F475437

General Info

Members Datasets Scaffolds Average Seq Length
690 340 1380 205

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1030035|Ga0081540_10300352
Length 243
Sequence LIRFNLNGSRSRGDFSTGVGRLDPEPATMIVLKTGPWDLDMKLYDGGRAPNPRRVRIYLAEKGITVPLAPVDLGALQHKSADFAAINPVQRVPVLVLDDGSVIAESIAICRYFEALHPEPPLFGLGARAIAEVEMWNRRLELNLLFPIAHVFRNTHPAMKELEVPQVPAWAEANKPRIMDFLGILDRSLKDRPFAAGDRYTVADITGLVAIDFLKPAKLTVPETCASVRRWHAAVSARPSASA

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
321 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
337 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 9.71
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1030035 3300005983 Bacteria 3016
2 JGI24737J22298_10020459 3300001990 Bacteria 2112
3 JGI24743J22301_10003886 3300001991 Bacteria 2394
4 JGI24745J21846_1004566 3300002073 Bacteria 1486
5 JGI24748J21848_1013408 3300002074 Bacteria 969
6 JGI24749J21850_1002814 3300002076 Bacteria 2436
7 JGI24744J21845_10006855 3300002077 Bacteria 2353
8 JGI24742J22300_10001927 3300002244 Bacteria 3302
9 JGI25406J46586_10088639 3300003203 Bacteria 937
10 JGI25404J52841_10009621 3300003659 Bacteria 2068
11 JGI25405J52794_10010555 3300003911 Bacteria 1758
12 Ga0070690_100003592 3300005330 Bacteria 8519
13 Ga0070690_100610146 3300005330 Bacteria 829
14 Ga0070670_100086473 3300005331 Bacteria 2694
15 Ga0068869_100721428 3300005334 Bacteria 852
16 Ga0070666_10137959 3300005335 Bacteria 1698
17 Ga0070682_100798324 3300005337 Bacteria 767
18 Ga0070682_101079830 3300005337 Bacteria 671
19 Ga0068868_100057819 3300005338 Bacteria 3064
20 Ga0070660_100022408 3300005339 Bacteria 4671
21 Ga0070660_100038863 3300005339 Bacteria 3615
22 Ga0070660_100094545 3300005339 Bacteria 2361
23 Ga0070660_100504507 3300005339 Bacteria 1007
24 Ga0070689_100012700 3300005340 Bacteria 6076
25 Ga0070691_10038477 3300005341 Bacteria 2259
26 Ga0070687_100008252 3300005343 Bacteria 4400
27 Ga0070687_100044974 3300005343 Bacteria 2252
28 Ga0070661_100085385 3300005344 Bacteria 2332
29 Ga0070668_100043826 3300005347 Bacteria 3431
30 Ga0070669_100692857 3300005353 Bacteria 860
31 Ga0070671_100200764 3300005355 Unclassified 1691
32 Ga0070674_100075129 3300005356 Bacteria 2399
33 Ga0070673_100516697 3300005364 Bacteria 1082
34 Ga0070688_100016893 3300005365 Bacteria 4179
35 Ga0070688_100096345 3300005365 Bacteria 1943
36 Ga0070659_100015664 3300005366 Bacteria 5679
37 Ga0070659_100218054 3300005366 Bacteria 1574
38 Ga0070667_100074984 3300005367 Bacteria 2887
39 Ga0070703_10013916 3300005406 Bacteria 2286
40 Ga0070709_10012835 3300005434 Bacteria 4697
41 Ga0070713_100001338 3300005436 Bacteria 15759
42 Ga0070713_100021029 3300005436 Bacteria 5011
43 Ga0070713_100131482 3300005436 Bacteria 2208
44 Ga0070713_100203116 3300005436 Bacteria 1791
45 Ga0070710_10000951 3300005437 Bacteria 13753
46 Ga0070710_10292302 3300005437 Bacteria 1061
47 Ga0070701_10043339 3300005438 Bacteria 2301
48 Ga0070701_10603862 3300005438 Bacteria 727
49 Ga0070711_100140068 3300005439 Bacteria 1812
50 Ga0070711_100267867 3300005439 Bacteria 1347
51 Ga0070705_100028663 3300005440 Bacteria 3052
52 Ga0070705_100250628 3300005440 Bacteria 1243
53 Ga0070700_100388818 3300005441 Bacteria 1045
54 Ga0070708_100079192 3300005445 Bacteria 2972
55 Ga0070663_100130549 3300005455 Bacteria 1907
56 Ga0070678_101141037 3300005456 Bacteria 721
57 Ga0070662_100482187 3300005457 Bacteria 1032
58 Ga0070681_10040326 3300005458 Bacteria 4678
59 Ga0070681_10144146 3300005458 Bacteria 2311
60 Ga0070681_10172356 3300005458 Bacteria 2086
61 Ga0068867_100051396 3300005459 Bacteria 3040
62 Ga0068867_100460905 3300005459 Bacteria 1085
63 Ga0070685_10020204 3300005466 Bacteria 3603
64 Ga0070706_100094260 3300005467 Bacteria 2778
65 Ga0070706_100534348 3300005467 Bacteria 1091
66 Ga0070707_100030569 3300005468 Bacteria 5128
67 Ga0070707_100095548 3300005468 Bacteria 2878
68 Ga0070698_100009542 3300005471 Bacteria 10386
69 Ga0070699_100001182 3300005518 Bacteria 24181
70 Ga0070699_100013882 3300005518 Bacteria 6929
71 Ga0070699_100085605 3300005518 Unclassified 2750
72 Ga0070679_100008548 3300005530 Bacteria 9644
73 Ga0070679_100544964 3300005530 Bacteria 1104
74 Ga0070684_100135727 3300005535 Bacteria 2222
75 Ga0070684_100169493 3300005535 Bacteria 1983
76 Ga0070697_100013296 3300005536 Bacteria 6456
77 Ga0070697_100146783 3300005536 Bacteria 1986
78 Ga0068853_100252555 3300005539 Bacteria 1618
79 Ga0070672_100088280 3300005543 Bacteria 2496
80 Ga0070672_100479593 3300005543 Bacteria 1074
81 Ga0070686_100035764 3300005544 Bacteria 3069
82 Ga0070695_100012570 3300005545 Bacteria 5082
83 Ga0070695_100444357 3300005545 Bacteria 992
84 Ga0070696_100536292 3300005546 Bacteria 936
85 Ga0070665_100004104 3300005548 Bacteria 15320
86 Ga0070665_100120001 3300005548 Bacteria 2631
87 Ga0070704_100053097 3300005549 Bacteria 2863
88 Ga0070704_100238307 3300005549 Bacteria 1488
89 Ga0068855_100147540 3300005563 Bacteria 2676
90 Ga0070664_100123983 3300005564 Bacteria 2265
91 Ga0068857_100165259 3300005577 Bacteria 2010
92 Ga0068857_100419123 3300005577 Bacteria 1248
