bacteria 2462
10 Ga0065712_10014304 3300005290 Bacteria 2557
11 Ga0065712_10036161 3300005290 Bacteria 1134
12 Ga0065707_10088483 3300005295 Bacteria 4647
13 Ga0070676_10029063 3300005328 Bacteria 3142
14 Ga0070683_100062365 3300005329 Bacteria 3466
15 Ga0070670_100081527 3300005331 Bacteria 2780
16 Ga0070670_100417738 3300005331 Bacteria 1185
17 Ga0068869_100004138 3300005334 Bacteria 8995
18 Ga0070666_10150777 3300005335 Bacteria 1622
19 Ga0070680_100307268 3300005336 Bacteria 1345
20 Ga0070682_100124716 3300005337 Bacteria 1734
21 Ga0068868_100201246 3300005338 Bacteria 1660
22 Ga0068868_100504730 3300005338 Bacteria 1060
23 Ga0070660_100193062 3300005339 Bacteria 1650
24 Ga0070689_100104783 3300005340 Bacteria 2243
25 Ga0070691_10011498 3300005341 Unclassified 4041
26 Ga0070691_10110141 3300005341 Bacteria 1376
27 Ga0070687_100482775 3300005343 Bacteria 831
28 Ga0070692_10115636 3300005345 Bacteria 1489
29 Ga0070692_10119809 3300005345 Bacteria 1466
30 Ga0070668_100003563 3300005347 Bacteria 11479
31 Ga0070668_100210731 3300005347 Bacteria 1598
32 Ga0070669_100029954 3300005353 Bacteria 3925
33 Ga0070669_100067297 3300005353 Bacteria 2642
34 Ga0070669_100139239 3300005353 Bacteria 1869
35 Ga0070675_100053067 3300005354 Bacteria 3334
36 Ga0070675_100196209 3300005354 Bacteria 1751
37 Ga0070675_100730656 3300005354 Bacteria 903
38 Ga0070671_100014889 3300005355 Bacteria 6284
39 Ga0070671_100156784 3300005355 Bacteria 1923
40 Ga0070674_100132986 3300005356 Bacteria 1857
41 Ga0070674_100604951 3300005356 Bacteria 927
42 Ga0070673_100047346 3300005364 Bacteria 3345
43 Ga0070673_100372277 3300005364 Bacteria 1272
44 Ga0070688_100200778 3300005365 Bacteria 1395
45 Ga0070659_100043877 3300005366 Bacteria 3498
46 Ga0070667_100049478 3300005367 Bacteria 3540
47 Ga0070667_100051482 3300005367 Bacteria 3472
48 Ga0070714_100117840 3300005435 Bacteria 2359
49 Ga0070714_100656102 3300005435 Bacteria 1010
50 Ga0070713_100359263 3300005436 Bacteria 1353
51 Ga0070711_100000001 3300005439 Bacteria 370591
52 Ga0070705_100111746 3300005440 Bacteria 1747
53 Ga0070705_100332569 3300005440 Bacteria 1101
54 Ga0070705_100532088 3300005440 Bacteria 898
55 Ga0070700_100073960 3300005441 Bacteria 2182
56 Ga0070708_100004157 3300005445 Bacteria 11367
57 Ga0070708_100018462 3300005445 Bacteria 5837
58 Ga0070708_100045576 3300005445 Bacteria 3864
59 Ga0070708_100050523 3300005445 Bacteria 3682
60 Ga0070708_100054823 3300005445 Bacteria 3543
61 Ga0070708_100228918 3300005445 Bacteria 1744
62 Ga0070663_100018782 3300005455 Bacteria 4541
63 Ga0070678_100180296 3300005456 Bacteria 1728
64 Ga0070678_100648865 3300005456 Bacteria 947
65 Ga0070662_100049159 3300005457 Bacteria 3041
66 Ga0070681_10210065 3300005458 Bacteria 1863
67 Ga0070685_10249386 3300005466 Bacteria 1175
68 Ga0070706_100000180 3300005467 Bacteria 80488
69 Ga0070706_100001440 3300005467 Bacteria 25108
70 Ga0070706_100013294 3300005467 Bacteria 7614
71 Ga0070706_100058023 3300005467 Bacteria 3572
72 Ga0070706_100068939 3300005467 Bacteria 3271
73 Ga0070706_100097530 3300005467 Bacteria 2730
74 Ga0070706_100103253 3300005467 Bacteria 2650
75 Ga0070706_100143102 3300005467 Bacteria 2232
76 Ga0070706_100746906 3300005467 Bacteria 906
77 Ga0070706_101104293 3300005467 Bacteria 730
78 Ga0070707_100001597 3300005468 Bacteria 21953
79 Ga0070707_100025826 3300005468 Bacteria 5575
80 Ga0070707_100137720 3300005468 Bacteria 2375
81 Ga0070707_100234809 3300005468 Bacteria 1785
82 Ga0070707_100309040 3300005468 Bacteria 1536
83 Ga0070707_100462292 3300005468 Bacteria 1230
84 Ga0070707_100691726 3300005468 Bacteria 982
85 Ga0070707_100806152 3300005468 Bacteria 903
86 Ga0070707_101000126 3300005468 Bacteria 801
87 Ga0070698_100008466 3300005471 Bacteria 11110
88 Ga0070698_100031254 3300005471 Bacteria 5520
89 Ga0070698_100070610 3300005471 Bacteria 3504
90 Ga0070698_100073139 3300005471 Bacteria 3435
91 Ga0070698_100083964 3300005471 Bacteria 3174
92 Ga0070698_100244328 3300005471 Bacteria 1728
93 Ga0070699_100001782 3300005518 Bacteria 19616
94 Ga0070699_100004657 3300005518 Bacteria 12133
95 Ga0070699_100004715 3300005518 Bacteria 12058
96 Ga0070699_100217145 3300005518 Bacteria 1703
97 Ga0070699_100412839 3300005518 Bacteria 1221
98 Ga0070699_100869217 3300005518 Bacteria 826
99 Ga0070679_100012709 3300005530 Bacteria 8053
100 Ga0070684_100026057 3300005535 Bacteria 4921
101 Ga0070697_100005696 3300005536 Bacteria 9597
102 Ga0070697_100046203 3300005536 Bacteria 3529
103 Ga0070697_100059126 3300005536 Bacteria 3120
104 Ga0070697_100108556 3300005536 Bacteria 2310
105 Ga0070697_100141943 3300005536 Bacteria 2020
106 Ga0070697_100202043 3300005536 Bacteria 1689
107 Ga0070697_100257643 3300005536 Bacteria 1493
108 Ga0070697_100264800 3300005536 Bacteria 1472
109 Ga0070697_100328681 3300005536 Bacteria 1318
110 Ga0070672_100337171 3300005543 Bacteria 1283
111 Ga0070686_100029548 3300005544 Bacteria 3335
112 Ga0070686_100338087 3300005544 Bacteria 1127
113 Ga0070695_100032706 3300005545 Bacteria 3252
114 Ga0070695_100117931 3300005545 Bacteria 1812
115 Ga0070696_100000423 3300005546 Bacteria 26477
116 Ga0070696_100031240 3300005546 Bacteria 3649
117 Ga0070696_100036919 3300005546 Bacteria 3371
118 Ga0070693_100043718 3300005547 Bacteria 2531
119 Ga0070665_100033236 3300005548 Bacteria 5190
120 Ga0070665_100083515 3300005548 Bacteria 3198
121 Ga0070704_100271672 3300005549 Bacteria 1401
122 Ga0070704_100288459 3300005549 Bacteria 1363
123 Ga0070664_100057997 3300005564 Bacteria 3293
124 Ga0070664_100071786 3300005564 Bacteria 2967
125 Ga0070664_100142611 3300005564 Bacteria 2110
126 Ga0068857_100003449 3300005577 Bacteria 13186
127 Ga0068857_100322812 3300005577 Bacteria 1426
128 Ga0070702_100005030 3300005615 Bacteria 6108
129 Ga0068852_100079443 3300005616 Bacteria 2906
130 Ga0068859_100132058 3300005617 Bacteria 2569
131 Ga0068864_100077462 3300005618 Bacteria 2907
132 Ga0068864_100347942 3300005618 Bacteria 1398
133 Ga0068866_10019196 3300005718 Bacteria 3106
134 Ga0068851_10058585 3300005834 Bacteria 1969
135 Ga0068870_10007855 3300005840 Bacteria 4770
136 Ga0068863_100082929 3300005841 Bacteria 3038
137 Ga0068863_100101396 3300005841 Bacteria 2736
138 Ga0068863_100211419 3300005841 Bacteria 1868
139 Ga0068863_100269604 3300005841 Bacteria 1647
140 Ga0068858_100035461 3300005842 Bacteria 4627
141 Ga0068858_100245022 3300005842 Bacteria 1701
142 Ga0068860_100137421 3300005843 Bacteria 2347
143 Ga0081455_10050748 3300005937 Unclassified 3564
144 Ga0081455_10065386 3300005937 Bacteria 3042
145 Ga0081455_10447543 3300005937 Bacteria 883
146 Ga0081538_10007982 3300005981 Bacteria 9057
147 Ga0081538_10027131 3300005981 Bacteria 3980
148 Ga0081540_1044207 3300005983 Bacteria 2276
149 Ga0081539_10021947 3300005985 Bacteria 4242
150 Ga0070717_10001557 3300006028 Bacteria 15889
151 Ga0070717_10001602 3300006028 Bacteria 15654
152 Ga0070717_10007843 3300006028 Bacteria 7946
153 Ga0070717_10066237 3300006028 Bacteria 3003
154 Ga0070717_10133948 3300006028 Bacteria 2133
155 Ga0070717_10261570 3300006028 Bacteria 1531
156 Ga0070717_10547497 3300006028 Bacteria 1048
157 Ga0070717_10812014 3300006028 Bacteria 851
158 Ga0075365_10098677 3300006038 Bacteria 1998
159 Ga0075365_10256524 3300006038 Bacteria 1229
160 Ga0070716_100060441 3300006173 Bacteria 2189
161 Ga0070712_100065661 3300006175 Bacteria 2576
162 Ga0070712_100091287 3300006175 Bacteria 2231
163 Ga0075362_10056300 3300006177 Bacteria 1769
164 Ga0075367_10213928 3300006178 Bacteria 1205
165 Ga0068871_100194260 3300006358 Bacteria 1749
166 Ga0075428_100023959 3300006844 Bacteria 6754
167 Ga0075428_100124444 3300006844 Bacteria 2806
168 Ga0075428_100232933 3300006844 Bacteria 1987
169 Ga0075428_100245992 3300006844 Bacteria 1928
170 Ga0075428_100485982 3300006844 Bacteria 1321
171 Ga0075428_100563529 3300006844 Unclassified 1217
172 Ga0075430_100035420 3300006846 Bacteria 4234
173 Ga0075430_100156581 3300006846 Bacteria 1896
174 Ga0075430_100535780 3300006846 Bacteria 966
175 Ga0075431_100130422 3300006847 Bacteria 2593
176 Ga0075431_100176071 3300006847 Bacteria 2197
177 Ga0075431_100200884 3300006847 Bacteria 2039
178 Ga0075433_10035488 3300006852 Bacteria 4288
179 Ga0075433_10099872 3300006852 Bacteria 2569
180 Ga0075433_10129977 3300006852 Bacteria 2237
181 Ga0075433_10166975 3300006852 Bacteria 1959
182 Ga0075433_10181759 3300006852 Bacteria 1872
183 Ga0075433_10318654 3300006852 Bacteria 1376
184 Ga0075434_100069168 3300006871 Bacteria 3520
185 Ga0075434_100085031 3300006871 Bacteria 3162
186 Ga0075434_100116033 3300006871 Bacteria 2690
187 Ga0075434_100123183 3300006871 Bacteria 2609
188 Ga0075434_100166601 3300006871 Bacteria 2224
189 Ga0075434_100197854 3300006871 Bacteria 2029
190 Ga0075434_100201229 3300006871 Bacteria 2011
191 Ga0075434_100234593 3300006871 Bacteria 1854
192 Ga0075434_100289284 3300006871 Bacteria 1658
193 Ga0075434_100303931 3300006871 Bacteria 1616
194 Ga0075434_100499257 3300006871 Archaea 1238
195 Ga0075434_100619001 3300006871 Bacteria 1101
196 Ga0075429_100004883 3300006880 Bacteria 11556
197 Ga0075429_100007019 3300006880 Bacteria 9787
198 Ga0075429_100020060 3300006880 Bacteria 5795
199 Ga0075429_100186107 3300006880 Bacteria 1820
200 Ga0075429_100342154 3300006880 Bacteria 1309
201 Ga0068865_100029253 3300006881 Bacteria 3653
202 Ga0068865_100176432 3300006881 Bacteria 1642
203 Ga0068865_100419587 3300006881 Bacteria 1100
204 Ga0075436_100004136 3300006914 Bacteria 9955
205 Ga0075436_100028518 3300006914 Bacteria 3839
206 Ga0097620_100132064 3300006931 Bacteria 2569
207 Ga0075435_100002717 3300007076 Bacteria 11814
208 Ga0075435_100069289 3300007076 Bacteria 2876
209 Ga0075435_100117274 3300007076 Bacteria 2219
210 Ga0075435_100225469 3300007076 Bacteria 1592
211 Ga0075435_100323244 3300007076 Bacteria 1321
212 Ga0075435_100808990 3300007076 Bacteria 816
213 Ga0075435_100850544 3300007076 Bacteria 795
214 Ga0099794_10005655 3300007265 Bacteria 5034
215 Ga0099794_10209860 3300007265 Bacteria 999
216 Ga0111539_10090016 3300009094 Bacteria 3606
217 Ga0111539_10254080 3300009094 Bacteria 2047
218 Ga0111539_10523577 3300009094 Bacteria 1381
219 Ga0111539_10549799 3300009094 Bacteria 1345
220 Ga0111539_10641122 3300009094 Bacteria 1237
221 Ga0105245_10026747 3300009098 Bacteria 5080
222 Ga0105245_10096142 3300009098 Bacteria 2733
223 Ga0105245_10129822 3300009098 Bacteria 2363
224 Ga0105245_10150059 3300009098 Bacteria 2203
225 Ga0105247_10006020 3300009101 Bacteria 7554
226 Ga0105247_10095281 3300009101 Bacteria 1895
227 Ga0114129_10000460 3300009147 Bacteria 48735
228 Ga0114129_10029104 3300009147 Bacteria 7824
229 Ga0114129_10183990 3300009147 Bacteria 2841
230 Ga0114129_10186523 3300009147 Bacteria 2819
231 Ga0114129_10263530 3300009147 Bacteria 2308
232 Ga0114129_10324993 3300009147 Bacteria 2044
233 Ga0114129_10456492 3300009147 Bacteria 1675
234 Ga0114129_10466058 3300009147 Bacteria 1655
235 Ga0114129_10553985 3300009147 Bacteria 1495
236 Ga0114129_10554648 3300009147 Bacteria 1494
237 Ga0114129_10571468 3300009147 Bacteria 1468
238 Ga0114129_10721593 3300009147 Bacteria 1279
239 Ga0114129_11048286 3300009147 Bacteria 1024
240 Ga0114129_11606731 3300009147 Bacteria 796
241 Ga0105243_10046316 3300009148 Bacteria 3421
242 Ga0105243_10296359 3300009148 Bacteria 1464
243 Ga0105241_10373480 3300009174 Bacteria 1244
244 Ga0105242_10046352 3300009176 Bacteria 3527
245 Ga0105242_10415463 3300009176 Bacteria 1259
246 Ga0105248_10060348 3300009177 Bacteria 4257
247 Ga0105248_10295711 3300009177 Bacteria 1823
248 Ga0105248_10421076 3300009177 Bacteria 1504
249 Ga0105237_10228744 3300009545 Bacteria 1860
250 Ga0105237_10505760 3300009545 Bacteria 1215
251 Ga0105237_10506836 3300009545 Bacteria 1213
252 Ga0105238_10111708 3300009551 Bacteria 2713
253 Ga0105249_10225091 3300009553 Bacteria 1847
254 Ga0105249_10321680 3300009553 Bacteria 1558
255 Ga0105249_10388408 3300009553 Bacteria 1423
256 Ga0105249_10601152 3300009553 Bacteria 1154
257 Ga0105239_10018060 3300010375 Bacteria 7803
258 Ga0105239_10180628 3300010375 Bacteria 2361
259 Ga0105239_10291582 3300010375 Bacteria 1837
260 Ga0105239_10449850 3300010375 Bacteria 1461
261 Ga0105246_10140707 3300011119 Bacteria 1814
262 Ga0105246_10426726 3300011119 Bacteria 1108
263 Ga0157370_10477912 3300013104 Bacteria 1145
264 Ga0157374_10000377 3300013296 Bacteria 41023
265 Ga0157374_10120479 3300013296 Bacteria 2532
266 Ga0157374_10482767 3300013296 Bacteria 1242
267 Ga0157374_10537315 3300013296 Bacteria 1176
268 Ga0157374_10596037 3300013296 Bacteria 1115
269 Ga0157378_10173127 3300013297 Bacteria 2026
270 Ga0157378_10374460 3300013297 Bacteria 1397
271 Ga0157378_10574136 3300013297 Bacteria 1136
272 Ga0157378_10661349 3300013297 Unclassified 1061
273 Ga0157378_10722665 3300013297 Bacteria 1017