93 Ga0068854_100706643 3300005578 Bacteria 871
94 Ga0068856_100092072 3300005614 Bacteria 3016
95 Ga0068856_100163495 3300005614 Bacteria 2237
96 Ga0068856_100423980 3300005614 Bacteria 1350
97 Ga0070702_100010149 3300005615 Bacteria 4629
98 Ga0068852_100012438 3300005616 Bacteria 6463
99 Ga0068852_100061527 3300005616 Bacteria 3263
100 Ga0068859_100082692 3300005617 Bacteria 3253
101 Ga0068859_101124082 3300005617 Bacteria 864
102 Ga0068864_100139170 3300005618 Bacteria 2188
103 Ga0068864_100563826 3300005618 Bacteria 1102
104 Ga0068864_100926505 3300005618 Bacteria 861
105 Ga0068866_10016689 3300005718 Bacteria 3288
106 Ga0068861_101208374 3300005719 Bacteria 731
107 Ga0068863_100018268 3300005841 Bacteria 6714
108 Ga0068863_100133821 3300005841 Bacteria 2368
109 Ga0068863_100774671 3300005841 Bacteria 956
110 Ga0068858_100019474 3300005842 Bacteria 6348
111 Ga0068858_100492182 3300005842 Bacteria 1184
112 Ga0068860_100044044 3300005843 Bacteria 4255
113 Ga0068860_100064741 3300005843 Bacteria 3472
114 Ga0068860_100128764 3300005843 Bacteria 2427
115 Ga0068860_100129684 3300005843 Bacteria 2419
116 Ga0068860_100508529 3300005843 Bacteria 1203
117 Ga0068860_100856178 3300005843 Bacteria 924
118 Ga0068860_101307335 3300005843 Bacteria 746
119 Ga0068862_100096886 3300005844 Bacteria 2575
120 Ga0081455_10001208 3300005937 Bacteria 32347
121 Ga0081455_10049858 3300005937 Bacteria 3606
122 Ga0081455_10052653 3300005937 Bacteria 3483
123 Ga0081455_10089159 3300005937 Bacteria 2504
124 Ga0081455_10106533 3300005937 Bacteria 2237
125 Ga0081538_10023929 3300005981 Bacteria 4370
126 Ga0081538_10130057 3300005981 Bacteria 1185
127 Ga0081540_1000008 3300005983 Bacteria 203702
128 Ga0081540_1044351 3300005983 Bacteria 2271
129 Ga0081539_10022326 3300005985 Bacteria 4192
130 Ga0070717_10178004 3300006028 Bacteria 1852
131 Ga0070717_10200874 3300006028 Bacteria 1746
132 Ga0070717_10241789 3300006028 Bacteria 1592
133 Ga0070717_10442870 3300006028 Bacteria 1170
134 Ga0075365_10033316 3300006038 Bacteria 3318
135 Ga0075365_10062626 3300006038 Bacteria 2488
136 Ga0075365_10490224 3300006038 Bacteria 868
137 Ga0075363_100161852 3300006048 Bacteria 1267
138 Ga0075363_100165100 3300006048 Bacteria 1255
139 Ga0075363_100264215 3300006048 Unclassified 993
140 Ga0075363_100586946 3300006048 Unclassified 667
141 Ga0070715_10008500 3300006163 Bacteria 3581
142 Ga0070715_10014348 3300006163 Bacteria 2933
143 Ga0070715_10037611 3300006163 Bacteria 2004
144 Ga0070716_100000583 3300006173 Bacteria 15326
145 Ga0070712_100027995 3300006175 Bacteria 3766
146 Ga0070712_100034116 3300006175 Bacteria 3448
147 Ga0070712_100068831 3300006175 Bacteria 2523
148 Ga0070712_100646082 3300006175 Bacteria 898
149 Ga0075362_10024056 3300006177 Bacteria 2581
150 Ga0075367_10136068 3300006178 Bacteria 1520
151 Ga0075367_10264583 3300006178 Unclassified 1080
152 Ga0075366_10410203 3300006195 Bacteria 834
153 Ga0097621_100085221 3300006237 Bacteria 2635
154 Ga0075370_10278977 3300006353 Bacteria 992
155 Ga0068871_100079464 3300006358 Bacteria 2714
156 Ga0068871_100155353 3300006358 Bacteria 1953
157 Ga0068871_100556636 3300006358 Bacteria 1039
158 Ga0075428_100060912 3300006844 Bacteria 4133
159 Ga0075428_100127878 3300006844 Bacteria 2764
160 Ga0075428_100128336 3300006844 Bacteria 2759
161 Ga0075428_100354225 3300006844 Bacteria 1575
162 Ga0075428_100768175 3300006844 Bacteria 1025
163 Ga0075430_100000606 3300006846 Bacteria 27372
164 Ga0075430_100006598 3300006846 Bacteria 9779
165 Ga0075430_100232279 3300006846 Bacteria 1529
166 Ga0075431_100116175 3300006847 Bacteria 2762
167 Ga0075431_100169924 3300006847 Bacteria 2240
168 Ga0075433_10027816 3300006852 Bacteria 4801
169 Ga0075433_10103347 3300006852 Bacteria 2524
170 Ga0075433_10109042 3300006852 Bacteria 2456
171 Ga0075433_10180059 3300006852 Bacteria 1881
172 Ga0075434_100033867 3300006871 Bacteria 5043
173 Ga0075434_100121467 3300006871 Bacteria 2628
174 Ga0075434_100142566 3300006871 Bacteria 2416
175 Ga0075434_100769919 3300006871 Bacteria 979
176 Ga0075429_100009454 3300006880 Bacteria 8460
177 Ga0075429_100609577 3300006880 Bacteria 957
178 Ga0068865_100000817 3300006881 Bacteria 17554
179 Ga0075436_100004938 3300006914 Bacteria 9163
180 Ga0075436_100185276 3300006914 Unclassified 1472
181 Ga0097620_100082696 3300006931 Bacteria 3253
182 Ga0097620_101124071 3300006931 Bacteria 864
183 Ga0075435_100029139 3300007076 Bacteria 4332
184 Ga0075435_100190295 3300007076 Bacteria 1737
185 Ga0075435_100224269 3300007076 Bacteria 1596
186 Ga0075435_100261873 3300007076 Bacteria 1474
187 Ga0099795_10004043 3300007788 Bacteria 3732
188 Ga0105251_10133309 3300009011 Bacteria 1125
189 Ga0105240_10211627 3300009093 Bacteria 2265
190 Ga0111539_10018500 3300009094 Bacteria 8629
191 Ga0111539_10183897 3300009094 Bacteria 2441
192 Ga0111539_10322490 3300009094 Bacteria 1798
193 Ga0111539_10422312 3300009094 Bacteria 1553
194 Ga0111539_11261032 3300009094 Bacteria 858
195 Ga0105245_10016708 3300009098 Bacteria 6409
196 Ga0105245_10022054 3300009098 Bacteria 5589
197 Ga0105245_10390404 3300009098 Bacteria 1388