274 Ga0163162_10083508 3300013306 Bacteria 3268
275 Ga0163162_10131162 3300013306 Bacteria 2615
276 Ga0163162_10320004 3300013306 Bacteria 1684
277 Ga0163162_10403260 3300013306 Bacteria 1500
278 Ga0163162_10724687 3300013306 Bacteria 1115
279 Ga0163162_10977396 3300013306 Bacteria 957
280 Ga0157372_10101779 3300013307 Unclassified 3280
281 Ga0157372_10184730 3300013307 Bacteria 2414
282 Ga0157375_10146073 3300013308 Bacteria 2496
283 Ga0163163_10029506 3300014325 Bacteria 5277
284 Ga0163163_10146182 3300014325 Bacteria 2408
285 Ga0157380_10100000 3300014326 Bacteria 2413
286 Ga0157377_10043090 3300014745 Bacteria 2510
287 Ga0157379_10020074 3300014968 Bacteria 5905
288 Ga0157376_10090158 3300014969 Bacteria 2653
289 Ga0157376_10178227 3300014969 Bacteria 1941
290 Ga0163161_10050271 3300017792 Bacteria 3017
291 Ga0163161_10079216 3300017792 Bacteria 2416
292 Ga0206349_1942866 3300020075 Unclassified 1401
293 Ga0206351_10260509 3300020077 Bacteria 708
294 Ga0206352_10549449 3300020078 Bacteria 5148
295 Ga0206350_10735723 3300020080 Bacteria 714
296 Ga0206350_10980878 3300020080 Bacteria 6204
297 Ga0206354_11005961 3300020081 Bacteria 706
298 Ga0213872_10005436 3300021361 Bacteria 6561
299 Ga0213872_10011433 3300021361 Bacteria 4197
300 Ga0213872_10100710 3300021361 Bacteria 1288
301 Ga0213872_10118895 3300021361 Unclassified 1169
302 Ga0213874_10002003 3300021377 Bacteria 4298
303 Ga0213874_10018168 3300021377 Bacteria 1897
304 Ga0213874_10065745 3300021377 Bacteria 1146
305 Ga0213875_10141759 3300021388 Bacteria 1125
306 Ga0213871_10020081 3300021441 Bacteria 1652
307 Ga0224712_10022579 3300022467 Bacteria 2171
308 Ga0207697_10086132 3300025315 Bacteria 1328
309 Ga0207656_10018542 3300025321 Bacteria 2742
310 Ga0207653_10000120 3300025885 Bacteria 55535
311 Ga0207653_10039552 3300025885 Bacteria 1544
312 Ga0207710_10127969 3300025900 Bacteria 1218
313 Ga0207688_10006272 3300025901 Bacteria 6475
314 Ga0207647_10019384 3300025904 Bacteria 4576
315 Ga0207685_10073057 3300025905 Bacteria 1396
316 Ga0207699_10068641 3300025906 Bacteria 2159
317 Ga0207699_10376694 3300025906 Bacteria 1006
318 Ga0207645_10007791 3300025907 Bacteria 7537
319 Ga0207684_10000388 3300025910 Bacteria 59094
320 Ga0207684_10000956 3300025910 Bacteria 32546
321 Ga0207684_10002152 3300025910 Bacteria 20191
322 Ga0207684_10002259 3300025910 Bacteria 19621
323 Ga0207684_10004902 3300025910 Bacteria 12491
324 Ga0207684_10023982 3300025910 Bacteria 5205
325 Ga0207684_10091848 3300025910 Bacteria 2587
326 Ga0207684_10209340 3300025910 Bacteria 1682
327 Ga0207671_10223873 3300025914 Bacteria 1474
328 Ga0207671_10344101 3300025914 Bacteria 1182
329 Ga0207693_10009939 3300025915 Bacteria 7735
330 Ga0207693_10042409 3300025915 Bacteria 3582
331 Ga0207693_10283149 3300025915 Bacteria 1299
332 Ga0207693_10342423 3300025915 Bacteria 1170
333 Ga0207663_10000001 3300025916 Bacteria 591990
334 Ga0207663_10543312 3300025916 Bacteria 908
335 Ga0207662_10079649 3300025918 Bacteria 1996
336 Ga0207662_10115034 3300025918 Bacteria 1681
337 Ga0207657_10136579 3300025919 Bacteria 2006
338 Ga0207649_10038887 3300025920 Bacteria 2882
339 Ga0207652_10010625 3300025921 Bacteria 7412
340 Ga0207652_10055883 3300025921 Bacteria 3397
341 Ga0207652_10819908 3300025921 Bacteria 825
342 Ga0207646_10001620 3300025922 Bacteria 27449
343 Ga0207646_10002479 3300025922 Bacteria 21794
344 Ga0207646_10022118 3300025922 Bacteria 5864
345 Ga0207646_10051674 3300025922 Bacteria 3677
346 Ga0207646_10101633 3300025922 Bacteria 2577
347 Ga0207646_10198944 3300025922 Bacteria 1810
348 Ga0207646_10301942 3300025922 Bacteria 1446
349 Ga0207681_10053456 3300025923 Bacteria 2742
350 Ga0207694_10082382 3300025924 Bacteria 2529
351 Ga0207650_10058580 3300025925 Bacteria 2868
352 Ga0207650_10067632 3300025925 Bacteria 2681
353 Ga0207659_10175753 3300025926 Bacteria 1692
354 Ga0207659_10558728 3300025926 Bacteria 973
355 Ga0207659_10706996 3300025926 Bacteria 863
356 Ga0207687_10032217 3300025927 Bacteria 3549
357 Ga0207687_10067435 3300025927 Bacteria 2545
358 Ga0207687_10264810 3300025927 Bacteria 1372
359 Ga0207700_10110026 3300025928 Bacteria 2215
360 Ga0207700_10221252 3300025928 Bacteria 1605
361 Ga0207700_10312888 3300025928 Bacteria 1359
362 Ga0207664_10158375 3300025929 Bacteria 1929
363 Ga0207664_10247493 3300025929 Bacteria 1554
364 Ga0207644_10064821 3300025931 Bacteria 2655
365 Ga0207644_10414727 3300025931 Bacteria 1102
366 Ga0207690_10030727 3300025932 Bacteria 3430
367 Ga0207706_10068275 3300025933 Bacteria 3128
368 Ga0207706_10113979 3300025933 Bacteria 2378
369 Ga0207706_10170632 3300025933 Bacteria 1911
370 Ga0207706_10343930 3300025933 Bacteria 1297
371 Ga0207686_10333903 3300025934 Bacteria 1136
372 Ga0207709_10295885 3300025935 Bacteria 1202
373 Ga0207709_10391226 3300025935 Bacteria 1060
374 Ga0207670_10230643 3300025936 Bacteria 1422
375 Ga0207669_10044364 3300025937 Bacteria 2611
376 Ga0207669_10305025 3300025937 Unclassified 1212
377 Ga0207669_10471156 3300025937 Bacteria 999
378 Ga0207704_10013318 3300025938 Bacteria 4112
379 Ga0207704_10051283 3300025938 Bacteria 2494
380 Ga0207665_10339550 3300025939 Bacteria 1131
381 Ga0207691_10053527 3300025940 Bacteria 3685
382 Ga0207691_10127537 3300025940 Bacteria 2250
383 Ga0207711_10030299 3300025941 Bacteria 4563
384 Ga0207711_10402479 3300025941 Bacteria 1272
385 Ga0207689_10098574 3300025942 Bacteria 2401
386 Ga0207689_10498836 3300025942 Bacteria 1020
387 Ga0207661_10317043 3300025944 Bacteria 1401
388 Ga0207679_10064755 3300025945 Bacteria 2733
389 Ga0207679_10441884 3300025945 Bacteria 1152
390 Ga0207667_10287589 3300025949 Bacteria 1680
391 Ga0207651_10015326 3300025960 Bacteria 4452
392 Ga0207712_10047821 3300025961 Bacteria 2972
393 Ga0207712_10150213 3300025961 Bacteria 1799
394 Ga0207712_10422223 3300025961 Bacteria 1125
395 Ga0207668_10029708 3300025972 Bacteria 3585
396 Ga0207668_10051231 3300025972 Bacteria 2850
397 Ga0207677_10183304 3300026023 Bacteria 1649
398 Ga0207677_10203437 3300026023 Bacteria 1575
399 Ga0207703_10021323 3300026035 Bacteria 5073
400 Ga0207703_10075114 3300026035 Bacteria 2800
401 Ga0207678_10001556 3300026067 Bacteria 21059
402 Ga0207678_10082629 3300026067 Bacteria 2748
403 Ga0207708_10001604 3300026075 Bacteria 16845
404 Ga0207641_10015200 3300026088 Bacteria 6308
405 Ga0207641_10022610 3300026088 Bacteria 5176