198 Ga0105245_10419987 3300009098 Bacteria 1340
199 Ga0105245_10542496 3300009098 Bacteria 1184
200 Ga0105245_11197898 3300009098 Bacteria 807
201 Ga0105247_10048542 3300009101 Bacteria 2607
202 Ga0105247_10173046 3300009101 Bacteria 1437
203 Ga0105247_10359759 3300009101 Bacteria 1026
204 Ga0114129_10003226 3300009147 Bacteria 22877
205 Ga0114129_10012927 3300009147 Bacteria 11880
206 Ga0114129_10082499 3300009147 Bacteria 4467
207 Ga0114129_10085273 3300009147 Bacteria 4382
208 Ga0114129_10167345 3300009147 Bacteria 2999
209 Ga0114129_10532045 3300009147 Bacteria 1531
210 Ga0114129_10697042 3300009147 Bacteria 1305
211 Ga0114129_10780284 3300009147 Bacteria 1221
212 Ga0114129_11126686 3300009147 Bacteria 981
213 Ga0105243_10018201 3300009148 Bacteria 5320
214 Ga0105243_10033776 3300009148 Bacteria 3956
215 Ga0105241_10280806 3300009174 Bacteria 1422
216 Ga0105241_11113846 3300009174 Bacteria 744
217 Ga0105242_10120636 3300009176 Unclassified 2249
218 Ga0105242_10149309 3300009176 Bacteria 2036
219 Ga0105248_10070027 3300009177 Bacteria 3939
220 Ga0105248_10078059 3300009177 Bacteria 3723
221 Ga0105248_10114472 3300009177 Bacteria 3042
222 Ga0105248_10348143 3300009177 Bacteria 1668
223 Ga0105238_10034538 3300009551 Bacteria 5144
224 Ga0105238_10199009 3300009551 Bacteria 1979
225 Ga0105238_10245673 3300009551 Bacteria 1767
226 Ga0105249_10001094 3300009553 Bacteria 24097
227 Ga0105249_10171426 3300009553 Bacteria 2105
228 Ga0105249_10220909 3300009553 Bacteria 1864
229 Ga0099796_10018592 3300010159 Bacteria 2091
230 Ga0105239_10427693 3300010375 Bacteria 1501
231 Ga0105239_10828723 3300010375 Bacteria 1060
232 Ga0105246_10065645 3300011119 Bacteria 2538
233 Ga0105246_10108149 3300011119 Bacteria 2038
234 Ga0105246_10139801 3300011119 Bacteria 1819
235 Ga0157373_10240825 3300013100 Bacteria 1279
236 Ga0157371_10064668 3300013102 Bacteria 2592
237 Ga0157370_10075965 3300013104 Bacteria 3166
238 Ga0157369_10050595 3300013105 Bacteria 4499
239 Ga0157369_10618796 3300013105 Bacteria 1117
240 Ga0157374_10333095 3300013296 Bacteria 1506
241 Ga0157378_10179292 3300013297 Bacteria 1992
242 Ga0157378_10316501 3300013297 Bacteria 1515
243 Ga0163162_10230913 3300013306 Bacteria 1981
244 Ga0163162_11051663 3300013306 Bacteria 921
245 Ga0157372_10076393 3300013307 Bacteria 3782
246 Ga0157375_10377337 3300013308 Bacteria 1584
247 Ga0163163_10012040 3300014325 Bacteria 7871
248 Ga0163163_10117713 3300014325 Bacteria 2689
249 Ga0163163_10661794 3300014325 Unclassified 1108
250 Ga0157380_10083614 3300014326 Bacteria 2615
251 Ga0157380_10313661 3300014326 Bacteria 1451
252 Ga0157377_10013007 3300014745 Bacteria 4201
253 Ga0157379_10095752 3300014968 Bacteria 2664
254 Ga0157379_10099931 3300014968 Bacteria 2605
255 Ga0157379_10561357 3300014968 Unclassified 1063
256 Ga0157379_11014561 3300014968 Bacteria 792
257 Ga0157376_10071061 3300014969 Bacteria 2957
258 Ga0157376_10921571 3300014969 Bacteria 893
259 Ga0182007_10029650 3300015262 Bacteria 1873
260 Ga0163161_10088315 3300017792 Bacteria 2292
261 Ga0213872_10006493 3300021361 Bacteria 5860
262 Ga0213872_10053071 3300021361 Bacteria 1839
263 Ga0213871_10030238 3300021441 Bacteria 1408
264 Ga0207697_10019933 3300025315 Bacteria 2748
265 Ga0207697_10057821 3300025315 Bacteria 1610
266 Ga0207692_10001071 3300025898 Bacteria 10008
267 Ga0207642_10017214 3300025899 Bacteria 2743
268 Ga0207710_10023389 3300025900 Bacteria 2655
269 Ga0207710_10107308 3300025900 Bacteria 1323
270 Ga0207688_10009441 3300025901 Bacteria 5310
271 Ga0207688_10157356 3300025901 Bacteria 1345
272 Ga0207680_10064367 3300025903 Bacteria 2248
273 Ga0207680_10067047 3300025903 Bacteria 2209
274 Ga0207647_10020098 3300025904 Bacteria 4483
275 Ga0207647_10042425 3300025904 Bacteria 2855
276 Ga0207685_10065582 3300025905 Bacteria 1454
277 Ga0207685_10142180 3300025905 Bacteria 1077
278 Ga0207645_10206743 3300025907 Bacteria 1292
279 Ga0207684_10207582 3300025910 Bacteria 1690
280 Ga0207654_10450579 3300025911 Bacteria 902
281 Ga0207707_10100228 3300025912 Bacteria 2531
282 Ga0207707_10105145 3300025912 Bacteria 2467
283 Ga0207707_10651717 3300025912 Unclassified 887
284 Ga0207695_10141882 3300025913 Bacteria 2350
285 Ga0207693_10018989 3300025915 Bacteria 5472
286 Ga0207693_10090543 3300025915 Bacteria 2398
287 Ga0207693_10147109 3300025915 Bacteria 1852
288 Ga0207693_10417579 3300025915 Bacteria 1049
289 Ga0207663_10032135 3300025916 Bacteria 3113
290 Ga0207663_10053051 3300025916 Bacteria 2531
291 Ga0207663_10441540 3300025916 Bacteria 1002
292 Ga0207660_10105120 3300025917 Bacteria 2115
293 Ga0207662_10012447 3300025918 Bacteria 4739
294 Ga0207662_10019596 3300025918 Bacteria 3853
295 Ga0207657_10061180 3300025919 Bacteria 3230
296 Ga0207657_10083925 3300025919 Bacteria 2671
297 Ga0207657_10261616 3300025919 Unclassified 1377
298 Ga0207652_10029836 3300025921 Bacteria 4564
299 Ga0207681_10063991 3300025923 Bacteria 2538
300 Ga0207650_10031566 3300025925 Bacteria 3827
301 Ga0207659_10036782 3300025926 Bacteria 3395
302 Ga0207659_10590441 3300025926 Bacteria 946
303 Ga0207687_10008243 3300025927 Bacteria 6817
304 Ga0207687_10009871 3300025927 Bacteria 6250
305 Ga0207687_10149303 3300025927 Bacteria 1781
306 Ga0207687_10904761 3300025927 Bacteria 755
307 Ga0207700_10185218 3300025928 Bacteria 1746
308 Ga0207700_10207423 3300025928 Bacteria 1655
309 Ga0207700_10280475 3300025928 Bacteria 1433
310 Ga0207700_11020677 3300025928 Bacteria 740
311 Ga0207664_10134428 3300025929 Bacteria 2085
312 Ga0207664_10237095 3300025929 Bacteria 1587
313 Ga0207644_10032220 3300025931 Bacteria 3655
314 Ga0207690_10046165 3300025932 Bacteria 2883
315 Ga0207690_10221948 3300025932 Bacteria 1446
316 Ga0207690_10566069 3300025932 Bacteria 925
317 Ga0207690_10988040 3300025932 Bacteria 700
318 Ga0207706_10108825 3300025933 Bacteria 2439
319 Ga0207706_10176812 3300025933 Bacteria 1875
320 Ga0207686_10031284 3300025934 Unclassified 3158
321 Ga0207686_10045138 3300025934 Bacteria 2710
322 Ga0207709_10022442 3300025935 Bacteria 3581
323 Ga0207709_10120563 3300025935 Bacteria 1770
324 Ga0207670_10001209 3300025936 Bacteria 13624
325 Ga0207669_10091986 3300025937 Bacteria 1977
326 Ga0207704_10146008 3300025938 Bacteria 1662
327 Ga0207704_10192908 3300025938 Bacteria 1483
328 Ga0207665_10000939 3300025939 Bacteria 19702
329 Ga0207665_10229471 3300025939 Bacteria 1364
330 Ga0207691_10004214 3300025940 Bacteria 13966
331 Ga0207711_10036799 3300025941 Bacteria 4154
332 Ga0207711_10060091 3300025941 Bacteria 3274
333 Ga0207711_10168638 3300025941 Unclassified 1985
334 Ga0207689_10022049 3300025942 Bacteria 5356
335 Ga0207679_10042782 3300025945 Bacteria 3257
336 Ga0207679_10234288 3300025945 Bacteria 1552
337 Ga0207667_10174086 3300025949 Bacteria 2212
338 Ga0207651_10868451 3300025960 Bacteria 802
339 Ga0207712_10012728 3300025961 Bacteria 5377
340 Ga0207712_10079043 3300025961 Bacteria 2388
341 Ga0207712_10171081 3300025961 Bacteria 1698
342 Ga0207668_10146054 3300025972 Bacteria 1825
343 Ga0207640_10150377 3300025981 Bacteria 1710
344 Ga0207658_10057667 3300025986 Bacteria 2887
345 Ga0207658_10148526 3300025986 Bacteria 1906
346 Ga0207677_10094202 3300026023 Bacteria 2185
347 Ga0207703_10098546 3300026035 Bacteria 2472
348 Ga0207639_10176774 3300026041 Bacteria 1812
349 Ga0207678_10009723 3300026067 Bacteria 8457
350 Ga0207708_10282745 3300026075 Bacteria 1345
351 Ga0207708_10688145 3300026075 Bacteria 873
352 Ga0207702_10101273 3300026078 Bacteria 2543
353 Ga0207702_10204207 3300026078 Bacteria 1834
354 Ga0207702_10375458 3300026078 Bacteria 1366
355 Ga0207641_10149700 3300026088 Bacteria 2113
356 Ga0207641_10496183 3300026088 Bacteria 1185
357 Ga0207648_10208843 3300026089 Bacteria 1733
358 Ga0207676_10009182 3300026095 Bacteria 7041
359 Ga0207676_10083520 3300026095 Bacteria 2601
360 Ga0207676_10421582 3300026095 Bacteria 1252
361 Ga0207676_11049226 3300026095 Bacteria 804
362 Ga0207674_10184289 3300026116 Bacteria 2038
363 Ga0207674_10402378 3300026116 Bacteria 1323
364 Ga0207675_100002495 3300026118 Bacteria 18213
365 Ga0207675_100075039 3300026118 Bacteria 3165
366 Ga0207683_10028413 3300026121 Bacteria 4836
367 Ga0207683_10077877 3300026121 Bacteria 2937
368 Ga0207698_10223226 3300026142 Bacteria 1704
369 Ga0207428_10021089 3300027907 Bacteria 5521
370 Ga0268266_10004249 3300028379 Bacteria 13776
371 Ga0268266_10018150 3300028379 Bacteria 5998
372 Ga0268266_10221985 3300028379 Bacteria 1737
373 Ga0268266_10545421 3300028379 Bacteria 1111
374 Ga0268265_10038724 3300028380 Bacteria 3508
375 Ga0268264_10023619 3300028381 Bacteria 5014
376 Ga0268264_10048278 3300028381 Bacteria 3541
377 Ga0268264_10245956 3300028381 Bacteria 1659
378 Ga0268264_10701619 3300028381 Bacteria 1005
379 Ga0265334_10003076 3300028573 Bacteria 7621
380 Ga0265325_10005527 3300031241 Bacteria 7801
381 Ga0265325_10124843 3300031241 Bacteria 1238
382 Ga0265342_10234430 3300031712 Bacteria 985
383 Ga0307416_100397160 3300032002 Bacteria 1415
384 Ga0307416_100617137 3300032002 Bacteria 1166
385 Ga0373944_0015715 3300035089 Bacteria 2127
386 Ga0373932_0037985 3300035112 Bacteria 1375
387 Ga0373936_0004777 3300035113 Bacteria 5116
388 Ga0373941_0008716 3300035115 Bacteria 2530
389 Ga0373941_0164072 3300035115 Bacteria 824
390 Ga0373945_0007175 3300035116 Bacteria 3606
391 Ga0373943_0076283 3300035170 Bacteria 1709
392 Ga0373943_0172398 3300035170 Bacteria 1184
393 Ga0373946_0013318 3300035171 Bacteria 3090
394 Ga0373946_0085541 3300035171 Bacteria 1388
395 Ga0373961_0218763 3300035241 Bacteria 678
396 Ga0373924_0260909 3300035410 Bacteria 768
397 Ga0373931_0014471 3300035691 Bacteria 3857
398 Ga0373931_0022458 3300035691 Bacteria 3176
399 Ga0373931_0051802 3300035691 Unclassified 2187
400 Ga0373931_0300110 3300035691 Bacteria 992
401 Ga0373935_0039766 3300035692 Bacteria 2949
402 Ga0373935_0354204 3300035692 Bacteria 1047
403 Ga0373927_0029382 3300035695 Bacteria 3582
404 Ga0373927_0038736 3300035695 Bacteria 3094
405 Ga0373927_0178641 3300035695 Bacteria 1392
406 Ga0373927_0268190 3300035695 Bacteria 1123
407 Ga0373947_0006765 3300035725 Bacteria 6651
408 Ga0373947_0193949 3300035725 Bacteria 1326
409 Ga0373937_0020008 3300036401 Bacteria 5996
410 Ga0373925_0030990 3300037068 Bacteria 3928