406 Ga0207641_10217930 3300026088 Bacteria 1768
407 Ga0207641_10643585 3300026088 Bacteria 1041
408 Ga0207648_10043557 3300026089 Bacteria 3939
409 Ga0207648_10445931 3300026089 Bacteria 1178
410 Ga0207676_10257048 3300026095 Bacteria 1575
411 Ga0207674_10006994 3300026116 Bacteria 13196
412 Ga0207675_100004661 3300026118 Bacteria 13210
413 Ga0207675_100442553 3300026118 Bacteria 1287
414 Ga0207683_10004771 3300026121 Bacteria 11671
415 Ga0207683_10395169 3300026121 Bacteria 1272
416 Ga0207698_10075054 3300026142 Bacteria 2700
417 Ga0209588_1018371 3300027671 Bacteria 2176
418 Ga0209998_10011466 3300027717 Bacteria 1835
419 Ga0207428_10010798 3300027907 Bacteria 8140
420 Ga0207428_10115457 3300027907 Bacteria 2062
421 Ga0268265_10031730 3300028380 Bacteria 3818
422 Ga0268264_10776099 3300028381 Bacteria 956
423 Ga0265322_10066388 3300028654 Bacteria 1023
424 Ga0265338_10011135 3300028800 Bacteria 10428
425 Ga0265338_10015445 3300028800 Bacteria 8384
426 Ga0265332_10000912 3300031238 Bacteria 17744
427 Ga0265328_10004852 3300031239 Bacteria 5794
428 Ga0265328_10010616 3300031239 Bacteria 3699
429 Ga0265320_10012795 3300031240 Bacteria 4862
430 Ga0265329_10002483 3300031242 Bacteria 8327
431 Ga0265340_10016150 3300031247 Bacteria 3870
432 Ga0265340_10064732 3300031247 Bacteria 1742
433 Ga0265339_10005924 3300031249 Bacteria 8093
434 Ga0265339_10077708 3300031249 Bacteria 1759
435 Ga0265331_10000381 3300031250 Bacteria 46160
436 Ga0265327_10063201 3300031251 Bacteria 1881
437 Ga0265316_10000522 3300031344 Bacteria 43400
438 Ga0265314_10000653 3300031711 Bacteria 42465
439 Ga0265314_10001989 3300031711 Bacteria 21700
440 Ga0265342_10047097 3300031712 Bacteria 2588
441 Ga0373938_0011039 3300034957 Bacteria 1673
442 Ga0373932_0026093 3300035112 Bacteria 1587
443 Ga0373932_0217310 3300035112 Bacteria 685
444 Ga0373936_0036901 3300035113 Bacteria 1950
445 Ga0373936_0142788 3300035113 Bacteria 1034
446 Ga0373954_0009234 3300035118 Bacteria 4337
447 Ga0373956_0002702 3300035119 Bacteria 7181
448 Ga0373943_0004675 3300035170 Bacteria 6192
449 Ga0373943_0010949 3300035170 Bacteria 4076
450 Ga0373943_0023617 3300035170 Bacteria 2860
451 Ga0373946_0028427 3300035171 Bacteria 2218
452 Ga0373931_0017861 3300035691 Bacteria 3516
453 Ga0373931_0064937 3300035691 Bacteria 1977
454 Ga0373931_0086994 3300035691 Bacteria 1735
455 Ga0373935_0009631 3300035692 Bacteria 5783
456 Ga0373935_0045466 3300035692 Bacteria 2771
457 Ga0373935_0368840 3300035692 Bacteria 1026
458 Ga0373935_0592014 3300035692 Bacteria 811
459 Ga0373927_0000256 3300035695 Bacteria 41861
460 Ga0373927_0001229 3300035695 Bacteria 19456
461 Ga0373927_0052362 3300035695 Bacteria 2640
462 Ga0373927_0573889 3300035695 Bacteria 745
463 Ga0373933_0014839 3300035724 Bacteria 4336
464 Ga0373947_0004879 3300035725 Bacteria 7846
465 Ga0373947_0008753 3300035725 Bacteria 5818
466 Ga0373947_0016103 3300035725 Bacteria 4296
467 Ga0373947_0050796 3300035725 Bacteria 2493
468 Ga0373947_0123138 3300035725 Bacteria 1649
469 Ga0373947_0248756 3300035725 Bacteria 1175
470 Ga0373937_0145856 3300036401 Bacteria 2216
471 Ga0373937_0289897 3300036401 Bacteria 1546
472 Ga0373925_0000229 3300037068 Bacteria 59752
473 Ga0373925_0020782 3300037068 Bacteria 4783
474 Ga0373925_0068787 3300037068 Bacteria 2674
475 Ga0395898_0033346 3300037466 Bacteria 5140
476 Ga0395905_0237210 3300037471 Bacteria 1705
477 Ga0436364_0491980 3300037853 Bacteria 1243
478 Ga0436364_0673974 3300037853 Bacteria 1325
479 Ga0436364_0737333 3300037853 Bacteria 47273
480 Ga0436360_0430870 3300039438 Bacteria 7868
481 Ga0436360_0569045 3300039438 Bacteria 1588
482 Ga0436360_1353222 3300039438 Bacteria 1437
483 Ga0436361_0406336 3300039447 Bacteria 8197
484 Ga0436361_0436414 3300039447 Bacteria 1961
485 Ga0436361_0478803 3300039447 Bacteria 4018
486 Ga0436361_0550333 3300039447 Bacteria 912
487 Ga0436361_0566606 3300039447 Bacteria 9082
488 Ga0436361_0874952 3300039447 Bacteria 4448
489 Ga0436361_1168341 3300039447 Bacteria 2191
490 Ga0436361_1183561 3300039447 Bacteria 1002
491 Ga0436363_0820729 3300039450 Bacteria 17625
492 Ga0436363_0925260 3300039450 Bacteria 8838
493 Ga0436363_1085038 3300039450 Bacteria 5318
494 Ga0436362_0017587 3300039453 Bacteria 1284
495 Ga0436362_0183071 3300039453 Bacteria 756
496 Ga0436362_0212378 3300039453 Bacteria 1756
497 Ga0436362_0510505 3300039453 Bacteria 1035
498 Ga0436362_1262574 3300039453 Bacteria 1425
499 Ga0436362_1266172 3300039453 Bacteria 889
500 Ga0436362_1291049 3300039453 Bacteria 1737
501 Ga0451853_3060727 3300041512 Bacteria 1335
502 Ga0439448_0041884 3300042005 Bacteria 1483
503 Ga0439464_0014666 3300042439 Bacteria 2109
504 Ga0466972_0009306 3300044658 Bacteria 4938
505 Ga0466972_0092665 3300044658 Bacteria 1432
506 Ga0453683_0009578 3300044673 Bacteria 6463
507 Ga0453683_0199105 3300044673 Bacteria 1272
508 Ga0466965_0070021 3300044683 Bacteria 1763
509 Ga0466966_0000945 3300044684 Bacteria 18582
510 Ga0466961_0084862 3300044693 Bacteria 2003
511 Ga0453684_0034236 3300044712 Bacteria 7056
512 Ga0466968_0000832 3300044735 Bacteria 10745
513 Ga0466970_0000515 3300044765 Bacteria 19015
514 Ga0466970_0026762 3300044765 Bacteria 3024
515 Ga0466959_0022191 3300045049 Bacteria 4690
516 Ga0466959_0078278 3300045049 Bacteria 2385
517 Ga0466958_0115819 3300045836 Bacteria 1675
518 Ga0495592_0191201 3300046454 Bacteria 1387
519 Ga0495638_0151392 3300046460 Bacteria 1345
520 Ga0495653_0049672 3300046463 Bacteria 3230
521 Ga0495580_0000538 3300046472 Bacteria 31978
522 Ga0495580_0072078 3300046472 Bacteria 2413
523 Ga0495582_0000116 3300046473 Bacteria 42232
524 Ga0495639_0126619 3300046475 Bacteria 1221
525 Ga0495639_0219282 3300046475 Bacteria 935
526 Ga0495662_0044556 3300046476 Bacteria 2142
527 Ga0495662_0264592 3300046476 Unclassified 846
528 Ga0495584_0024037 3300046491 Bacteria 3089
529 Ga0495585_0052490 3300046492 Bacteria 2257
530 Ga0495585_0077162 3300046492 Bacteria 1809
531 Ga0495594_0079480 3300046499 Bacteria 1831
532 Ga0495596_0103506 3300046500 Bacteria 1106
533 Ga0495616_0053199 3300046513 Bacteria 2013
534 Ga0495618_0058769 3300046514 Bacteria 2436
535 Ga0495630_0122051 3300046517 Bacteria 1977
536 Ga0495663_0049636 3300046525 Bacteria 1296
537 Ga0495666_0047178 3300046526 Bacteria 2075
538 Ga0495665_0000352 3300046531 Bacteria 23275
539 Ga0495586_0417060 3300046535 Bacteria 773
540 Ga0495621_0054210 3300046539 Bacteria 1441