411 Ga0373925_0072598 3300037068 Bacteria 2603
412 Ga0373925_0116206 3300037068 Bacteria 2072
413 Ga0373925_0137812 3300037068 Bacteria 1908
414 Ga0373925_0380506 3300037068 Bacteria 1149
415 Ga0395899_0099424 3300037312 Bacteria 2101
416 Ga0395900_0053573 3300037418 Bacteria 4152
417 Ga0395900_0063098 3300037418 Bacteria 3809
418 Ga0395900_0579318 3300037418 Bacteria 1064
419 Ga0395900_0707485 3300037418 Bacteria 940
420 Ga0395898_0360867 3300037466 Bacteria 1385
421 Ga0395898_1161260 3300037466 Unclassified 704
422 Ga0395901_0007147 3300038443 Bacteria 11269
423 Ga0395901_0047246 3300038443 Bacteria 4469
424 Ga0395901_0073184 3300038443 Bacteria 3573
425 Ga0395901_1269495 3300038443 Unclassified 699
426 Ga0400483_071423 3300039062 Bacteria 11134
427 Ga0436365_0569252 3300039437 Bacteria 1824
428 Ga0436360_0031653 3300039438 Bacteria 988
429 Ga0436360_1200262 3300039438 Bacteria 4165
430 Ga0436361_0180188 3300039447 Bacteria 2450
431 Ga0436361_0430432 3300039447 Bacteria 1398
432 Ga0436361_0991103 3300039447 Bacteria 9829
433 Ga0451800_0878792 3300041459 Bacteria 982
434 Ga0451576_0815737 3300045051 Bacteria 980
435 Ga0495617_037001 3300046452 Bacteria 1636
436 Ga0495627_071932 3300046453 Bacteria 1009
437 Ga0495592_0072327 3300046454 Bacteria 2509
438 Ga0495592_0076857 3300046454 Bacteria 2422
439 Ga0495603_0122724 3300046455 Bacteria 1513
440 Ga0495638_0370377 3300046460 Bacteria 751
441 Ga0495641_0083518 3300046461 Bacteria 1430
442 Ga0495582_0015749 3300046473 Bacteria 4147
443 Ga0495582_0035955 3300046473 Bacteria 2724
444 Ga0495639_0059302 3300046475 Bacteria 1752
445 Ga0495639_0224620 3300046475 Bacteria 924
446 Ga0495662_0020074 3300046476 Bacteria 3234
447 Ga0495584_0318819 3300046491 Bacteria 789
448 Ga0495585_0025036 3300046492 Bacteria 3420
449 Ga0495585_0220522 3300046492 Bacteria 957
450 Ga0495594_0014984 3300046499 Bacteria 4069
451 Ga0495607_0195069 3300046501 Bacteria 1006
452 Ga0495616_0100305 3300046513 Bacteria 1359
453 Ga0495620_0114614 3300046515 Bacteria 1066
454 Ga0495630_0280131 3300046517 Unclassified 1274
455 Ga0495630_0466824 3300046517 Bacteria 967
456 Ga0495631_0153423 3300046518 Bacteria 988
457 Ga0495632_0218337 3300046519 Bacteria 863
458 Ga0495637_0061385 3300046520 Bacteria 1541
459 Ga0495637_0108625 3300046520 Bacteria 1077
460 Ga0495644_0016520 3300046523 Bacteria 2825
461 Ga0495663_0051012 3300046525 Bacteria 1280
462 Ga0495663_0097373 3300046525 Bacteria 965
463 Ga0495665_0179644 3300046531 Bacteria 1100
464 Ga0495640_0075833 3300046533 Bacteria 2245
465 Ga0495640_0318034 3300046533 Bacteria 964
466 Ga0495598_0001739 3300046537 Bacteria 4370
467 Ga0495598_0011965 3300046537 Bacteria 2116
468 Ga0495621_0058919 3300046539 Bacteria 1390
469 Ga0495633_0015732 3300046558 Bacteria 3921
470 Ga0495656_0013578 3300046615 Bacteria 3033
471 Ga0495656_0230510 3300046615 Bacteria 929
472 Ga0495668_0104437 3300046616 Bacteria 1550
473 Ga0495634_0054703 3300046642 Bacteria 2670
474 Ga0495611_0188993 3300046648 Bacteria 962
475 Ga0495659_0032331 3300046664 Bacteria 1831
476 Ga0495661_0161127 3300046665 Bacteria 1204
477 Ga0495661_0242488 3300046665 Bacteria 924
478 Ga0495588_0005847 3300046674 Bacteria 5506
479 Ga0495647_0035817 3300046681 Bacteria 1865
480 Ga0495658_0054933 3300046683 Bacteria 2267
481 Ga0495613_0621227 3300046689 Bacteria 717
482 Ga0495624_0020274 3300046690 Bacteria 4428
483 Ga0495670_0030623 3300046691 Bacteria 2673
484 Ga0495670_0119750 3300046691 Bacteria 1367
485 Ga0495670_0139595 3300046691 Bacteria 1267
486 Ga0495649_0106289 3300046694 Bacteria 1490
487 Ga0495589_0063227 3300046794 Bacteria 1816
488 Ga0495589_0213145 3300046794 Bacteria 909
489 Ga0495589_0280431 3300046794 Bacteria 775
490 Ga0495604_0051091 3300047317 Bacteria 3207
491 Ga0495674_0038021 3300047319 Bacteria 4323
492 Ga0495674_0211302 3300047319 Bacteria 1607
493 Ga0495676_0007833 3300047321 Bacteria 9798
494 Ga0495677_0153511 3300047445 Bacteria 887
495 Ga0495677_0174312 3300047445 Bacteria 833
496 Ga0495684_0362974 3300047471 Bacteria 1025
497 Ga0495615_0043163 3300048090 Bacteria 1134
498 Ga0496100_0020359 3300048903 Bacteria 3976
499 Ga0496100_0029666 3300048903 Bacteria 3385
500 Ga0496100_0050806 3300048903 Bacteria 2688
501 Ga0496100_0082193 3300048903 Bacteria 2178
502 Ga0496100_0337865 3300048903 Bacteria 1135
503 Ga0496100_0443495 3300048903 Unclassified 994
504 Ga0496101_0021506 3300048904 Bacteria 4432
505 Ga0496101_0027790 3300048904 Bacteria 3944
506 Ga0496101_0038842 3300048904 Bacteria 3382
507 Ga0496101_0282921 3300048904 Bacteria 1296
508 Ga0496102_0014795 3300048905 Bacteria 6785
509 Ga0496102_0058003 3300048905 Bacteria 3537
510 Ga0496102_0280910 3300048905 Bacteria 1569
511 Ga0496102_0281170 3300048905 Bacteria 1568
512 Ga0496103_0002508 3300048906 Bacteria 11507
513 Ga0496103_0012368 3300048906 Bacteria 5062
514 Ga0496104_0022526 3300048907 Bacteria 5786
515 Ga0496104_0090239 3300048907 Bacteria 2928
516 Ga0496104_0665952 3300048907 Unclassified 949
517 Ga0496105_0002763 3300048908 Bacteria 12816
518 Ga0496105_0003909 3300048908 Bacteria 11142