541 Ga0495645_0087552 3300046543 Bacteria 2228
542 Ga0495656_0003118 3300046615 Bacteria 5575
543 Ga0495656_0005948 3300046615 Bacteria 4245
544 Ga0495656_0084137 3300046615 Bacteria 1442
545 Ga0495668_0236626 3300046616 Bacteria 1000
546 Ga0495634_0352869 3300046642 Bacteria 880
547 Ga0495611_0047869 3300046648 Bacteria 1920
548 Ga0495647_0045252 3300046681 Bacteria 1690
549 Ga0495658_0162932 3300046683 Bacteria 1376
550 Ga0495669_0200492 3300046684 Bacteria 954
551 Ga0495613_0045739 3300046689 Bacteria 3236
552 Ga0495613_0047023 3300046689 Bacteria 3188
553 Ga0495613_0098019 3300046689 Bacteria 2118
554 Ga0495624_0085446 3300046690 Bacteria 1949
555 Ga0495624_0140162 3300046690 Bacteria 1481
556 Ga0495670_0040662 3300046691 Bacteria 2319
557 Ga0495649_0177103 3300046694 Bacteria 1114
558 Ga0495589_0029970 3300046794 Bacteria 2742
559 Ga0495581_0132103 3300047315 Bacteria 1455
560 Ga0495636_0040235 3300047318 Bacteria 1938
561 Ga0495676_0093284 3300047321 Bacteria 2245
562 Ga0495602_0390295 3300048088 Bacteria 995
563 Ga0496100_0013220 3300048903 Bacteria 4753
564 Ga0496100_0159262 3300048903 Bacteria 1617
565 Ga0496101_0050966 3300048904 Bacteria 2981
566 Ga0496101_0234358 3300048904 Bacteria 1427
567 Ga0496102_0156528 3300048905 Bacteria 2142
568 Ga0496102_0261529 3300048905 Bacteria 1631
569 Ga0496103_0003147 3300048906 Bacteria 10138
570 Ga0496103_0070326 3300048906 Bacteria 2189
571 Ga0496103_0284880 3300048906 Bacteria 1063
572 Ga0496104_0011256 3300048907 Bacteria 8006
573 Ga0496104_0018903 3300048907 Bacteria 6294
574 Ga0496104_0030082 3300048907 Bacteria 5043
575 Ga0496105_0001762 3300048908 Bacteria 15472
576 Ga0496105_0031947 3300048908 Bacteria 4317
577 Ga0496106_0009698 3300048909 Bacteria 7108
578 Ga0496106_0095333 3300048909 Bacteria 2301
579 Ga0496106_0335874 3300048909 Bacteria 1213
580 Ga0496107_0086536 3300048910 Bacteria 2287
581 Ga0496108_0008535 3300048911 Bacteria 8308
582 Ga0496108_0028632 3300048911 Bacteria 4609
583 Ga0496108_0126742 3300048911 Bacteria 2192
584 Ga0496109_0000945 3300048912 Bacteria 24010
585 Ga0496109_0029852 3300048912 Bacteria 4886
586 Ga0496109_0091110 3300048912 Bacteria 2819
587 Ga0496109_0162340 3300048912 Bacteria 2094
588 Ga0496109_0412869 3300048912 Bacteria 1275
589 Ga0496110_0003220 3300048913 Bacteria 12436
590 Ga0496110_0004777 3300048913 Bacteria 10548
591 Ga0496110_0103998 3300048913 Bacteria 2547
592 Ga0496110_0777275 3300048913 Bacteria 861
593 Ga0496111_0006914 3300048914 Bacteria 7404
594 Ga0496111_0030952 3300048914 Bacteria 3808
595 Ga0496112_0013483 3300048915 Bacteria 7547
596 Ga0496112_0046734 3300048915 Bacteria 4247
597 Ga0496112_0070280 3300048915 Bacteria 3460
598 Ga0496112_0508141 3300048915 Bacteria 1140
599 Ga0496113_0000599 3300048916 Bacteria 17986
600 Ga0496113_0011048 3300048916 Bacteria 6003
601 Ga0496114_0007412 3300048917 Bacteria 8670
602 Ga0496114_0175361 3300048917 Bacteria 1870
603 Ga0496114_0209504 3300048917 Bacteria 1709
604 Ga0496115_0059950 3300048918 Bacteria 3065
605 Ga0496115_0224115 3300048918 Bacteria 1551
606 Ga0496115_0379599 3300048918 Bacteria 1149
607 Ga0496126_0408393 3300048929 Bacteria 1100
608 Ga0501039_0548666 3300049575 Bacteria 907
609 Ga0501043_0574675 3300049579 Bacteria 835
610 nmdc:mga03683_53958_c1 3300050489 Bacteria 1684
611 nmdc:mga00v17_248816_c1 3300050491 Bacteria 1152
612 nmdc:mga0yw44_9302_c1 3300050492 Bacteria 4957
613 nmdc:mga0yw44_93418_c1 3300050492 Bacteria 1905
614 nmdc:mga0k408_200200_c1 3300050493 Bacteria 1192
615 nmdc:mga06z11_12330_c1 3300050494 Bacteria 3716
616 nmdc:mga06z11_438286_c1 3300050494 Bacteria 789
617 nmdc:mga05p37_124598_c1 3300050507 Bacteria 3165
618 nmdc:mga05p37_1288053_c1 3300050507 Bacteria 746
619 nmdc:mga05p37_135624_c1 3300050507 Bacteria 3019
620 nmdc:mga05p37_190743_c1 3300050507 Bacteria 2035
621 nmdc:mga05p37_255562_c1 3300050507 Bacteria 2100
622 nmdc:mga05p37_2595_c1 3300050507 Bacteria 21024
623 nmdc:mga05p37_361234_c1 3300050507 Bacteria 1707
624 nmdc:mga05p37_40536_c1 3300050507 Bacteria 5719
625 nmdc:mga05p37_473443_c1 3300050507 Bacteria 1445
626 nmdc:mga05p37_5056_c1 3300050507 Bacteria 15460
627 nmdc:mga05p37_9100_c1 3300050507 Bacteria 11737
628 nmdc:mga05p37_92659_c1 3300050507 Bacteria 3723
629 nmdc:mga05p37_947087_c1 3300050507 Bacteria 922
630 nmdc:mga05p37_98167_c1 3300050507 Bacteria 3608
631 nmdc:mga05p37_99996_c1 3300050507 Bacteria 3572
632 nmdc:mga09592_238998_c1 3300050508 Bacteria 1574
633 nmdc:mga09592_26966_c1 3300050508 Bacteria 4764
634 nmdc:mga09592_355324_c1 3300050508 Bacteria 1268
635 nmdc:mga09592_41109_c1 3300050508 Bacteria 3887
636 nmdc:mga09592_5639_c1 3300050508 Bacteria 10207
637 nmdc:mga09592_65402_c1 3300050508 Bacteria 3081
638 nmdc:mga0qj67_163477_c1 3300050509 Bacteria 1807
639 nmdc:mga0qj67_26192_c1 3300050509 Bacteria 4513
640 nmdc:mga0qj67_361147_c1 3300050509 Bacteria 1173
641 nmdc:mga0qj67_3953_c1 3300050509 Bacteria 10726
642 nmdc:mga06r32_215295_c1 3300050510 Bacteria 1909
643 nmdc:mga06r32_36029_c1 3300050510 Bacteria 4672
644 nmdc:mga06r32_387293_c1 3300050510 Bacteria 1380
645 nmdc:mga06r32_45325_c1 3300050510 Bacteria 4191
646 nmdc:mga06r32_500985_c1 3300050510 Bacteria 1191
647 nmdc:mga06r32_93337_c1 3300050510 Bacteria 2944
648 nmdc:mga08y16_119814_c1 3300050511 Bacteria 2739
649 nmdc:mga08y16_127988_c1 3300050511 Bacteria 2642
650 nmdc:mga08y16_15067_c1 3300050511 Bacteria 8131
651 nmdc:mga08y16_233767_c1 3300050511 Bacteria 1901
652 nmdc:mga08y16_422350_c1 3300050511 Bacteria 1362
653 nmdc:mga0n895_11984_c1 3300050512 Bacteria 7759
654 nmdc:mga0n895_128683_c1 3300050512 Bacteria 2556
655 nmdc:mga0n895_142250_c1 3300050512 Bacteria 2428
656 nmdc:mga0n895_235083_c1 3300050512 Bacteria 1860
657 nmdc:mga0n895_347755_c1 3300050512 Bacteria 1501
658 nmdc:mga0n895_457231_c1 3300050512 Unclassified 1288
659 nmdc:mga0n895_47716_c1 3300050512 Bacteria 4188
660 nmdc:mga0n895_480830_c1 3300050512 Bacteria 1252
661 nmdc:mga0n895_65610_c1 3300050512 Bacteria 3593
662 nmdc:mga0n895_769274_c1 3300050512 Bacteria 955
663 nmdc:mga0n895_783219_c1 3300050512 Bacteria 945
664 nmdc:mga0n895_909727_c1 3300050512 Bacteria 865
665 nmdc:mga0n895_91955_c1 3300050512 Bacteria 3037
666 nmdc:mga0n895_92696_c1 3300050512 Bacteria 3024
667 nmdc:mga0rr50_108392_c1 3300050513 Bacteria 2194
668 nmdc:mga0rr50_254283_c1 3300050513 Bacteria 1460
669 nmdc:mga0rr50_277273_c1 3300050513 Bacteria 1398