519 Ga0496105_0314134 3300048908 Unclassified 1257
520 Ga0496106_0013380 3300048909 Bacteria 6058
521 Ga0496106_0021610 3300048909 Bacteria 4777
522 Ga0496106_0030512 3300048909 Bacteria 4019
523 Ga0496106_0049560 3300048909 Bacteria 3164
524 Ga0496106_0149855 3300048909 Bacteria 1840
525 Ga0496106_0443335 3300048909 Bacteria 1043
526 Ga0496107_0006397 3300048910 Bacteria 8095
527 Ga0496107_0013872 3300048910 Bacteria 5632
528 Ga0496107_0039513 3300048910 Bacteria 3385
529 Ga0496107_0093054 3300048910 Bacteria 2204
530 Ga0496107_0204036 3300048910 Bacteria 1469
531 Ga0496107_0450147 3300048910 Bacteria 956
532 Ga0496107_0495152 3300048910 Bacteria 907
533 Ga0496108_0000378 3300048911 Bacteria 37061
534 Ga0496108_0029956 3300048911 Bacteria 4510
535 Ga0496108_0035448 3300048911 Bacteria 4147
536 Ga0496108_0113679 3300048911 Unclassified 2317
537 Ga0496109_0000386 3300048912 Bacteria 39999
538 Ga0496109_0016816 3300048912 Bacteria 6401
539 Ga0496109_0104545 3300048912 Bacteria 2629
540 Ga0496110_0002683 3300048913 Bacteria 13434
541 Ga0496110_0006786 3300048913 Bacteria 9105
542 Ga0496110_0018615 3300048913 Bacteria 5825
543 Ga0496110_0168826 3300048913 Unclassified 1984
544 Ga0496111_0000198 3300048914 Bacteria 27953
545 Ga0496111_0019586 3300048914 Bacteria 4704
546 Ga0496111_0043931 3300048914 Bacteria 3212
547 Ga0496111_0125552 3300048914 Bacteria 1896
548 Ga0496112_0000681 3300048915 Bacteria 23700
549 Ga0496112_0066432 3300048915 Bacteria 3558
550 Ga0496112_0106151 3300048915 Bacteria 2778
551 Ga0496112_0116565 3300048915 Bacteria 2641
552 Ga0496113_0000214 3300048916 Bacteria 27085
553 Ga0496113_0000558 3300048916 Bacteria 18513
554 Ga0496113_0042466 3300048916 Bacteria 3360
555 Ga0496113_0288568 3300048916 Bacteria 1312
556 Ga0496114_0037200 3300048917 Bacteria 4025
557 Ga0496114_0064713 3300048917 Bacteria 3062
558 Ga0496114_0145526 3300048917 Bacteria 2054
559 Ga0496115_0007951 3300048918 Bacteria 7827
560 Ga0496115_0136319 3300048918 Bacteria 2024
561 Ga0496115_0242151 3300048918 Unclassified 1486
562 Ga0496115_0452174 3300048918 Bacteria 1037
563 Ga0496115_0547239 3300048918 Unclassified 925
564 Ga0496126_0247957 3300048929 Bacteria 1485
565 Ga0501031_0024085 3300049568 Bacteria 3969
566 Ga0501032_0005298 3300049569 Bacteria 9592
567 Ga0501033_0155713 3300049570 Bacteria 1647
568 Ga0501033_0315331 3300049570 Bacteria 1099
569 Ga0501033_0528156 3300049570 Bacteria 814
570 Ga0501034_0196796 3300049571 Bacteria 1975
571 Ga0501034_0228276 3300049571 Bacteria 1811
572 Ga0501034_0400447 3300049571 Bacteria 1295
573 Ga0501036_0008867 3300049572 Bacteria 8259
574 Ga0501038_0229613 3300049574 Bacteria 1477
575 Ga0501038_0263940 3300049574 Bacteria 1360
576 Ga0501039_0009809 3300049575 Bacteria 7296
577 Ga0501039_0780376 3300049575 Bacteria 746
578 Ga0501040_0372828 3300049576 Bacteria 1024
579 Ga0501041_0202751 3300049577 Bacteria 1244
580 Ga0501042_0018103 3300049578 Bacteria 4873
581 Ga0501042_0114851 3300049578 Bacteria 1939
582 Ga0501042_0377729 3300049578 Bacteria 1026
583 Ga0501043_0105289 3300049579 Bacteria 2216
584 Ga0501043_0252287 3300049579 Unclassified 1359
585 Ga0501043_0419264 3300049579 Bacteria 1009
586 Ga0501046_0089636 3300049580 Bacteria 2367
587 Ga0501046_0131582 3300049580 Bacteria 1897
588 Ga0501047_0249504 3300049581 Bacteria 1623
589 Ga0501047_0290501 3300049581 Bacteria 1479
590 Ga0501047_0378169 3300049581 Unclassified 1251
591 Ga0501047_0432146 3300049581 Bacteria 1147
592 Ga0501048_0004435 3300049582 Bacteria 10688
593 Ga0501048_0286605 3300049582 Bacteria 1171
594 Ga0501067_0006486 3300049583 Bacteria 6486
595 Ga0501068_0067158 3300049584 Bacteria 2184
596 Ga0501068_0203137 3300049584 Bacteria 1257
597 Ga0501069_0059200 3300049585 Bacteria 2138
598 Ga0501069_0067034 3300049585 Bacteria 2007
599 Ga0501070_0105751 3300049586 Bacteria 2326
600 Ga0501070_0446646 3300049586 Bacteria 1043
601 Ga0501070_0674202 3300049586 Bacteria 819
602 Ga0501071_0055339 3300049587 Bacteria 2864
603 Ga0501072_0238204 3300049588 Bacteria 1449
604 Ga0501072_0566582 3300049588 Bacteria 897
605 Ga0501073_0120091 3300049589 Bacteria 1821
606 Ga0501073_0409229 3300049589 Unclassified 937
607 Ga0501074_0105592 3300049590 Bacteria 2016
608 Ga0501074_0395018 3300049590 Bacteria 981
609 Ga0501076_0110524 3300049592 Bacteria 2222
610 Ga0501076_0330317 3300049592 Bacteria 1251
611 Ga0501076_0334220 3300049592 Bacteria 1243
612 Ga0501076_0497225 3300049592 Bacteria 1005
613 Ga0501079_0262566 3300049741 Bacteria 1349
614 Ga0501080_0247817 3300049742 Bacteria 1624
615 Ga0501080_0280255 3300049742 Bacteria 1516
616 Ga0501080_0420488 3300049742 Bacteria 1201
617 Ga0501080_0691849 3300049742 Bacteria 900
618 Ga0501083_0114482 3300049744 Bacteria 1771
619 Ga0501035_0501181 3300049822 Bacteria 999
620 Ga0501035_0514490 3300049822 Bacteria 984
621 Ga0501044_0002125 3300049823 Bacteria 22744
622 Ga0501044_0217230 3300049823 Bacteria 1863
623 Ga0501045_0088320 3300049824 Bacteria 2290
624 Ga0501045_0165431 3300049824 Bacteria 1647
625 nmdc:mga03683_85052_c1 3300050489 Bacteria 1371
626 nmdc:mga03n38_286117_c1 3300050490 Bacteria 881
627 nmdc:mga03n38_98166_c1 3300050490 Bacteria 1408
628 nmdc:mga0yw44_266_c1 3300050492 Bacteria 16414
629 nmdc:mga0yw44_288522_c1 3300050492 Bacteria 1098
630 nmdc:mga0yw44_34138_c1 3300050492 Bacteria 2979
631 nmdc:mga0k408_502032_c1 3300050493 Bacteria 719
632 nmdc:mga06z11_403266_c1 3300050494 Bacteria 823
633 nmdc:mga06z11_48949_c1 3300050494 Bacteria 2154
634 nmdc:mga04h51_36465_c1 3300050495 Unclassified 1582
635 nmdc:mga07m45_326466_c1 3300050496 Bacteria 892
636 nmdc:mga05p37_168447_c1 3300050507 Bacteria 2672
637 nmdc:mga05p37_170690_c1 3300050507 Bacteria 2652
638 nmdc:mga05p37_526183_c1 3300050507 Bacteria 1351
639 nmdc:mga05p37_54767_c1 3300050507 Bacteria 4907
640 nmdc:mga05p37_635174_c1 3300050507 Bacteria 1199
641 nmdc:mga05p37_640622_c1 3300050507 Bacteria 1192
642 nmdc:mga05p37_65579_c1 3300050507 Bacteria 4467
643 nmdc:mga05p37_9754_c1 3300050507 Bacteria 11389
644 nmdc:mga09592_65199_c1 3300050508 Bacteria 3085
645 nmdc:mga09592_86243_c1 3300050508 Bacteria 2678
646 nmdc:mga0qj67_123403_c1 3300050509 Bacteria 2095
647 nmdc:mga0qj67_133787_c1 3300050509 Bacteria 2009
648 nmdc:mga0qj67_51396_c1 3300050509 Bacteria 3259
649 nmdc:mga0qj67_712_c1 3300050509 Bacteria 22631
650 nmdc:mga06r32_109758_c1 3300050510 Bacteria 2713
651 nmdc:mga06r32_287947_c1 3300050510 Bacteria 1629
652 nmdc:mga06r32_303013_c1 3300050510 Bacteria 1584
653 nmdc:mga08y16_128919_c1 3300050511 Bacteria 2631
654 nmdc:mga08y16_211933_c1 3300050511 Bacteria 2006
655 nmdc:mga08y16_26094_c1 3300050511 Bacteria 6163
656 nmdc:mga08y16_550658_c1 3300050511 Bacteria 1167
657 nmdc:mga08y16_655680_c1 3300050511 Bacteria 1053
658 nmdc:mga0n895_22461_c1 3300050512 Bacteria 5041
659 nmdc:mga0n895_32245_c1 3300050512 Bacteria 5028
660 nmdc:mga0n895_423942_c1 3300050512 Bacteria 1345
661 nmdc:mga0n895_49309_c1 3300050512 Bacteria 4124
662 nmdc:mga0rr50_144163_c1 3300050513 Bacteria 1919
663 nmdc:mga0rr50_186357_c1 3300050513 Bacteria 1698
664 nmdc:mga0rr50_271746_c1 3300050513 Bacteria 1413
665 nmdc:mga0rr50_35576_c1 3300050513 Bacteria 3578
666 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
667 nmdc:mga08x19_40790_c1 3300050514 Bacteria 2955
668 nmdc:mga0a205_19705_c2 3300050515 Bacteria 5109
669 nmdc:mga0a205_51955_c1 3300050515 Bacteria 3956
670 nmdc:mga0a205_72911_c1 3300050515 Bacteria 3317
671 Ga0495601_0022184 3300053077 Bacteria 3896
672 Ga0495601_0084827 3300053077 Bacteria 2035
673 Ga0495612_0006578 3300053078 Bacteria 4768
674 Ga0495612_0179954 3300053078 Bacteria 928
675 Ga0495655_0010773 3300053083 Bacteria 1816
676 Ga0495619_0018105 3300053085 Bacteria 4467
677 Ga0495619_0036279 3300053085 Bacteria 3209
678 Ga0495619_0048678 3300053085 Bacteria 2793
679 Ga0495619_0127725 3300053085 Bacteria 1746
680 Ga0500562_024567 3300053108 Bacteria 1576
681 Ga0500593_003060 3300053117 Bacteria 6253
682 Ga0501084_0037485 3300054114 Bacteria 4050
683 Ga0501084_0159360 3300054114 Bacteria 1904
684 Ga0501084_0283997 3300054114 Bacteria 1398
685 Ga0501082_0152984 3300060353 Bacteria 2004
686 Ga0501082_0184204 3300060353 Bacteria 1816
687 Ga0501082_0354336 3300060353 Bacteria 1280
688 Ga0501082_0698180 3300060353 Bacteria 888
689 Ga0530510_0031715 3300061734 Bacteria 3801
690 Ga0530510_0062528 3300061734 Bacteria 2695
691 Ga0081540_1030035
692 JGI24737J22298_10020459
693 JGI24743J22301_10003886
694 JGI24745J21846_1004566
695 JGI24748J21848_1013408
696 JGI24749J21850_1002814
697 JGI24744J21845_10006855
698 JGI24742J22300_10001927
699 JGI25406J46586_10088639
700 JGI25404J52841_10009621
701 JGI25405J52794_10010555
702 Ga0070690_100003592
703 Ga0070690_100610146
704 Ga0070670_100086473
705 Ga0068869_100721428
706 Ga0070666_10137959
707 Ga0070682_100798324
708 Ga0070682_101079830
709 Ga0068868_100057819
710 Ga0070660_100022408
711 Ga0070660_100038863
712 Ga0070660_100094545
713 Ga0070660_100504507
714 Ga0070689_100012700
715 Ga0070691_10038477
716 Ga0070687_100008252
717 Ga0070687_100044974
718 Ga0070661_100085385
719 Ga0070668_100043826
720 Ga0070669_100692857
721 Ga0070671_100200764
722 Ga0070674_100075129
723 Ga0070673_100516697
724 Ga0070688_100016893
725 Ga0070688_100096345
726 Ga0070659_100015664
727 Ga0070659_100218054
728 Ga0070667_100074984
729 Ga0070703_10013916
730 Ga0070709_10012835
731 Ga0070713_100001338
732 Ga0070713_100021029
733 Ga0070713_100131482
734 Ga0070713_100203116
735 Ga0070710_10000951
736 Ga0070710_10292302
737 Ga0070701_10043339
738 Ga0070701_10603862
739 Ga0070711_100140068
740 Ga0070711_100267867
741 Ga0070705_100028663
742 Ga0070705_100250628
743 Ga0070700_100388818
744 Ga0070708_100079192
745 Ga0070663_100130549
746 Ga0070678_101141037
747 Ga0070662_100482187
748 Ga0070681_10040326
749 Ga0070681_10144146
750 Ga0070681_10172356
751 Ga0068867_100051396
752 Ga0068867_100460905
753 Ga0070685_10020204
754 Ga0070706_100094260
755 Ga0070706_100534348
756 Ga0070707_100030569
757 Ga0070707_100095548
758 Ga0070698_100009542
759 Ga0070699_100001182
760 Ga0070699_100013882
761 Ga0070699_100085605
762 Ga0070679_100008548
763 Ga0070679_100544964
764 Ga0070684_100135727
765 Ga0070684_100169493