670 nmdc:mga0rr50_297024_c1 3300050513 Bacteria 1351
671 nmdc:mga0rr50_361562_c1 3300050513 Bacteria 1222
672 nmdc:mga0rr50_73503_c1 3300050513 Bacteria 2614
673 nmdc:mga08x19_4010_c1 3300050514 Bacteria 8761
674 nmdc:mga08x19_76991_c1 3300050514 Bacteria 2184
675 nmdc:mga0a205_114232_c1 3300050515 Bacteria 2599
676 nmdc:mga0a205_127181_c1 3300050515 Bacteria 2448
677 nmdc:mga0a205_161302_c1 3300050515 Bacteria 2139
678 nmdc:mga0a205_161_c1 3300050515 Bacteria 44265
679 nmdc:mga0a205_200592_c1 3300050515 Bacteria 1886
680 nmdc:mga0a205_201758_c1 3300050515 Bacteria 1879
681 nmdc:mga0a205_260284_c1 3300050515 Bacteria 1613
682 nmdc:mga0a205_271644_c1 3300050515 Bacteria 1572
683 nmdc:mga0a205_81095_c1 3300050515 Bacteria 3134
684 Ga0495601_0050830 3300053077 Bacteria 2615
685 Ga0495612_0030118 3300053078 Bacteria 2186
686 Ga0495655_0009591 3300053083 Bacteria 1882
687 Ga0495655_0052608 3300053083 Bacteria 1083
688 Ga0495619_0007803 3300053085 Bacteria 6774
689 Ga0495619_0112837 3300053085 Bacteria 1858
690 Ga0501084_0496612 3300054114 Bacteria 1031
691 Ga0075435_100545106
692 SwRhRL2b_contig_3656164
693 JGI24745J21846_1001170
694 JGI24738J21930_10010024
695 JGI24749J21850_1014777
696 JGI24742J22300_10001465
697 JGI25406J46586_10027657
698 Ga0065704_10008130
699 Ga0065704_10096008
700 Ga0065712_10014304
701 Ga0065712_10036161
702 Ga0065707_10088483
703 Ga0070676_10029063
704 Ga0070683_100062365
705 Ga0070670_100081527
706 Ga0070670_100417738
707 Ga0068869_100004138
708 Ga0070666_10150777
709 Ga0070680_100307268
710 Ga0070682_100124716
711 Ga0068868_100201246
712 Ga0068868_100504730
713 Ga0070660_100193062
714 Ga0070689_100104783
715 Ga0070691_10011498
716 Ga0070691_10110141
717 Ga0070687_100482775
718 Ga0070692_10115636
719 Ga0070692_10119809
720 Ga0070668_100003563
721 Ga0070668_100210731
722 Ga0070669_100029954
723 Ga0070669_100067297
724 Ga0070669_100139239
725 Ga0070675_100053067
726 Ga0070675_100196209
727 Ga0070675_100730656
728 Ga0070671_100014889
729 Ga0070671_100156784
730 Ga0070674_100132986
731 Ga0070674_100604951
732 Ga0070673_100047346
733 Ga0070673_100372277
734 Ga0070688_100200778
735 Ga0070659_100043877
736 Ga0070667_100049478
737 Ga0070667_100051482
738 Ga0070714_100117840
739 Ga0070714_100656102
740 Ga0070713_100359263
741 Ga0070711_100000001
742 Ga0070705_100111746
743 Ga0070705_100332569
744 Ga0070705_100532088
745 Ga0070700_100073960
746 Ga0070708_100004157
747 Ga0070708_100018462
748 Ga0070708_100045576
749 Ga0070708_100050523
750 Ga0070708_100054823
751 Ga0070708_100228918
752 Ga0070663_100018782
753 Ga0070678_100180296
754 Ga0070678_100648865
755 Ga0070662_100049159
756 Ga0070681_10210065
757 Ga0070685_10249386
758 Ga0070706_100000180
759 Ga0070706_100001440
760 Ga0070706_100013294
761 Ga0070706_100058023
762 Ga0070706_100068939
763 Ga0070706_100097530
764 Ga0070706_100103253
765 Ga0070706_100143102
766 Ga0070706_100746906
767 Ga0070706_101104293
768 Ga0070707_100001597
769 Ga0070707_100025826
770 Ga0070707_100137720
771 Ga0070707_100234809
772 Ga0070707_100309040
773 Ga0070707_100462292
774 Ga0070707_100691726
775 Ga0070707_100806152
776 Ga0070707_101000126
777 Ga0070698_100008466
778 Ga0070698_100031254
779 Ga0070698_100070610
780 Ga0070698_100073139
781 Ga0070698_100083964
782 Ga0070698_100244328
783 Ga0070699_100001782
784 Ga0070699_100004657
785 Ga0070699_100004715
786 Ga0070699_100217145
787 Ga0070699_100412839
788 Ga0070699_100869217
789 Ga0070679_100012709
790 Ga0070684_100026057
791 Ga0070697_100005696
792 Ga0070697_100046203
793 Ga0070697_100059126
794 Ga0070697_100108556
795 Ga0070697_100141943
796 Ga0070697_100202043
797 Ga0070697_100257643
798 Ga0070697_100264800
799 Ga0070697_100328681
800 Ga0070672_100337171
801 Ga0070686_100029548
802 Ga0070686_100338087
803 Ga0070695_100032706
804 Ga0070695_100117931
805 Ga0070696_100000423
806 Ga0070696_100031240
807 Ga0070696_100036919
808 Ga0070693_100043718
809 Ga0070665_100033236
810 Ga0070665_100083515
811 Ga0070704_100271672
812 Ga0070704_100288459
813 Ga0070664_100057997
814 Ga0070664_100071786
815 Ga0070664_100142611
816 Ga0068857_100003449
817 Ga0068857_100322812
818 Ga0070702_100005030
819 Ga0068852_100079443
820 Ga0068859_100132058
821 Ga0068864_100077462
822 Ga0068864_100347942
823 Ga0068866_10019196
824 Ga0068851_10058585
825 Ga0068870_10007855
826 Ga0068863_100082929
827 Ga0068863_100101396
828 Ga0068863_100211419
829 Ga0068863_100269604
830 Ga0068858_100035461
831 Ga0068858_100245022
832 Ga0068860_100137421
833 Ga0081455_10050748
834 Ga0081455_10065386
835 Ga0081455_10447543
836 Ga0081538_10007982
837 Ga0081538_10027131
838 Ga0081540_1044207
839 Ga0081539_10021947
840 Ga0070717_10001557
841 Ga0070717_10001602
842 Ga0070717_10007843
843 Ga0070717_10066237
844 Ga0070717_10133948
845 Ga0070717_10261570
846 Ga0070717_10547497
847 Ga0070717_10812014
848 Ga0075365_10098677
849 Ga0075365_10256524
850 Ga0070716_100060441
851 Ga0070712_100065661
852 Ga0070712_100091287
853 Ga0075362_10056300
854 Ga0075367_10213928
855 Ga0068871_100194260
856 Ga0075428_100023959
857 Ga0075428_100124444
858 Ga0075428_100232933
859 Ga0075428_100245992
860 Ga0075428_100485982
861 Ga0075428_100563529
862 Ga0075430_100035420
863 Ga0075430_100156581
864 Ga0075430_100535780
865 Ga0075431_100130422
866 Ga0075431_100176071
867 Ga0075431_100200884
868 Ga0075433_10035488
869 Ga0075433_10099872
870 Ga0075433_10129977
871 Ga0075433_10166975
872 Ga0075433_10181759
873 Ga0075433_10318654
874 Ga0075434_100069168
875 Ga0075434_100085031
876 Ga0075434_100116033
877 Ga0075434_100123183
878 Ga0075434_100166601
879 Ga0075434_100197854
880 Ga0075434_100201229
881 Ga0075434_100234593
882 Ga0075434_100289284
883 Ga0075434_100303931
884 Ga0075434_100499257
885 Ga0075434_100619001
886 Ga0075429_100004883
887 Ga0075429_100007019
888 Ga0075429_100020060
889 Ga0075429_100186107
890 Ga0075429_100342154
891 Ga0068865_100029253
892 Ga0068865_100176432
893 Ga0068865_100419587
894 Ga0075436_100004136
895 Ga0075436_100028518
896 Ga0097620_100132064
897 Ga0075435_100002717
898 Ga0075435_100069289
899 Ga0075435_100117274
900 Ga0075435_100225469
901 Ga0075435_100323244
902 Ga0075435_100808990
903 Ga0075435_100850544
904 Ga0099794_10005655
905 Ga0099794_10209860
906 Ga0111539_10090016
907 Ga0111539_10254080
908 Ga0111539_10523577
909 Ga0111539_10549799
910 Ga0111539_10641122
911 Ga0105245_10026747
912 Ga0105245_10096142
913 Ga0105245_10129822
914 Ga0105245_10150059
915 Ga0105247_10006020
916 Ga0105247_10095281
917 Ga0114129_10000460
918 Ga0114129_10029104
919 Ga0114129_10183990
920 Ga0114129_10186523
921 Ga0114129_10263530
922 Ga0114129_10324993
923 Ga0114129_10456492
924 Ga0114129_10466058
925 Ga0114129_10553985
926 Ga0114129_10554648
927 Ga0114129_10571468
928 Ga0114129_10721593
929 Ga0114129_11048286
930 Ga0114129_11606731
931 Ga0105243_10046316
932 Ga0105243_10296359
933 Ga0105241_10373480
934 Ga0105242_10046352
935 Ga0105242_10415463
936 Ga0105248_10060348
937 Ga0105248_10295711
938 Ga0105248_10421076
939 Ga0105237_10228744
940 Ga0105237_10505760
941 Ga0105237_10506836
942 Ga0105238_10111708
943 Ga0105249_10225091
944 Ga0105249_10321680
945 Ga0105249_10388408
946 Ga0105249_10601152
947 Ga0105239_10018060
948 Ga0105239_10180628
949 Ga0105239_10291582
950 Ga0105239_10449850
951 Ga0105246_10140707
952 Ga0105246_10426726
953 Ga0157370_10477912
954 Ga0157374_10000377
955 Ga0157374_10120479
956 Ga0157374_10482767
957 Ga0157374_10537315
958 Ga0157374_10596037
959 Ga0157378_10173127
960 Ga0157378_10374460
961 Ga0157378_10574136
962 Ga0157378_10661349
963 Ga0157378_10722665
964 Ga0163162_10083508
965 Ga0163162_10131162
966 Ga0163162_10320004
967 Ga0163162_10403260
968 Ga0163162_10724687
969 Ga0163162_10977396
970 Ga0157372_10101779
971 Ga0157372_10184730
972 Ga0157375_10146073
973 Ga0163163_10029506
974 Ga0163163_10146182
975 Ga0157380_10100000
976 Ga0157377_10043090
977 Ga0157379_10020074
978 Ga0157376_10090158
979 Ga0157376_10178227
980 Ga0163161_10050271
981 Ga0163161_10079216
982 Ga0206349_1942866
983 Ga0206351_10260509
984 Ga0206352_10549449
985 Ga0206350_10735723
986 Ga0206350_10980878
987 Ga0206354_11005961
988 Ga0213872_10005436
989 Ga0213872_10011433
990 Ga0213872_10100710
991 Ga0213872_10118895
992 Ga0213874_10002003
993 Ga0213874_10018168
994 Ga0213874_10065745
995 Ga0213875_10141759
996 Ga0213871_10020081
997 Ga0224712_10022579
998 Ga0207697_10086132
999 Ga0207656_10018542
1000 Ga0207653_10000120
1001 Ga0207653_10039552
1002 Ga0207710_10127969
1003 Ga0207688_10006272
1004 Ga0207647_10019384
1005 Ga0207685_10073057
1006 Ga0207699_10068641
1007 Ga0207699_10376694
1008 Ga0207645_10007791
1009 Ga0207684_10000388
1010 Ga0207684_10000956
1011 Ga0207684_10002152
1012 Ga0207684_10002259
1013 Ga0207684_10004902
1014 Ga0207684_10023982
1015 Ga0207684_10091848
1016 Ga0207684_10209340
1017 Ga0207671_10223873
1018 Ga0207671_10344101
1019 Ga0207693_10009939
1020 Ga0207693_10042409
1021 Ga0207693_10283149
1022 Ga0207693_10342423
1023 Ga0207663_10000001
1024 Ga0207663_10543312
1025 Ga0207662_10079649
1026 Ga0207662_10115034
1027 Ga0207657_10136579
1028 Ga0207649_10038887
1029 Ga0207652_10010625
1030 Ga0207652_10055883
1031 Ga0207652_10819908
1032 Ga0207646_10001620
1033 Ga0207646_10002479
1034 Ga0207646_10022118
1035 Ga0207646_10051674
1036 Ga0207646_10101633
1037 Ga0207646_10198944
1038 Ga0207646_10301942
1039 Ga0207681_10053456
1040 Ga0207694_10082382
1041 Ga0207650_10058580
1042 Ga0207650_10067632
1043 Ga0207659_10175753
1044 Ga0207659_10558728
1045 Ga0207659_10706996
1046 Ga0207687_10032217
1047 Ga0207687_10067435
1048 Ga0207687_10264810
1049 Ga0207700_10110026
1050 Ga0207700_10221252
1051 Ga0207700_10312888
1052 Ga0207664_10158375
1053 Ga0207664_10247493
1054 Ga0207644_10064821
1055 Ga0207644_10414727
1056 Ga0207690_10030727
1057 Ga0207706_10068275
1058 Ga0207706_10113979
1059 Ga0207706_10170632
1060 Ga0207706_10343930
1061 Ga0207686_10333903
1062 Ga0207709_10295885
1063 Ga0207709_10391226
1064 Ga0207670_10230643
1065 Ga0207669_10044364
1066 Ga0207669_10305025
1067 Ga0207669_10471156
1068 Ga0207704_10013318
1069 Ga0207704_10051283
1070 Ga0207665_10339550
1071 Ga0207691_10053527
1072 Ga0207691_10127537
1073 Ga0207711_10030299
1074 Ga0207711_10402479
1075 Ga0207689_10098574
1076 Ga0207689_10498836
1077 Ga0207661_10317043
1078 Ga0207679_10064755
1079 Ga0207679_10441884
1080 Ga0207667_10287589
1081 Ga0207651_10015326
1082 Ga0207712_10047821
1083 Ga0207712_10150213
1084 Ga0207712_10422223
1085 Ga0207668_10029708
1086 Ga0207668_10051231
1087 Ga0207677_10183304
1088 Ga0207677_10203437
1089 Ga0207703_10021323
1090 Ga0207703_10075114
1091 Ga0207678_10001556
1092 Ga0207678_10082629
1093 Ga0207708_10001604
1094 Ga0207641_10015200
1095 Ga0207641_10022610
1096 Ga0207641_10217930
1097 Ga0207641_10643585
1098 Ga0207648_10043557
1099 Ga0207648_10445931
1100 Ga0207676_10257048
1101 Ga0207674_10006994
1102 Ga0207675_100004661
1103 Ga0207675_100442553
1104 Ga0207683_10004771
1105 Ga0207683_10395169
1106 Ga0207698_10075054
1107 Ga0209588_1018371
1108 Ga0209998_10011466
1109 Ga0207428_10010798
1110 Ga0207428_10115457
1111 Ga0268265_10031730
1112 Ga0268264_10776099
1113 Ga0265322_10066388
1114 Ga0265338_10011135
1115 Ga0265338_10015445
1116 Ga0265332_10000912
1117 Ga0265328_10004852
1118 Ga0265328_10010616
1119 Ga0265320_10012795
1120 Ga0265329_10002483
1121 Ga0265340_10016150
1122 Ga0265340_10064732
1123 Ga0265339_10005924
1124 Ga0265339_10077708
1125 Ga0265331_10000381
1126 Ga0265327_10063201
1127 Ga0265316_10000522
1128 Ga0265314_10000653
1129 Ga0265314_10001989
1130 Ga0265342_10047097
1131 Ga0373938_0011039
1132 Ga0373932_0026093
1133 Ga0373932_0217310
1134 Ga0373936_0036901
1135 Ga0373936_0142788
1136 Ga0373954_0009234
1137 Ga0373956_0002702
1138 Ga0373943_0004675
1139 Ga0373943_0010949
1140 Ga0373943_0023617
1141 Ga0373946_0028427
1142 Ga0373931_0017861
1143 Ga0373931_0064937
1144 Ga0373931_0086994
1145 Ga0373935_0009631
1146 Ga0373935_0045466
1147 Ga0373935_0368840
1148 Ga0373935_0592014
1149 Ga0373927_0000256
1150 Ga0373927_0001229
1151 Ga0373927_0052362
1152 Ga0373927_0573889
1153 Ga0373933_0014839
1154 Ga0373947_0004879
1155 Ga0373947_0008753
1156 Ga0373947_0016103
1157 Ga0373947_0050796
1158 Ga0373947_0123138
1159 Ga0373947_0248756
1160 Ga0373937_0145856
1161 Ga0373937_0289897
1162 Ga0373925_0000229
1163 Ga0373925_0020782
1164 Ga0373925_0068787
1165 Ga0395898_0033346
1166 Ga0395905_0237210
1167 Ga0436364_0491980
1168 Ga0436364_0673974
1169 Ga0436364_0737333
1170 Ga0436360_0430870
1171 Ga0436360_0569045
1172 Ga0436360_1353222
1173 Ga0436361_0406336
1174 Ga0436361_0436414
1175 Ga0436361_0478803
1176 Ga0436361_0550333
1177 Ga0436361_0566606
1178 Ga0436361_0874952
1179 Ga0436361_1168341
1180 Ga0436361_1183561
1181 Ga0436363_0820729
1182 Ga0436363_0925260
1183 Ga0436363_1085038
1184 Ga0436362_0017587
1185 Ga0436362_0183071
1186 Ga0436362_0212378
1187 Ga0436362_0510505
1188 Ga0436362_1262574
1189 Ga0436362_1266172
1190 Ga0436362_1291049
1191 Ga0451853_3060727
1192 Ga0439448_0041884
1193 Ga0439464_0014666
1194 Ga0466972_0009306
1195 Ga0466972_0092665
1196 Ga0453683_0009578
1197 Ga0453683_0199105
1198 Ga0466965_0070021
1199 Ga0466966_0000945
1200 Ga0466961_0084862
1201 Ga0453684_0034236
1202 Ga0466968_0000832
1203 Ga0466970_0000515
1204 Ga0466970_0026762
1205 Ga0466959_0022191
1206 Ga0466959_0078278
1207 Ga0466958_0115819
1208 Ga0495592_0191201
1209 Ga0495638_0151392
1210 Ga0495653_0049672
1211 Ga0495580_0000538
1212 Ga0495580_0072078
1213 Ga0495582_0000116
1214 Ga0495639_0126619
1215 Ga0495639_0219282
1216 Ga0495662_0044556
1217 Ga0495662_0264592
1218 Ga0495584_0024037
1219 Ga0495585_0052490
1220 Ga0495585_0077162
1221 Ga0495594_0079480
1222 Ga0495596_0103506
1223 Ga0495616_0053199
1224 Ga0495618_0058769
1225 Ga0495630_0122051
1226 Ga0495663_0049636
1227 Ga0495666_0047178
1228 Ga0495665_0000352
1229 Ga0495586_0417060
1230 Ga0495621_0054210
1231 Ga0495645_0087552
1232 Ga0495656_0003118
1233 Ga0495656_0005948
1234 Ga0495656_0084137
1235 Ga0495668_0236626
1236 Ga0495634_0352869
1237 Ga0495611_0047869
1238 Ga0495647_0045252
1239 Ga0495658_0162932
1240 Ga0495669_0200492
1241 Ga0495613_0045739
1242 Ga0495613_0047023
1243 Ga0495613_0098019
1244 Ga0495624_0085446
1245 Ga0495624_0140162
1246 Ga0495670_0040662
1247 Ga0495649_0177103
1248 Ga0495589_0029970
1249 Ga0495581_0132103
1250 Ga0495636_0040235
1251 Ga0495676_0093284
1252 Ga0495602_0390295
1253 Ga0496100_0013220
1254 Ga0496100_0159262
1255 Ga0496101_0050966
1256 Ga0496101_0234358
1257 Ga0496102_0156528
1258 Ga0496102_0261529
1259 Ga0496103_0003147
1260 Ga0496103_0070326
1261 Ga0496103_0284880
1262 Ga0496104_0011256
1263 Ga0496104_0018903
1264 Ga0496104_0030082
1265 Ga0496105_0001762
1266 Ga0496105_0031947
1267 Ga0496106_0009698
1268 Ga0496106_0095333
1269 Ga0496106_0335874
1270 Ga0496107_0086536
1271 Ga0496108_0008535
1272 Ga0496108_0028632
1273 Ga0496108_0126742
1274 Ga0496109_0000945
1275 Ga0496109_0029852
1276 Ga0496109_0091110
1277 Ga0496109_0162340
1278 Ga0496109_0412869
1279 Ga0496110_0003220
1280 Ga0496110_0004777
1281 Ga0496110_0103998
1282 Ga0496110_0777275
1283 Ga0496111_0006914
1284 Ga0496111_0030952
1285 Ga0496112_0013483
1286 Ga0496112_0046734
1287 Ga0496112_0070280
1288 Ga0496112_0508141
1289 Ga0496113_0000599
1290 Ga0496113_0011048
1291 Ga0496114_0007412
1292 Ga0496114_0175361
1293 Ga0496114_0209504
1294 Ga0496115_0059950
1295 Ga0496115_0224115
1296 Ga0496115_0379599
1297 Ga0496126_0408393
1298 Ga0501039_0548666
1299 Ga0501043_0574675
1300 nmdc:mga03683_53958_c1
1301 nmdc:mga00v17_248816_c1
1302 nmdc:mga0yw44_9302_c1
1303 nmdc:mga0yw44_93418_c1
1304 nmdc:mga0k408_200200_c1
1305 nmdc:mga06z11_12330_c1
1306 nmdc:mga06z11_438286_c1
1307 nmdc:mga05p37_124598_c1
1308 nmdc:mga05p37_1288053_c1
1309 nmdc:mga05p37_135624_c1
1310 nmdc:mga05p37_190743_c1
1311 nmdc:mga05p37_255562_c1
1312 nmdc:mga05p37_2595_c1
1313 nmdc:mga05p37_361234_c1
1314 nmdc:mga05p37_40536_c1
1315 nmdc:mga05p37_473443_c1
1316 nmdc:mga05p37_5056_c1
1317 nmdc:mga05p37_9100_c1
1318 nmdc:mga05p37_92659_c1
1319 nmdc:mga05p37_947087_c1
1320 nmdc:mga05p37_98167_c1
1321 nmdc:mga05p37_99996_c1
1322 nmdc:mga09592_238998_c1
1323 nmdc:mga09592_26966_c1
1324 nmdc:mga09592_355324_c1
1325 nmdc:mga09592_41109_c1
1326 nmdc:mga09592_5639_c1
1327 nmdc:mga09592_65402_c1
1328 nmdc:mga0qj67_163477_c1
1329 nmdc:mga0qj67_26192_c1
1330 nmdc:mga0qj67_361147_c1
1331 nmdc:mga0qj67_3953_c1
1332 nmdc:mga06r32_215295_c1
1333 nmdc:mga06r32_36029_c1
1334 nmdc:mga06r32_387293_c1
1335 nmdc:mga06r32_45325_c1
1336 nmdc:mga06r32_500985_c1
1337 nmdc:mga06r32_93337_c1
1338 nmdc:mga08y16_119814_c1
1339 nmdc:mga08y16_127988_c1
1340 nmdc:mga08y16_15067_c1
1341 nmdc:mga08y16_233767_c1
1342 nmdc:mga08y16_422350_c1
1343 nmdc:mga0n895_11984_c1
1344 nmdc:mga0n895_128683_c1
1345 nmdc:mga0n895_142250_c1
1346 nmdc:mga0n895_235083_c1
1347 nmdc:mga0n895_347755_c1
1348 nmdc:mga0n895_457231_c1
1349 nmdc:mga0n895_47716_c1
1350 nmdc:mga0n895_480830_c1
1351 nmdc:mga0n895_65610_c1
1352 nmdc:mga0n895_769274_c1
1353 nmdc:mga0n895_783219_c1
1354 nmdc:mga0n895_909727_c1
1355 nmdc:mga0n895_91955_c1
1356 nmdc:mga0n895_92696_c1
1357 nmdc:mga0rr50_108392_c1
1358 nmdc:mga0rr50_254283_c1
1359 nmdc:mga0rr50_277273_c1
1360 nmdc:mga0rr50_297024_c1
1361 nmdc:mga0rr50_361562_c1
1362 nmdc:mga0rr50_73503_c1
1363 nmdc:mga08x19_4010_c1
1364 nmdc:mga08x19_76991_c1
1365 nmdc:mga0a205_114232_c1
1366 nmdc:mga0a205_127181_c1
1367 nmdc:mga0a205_161302_c1
1368 nmdc:mga0a205_161_c1
1369 nmdc:mga0a205_200592_c1
1370 nmdc:mga0a205_201758_c1
1371 nmdc:mga0a205_260284_c1
1372 nmdc:mga0a205_271644_c1
1373 nmdc:mga0a205_81095_c1
1374 Ga0495601_0050830
1375 Ga0495612_0030118
1376 Ga0495655_0009591
1377 Ga0495655_0052608
1378 Ga0495619_0007803
1379 Ga0495619_0112837
1380 Ga0501084_0496612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

7

204

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9395 4 220
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9353 4 220
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.935 5 220
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9347 7 223
1tqj-assembly1.cif.gz_D crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9337 4 220
ID Description Score Start End Superfamily
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9349 6 223 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9347 4 222 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9337 4 220 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 4 220 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9265 4 222 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A317IJM5-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9557 3 221 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A523V7S2-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9525 6 221 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7C3BW27-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9519 5 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7Y5G2V8-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9513 5 221 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A2N9NY93-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9509 2 229 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Map