766 Ga0070697_100013296
767 Ga0070697_100146783
768 Ga0068853_100252555
769 Ga0070672_100088280
770 Ga0070672_100479593
771 Ga0070686_100035764
772 Ga0070695_100012570
773 Ga0070695_100444357
774 Ga0070696_100536292
775 Ga0070665_100004104
776 Ga0070665_100120001
777 Ga0070704_100053097
778 Ga0070704_100238307
779 Ga0068855_100147540
780 Ga0070664_100123983
781 Ga0068857_100165259
782 Ga0068857_100419123
783 Ga0068854_100706643
784 Ga0068856_100092072
785 Ga0068856_100163495
786 Ga0068856_100423980
787 Ga0070702_100010149
788 Ga0068852_100012438
789 Ga0068852_100061527
790 Ga0068859_100082692
791 Ga0068859_101124082
792 Ga0068864_100139170
793 Ga0068864_100563826
794 Ga0068864_100926505
795 Ga0068866_10016689
796 Ga0068861_101208374
797 Ga0068863_100018268
798 Ga0068863_100133821
799 Ga0068863_100774671
800 Ga0068858_100019474
801 Ga0068858_100492182
802 Ga0068860_100044044
803 Ga0068860_100064741
804 Ga0068860_100128764
805 Ga0068860_100129684
806 Ga0068860_100508529
807 Ga0068860_100856178
808 Ga0068860_101307335
809 Ga0068862_100096886
810 Ga0081455_10001208
811 Ga0081455_10049858
812 Ga0081455_10052653
813 Ga0081455_10089159
814 Ga0081455_10106533
815 Ga0081538_10023929
816 Ga0081538_10130057
817 Ga0081540_1000008
818 Ga0081540_1044351
819 Ga0081539_10022326
820 Ga0070717_10178004
821 Ga0070717_10200874
822 Ga0070717_10241789
823 Ga0070717_10442870
824 Ga0075365_10033316
825 Ga0075365_10062626
826 Ga0075365_10490224
827 Ga0075363_100161852
828 Ga0075363_100165100
829 Ga0075363_100264215
830 Ga0075363_100586946
831 Ga0070715_10008500
832 Ga0070715_10014348
833 Ga0070715_10037611
834 Ga0070716_100000583
835 Ga0070712_100027995
836 Ga0070712_100034116
837 Ga0070712_100068831
838 Ga0070712_100646082
839 Ga0075362_10024056
840 Ga0075367_10136068
841 Ga0075367_10264583
842 Ga0075366_10410203
843 Ga0097621_100085221
844 Ga0075370_10278977
845 Ga0068871_100079464
846 Ga0068871_100155353
847 Ga0068871_100556636
848 Ga0075428_100060912
849 Ga0075428_100127878
850 Ga0075428_100128336
851 Ga0075428_100354225
852 Ga0075428_100768175
853 Ga0075430_100000606
854 Ga0075430_100006598
855 Ga0075430_100232279
856 Ga0075431_100116175
857 Ga0075431_100169924
858 Ga0075433_10027816
859 Ga0075433_10103347
860 Ga0075433_10109042
861 Ga0075433_10180059
862 Ga0075434_100033867
863 Ga0075434_100121467
864 Ga0075434_100142566
865 Ga0075434_100769919
866 Ga0075429_100009454
867 Ga0075429_100609577
868 Ga0068865_100000817
869 Ga0075436_100004938
870 Ga0075436_100185276
871 Ga0097620_100082696
872 Ga0097620_101124071
873 Ga0075435_100029139
874 Ga0075435_100190295
875 Ga0075435_100224269
876 Ga0075435_100261873
877 Ga0099795_10004043
878 Ga0105251_10133309
879 Ga0105240_10211627
880 Ga0111539_10018500
881 Ga0111539_10183897
882 Ga0111539_10322490
883 Ga0111539_10422312
884 Ga0111539_11261032
885 Ga0105245_10016708
886 Ga0105245_10022054
887 Ga0105245_10390404
888 Ga0105245_10419987
889 Ga0105245_10542496
890 Ga0105245_11197898
891 Ga0105247_10048542
892 Ga0105247_10173046
893 Ga0105247_10359759
894 Ga0114129_10003226
895 Ga0114129_10012927
896 Ga0114129_10082499
897 Ga0114129_10085273
898 Ga0114129_10167345
899 Ga0114129_10532045
900 Ga0114129_10697042
901 Ga0114129_10780284
902 Ga0114129_11126686
903 Ga0105243_10018201
904 Ga0105243_10033776
905 Ga0105241_10280806
906 Ga0105241_11113846
907 Ga0105242_10120636
908 Ga0105242_10149309
909 Ga0105248_10070027
910 Ga0105248_10078059
911 Ga0105248_10114472
912 Ga0105248_10348143
913 Ga0105238_10034538
914 Ga0105238_10199009
915 Ga0105238_10245673
916 Ga0105249_10001094
917 Ga0105249_10171426
918 Ga0105249_10220909
919 Ga0099796_10018592
920 Ga0105239_10427693
921 Ga0105239_10828723
922 Ga0105246_10065645
923 Ga0105246_10108149
924 Ga0105246_10139801
925 Ga0157373_10240825
926 Ga0157371_10064668
927 Ga0157370_10075965
928 Ga0157369_10050595
929 Ga0157369_10618796
930 Ga0157374_10333095
931 Ga0157378_10179292
932 Ga0157378_10316501
933 Ga0163162_10230913
934 Ga0163162_11051663
935 Ga0157372_10076393
936 Ga0157375_10377337
937 Ga0163163_10012040
938 Ga0163163_10117713
939 Ga0163163_10661794
940 Ga0157380_10083614
941 Ga0157380_10313661
942 Ga0157377_10013007
943 Ga0157379_10095752
944 Ga0157379_10099931
945 Ga0157379_10561357
946 Ga0157379_11014561
947 Ga0157376_10071061
948 Ga0157376_10921571
949 Ga0182007_10029650
950 Ga0163161_10088315
951 Ga0213872_10006493
952 Ga0213872_10053071
953 Ga0213871_10030238
954 Ga0207697_10019933
955 Ga0207697_10057821
956 Ga0207692_10001071
957 Ga0207642_10017214
958 Ga0207710_10023389
959 Ga0207710_10107308
960 Ga0207688_10009441
961 Ga0207688_10157356
962 Ga0207680_10064367
963 Ga0207680_10067047
964 Ga0207647_10020098
965 Ga0207647_10042425
966 Ga0207685_10065582
967 Ga0207685_10142180
968 Ga0207645_10206743
969 Ga0207684_10207582
970 Ga0207654_10450579
971 Ga0207707_10100228
972 Ga0207707_10105145
973 Ga0207707_10651717
974 Ga0207695_10141882
975 Ga0207693_10018989
976 Ga0207693_10090543
977 Ga0207693_10147109
978 Ga0207693_10417579
979 Ga0207663_10032135
980 Ga0207663_10053051
981 Ga0207663_10441540
982 Ga0207660_10105120
983 Ga0207662_10012447
984 Ga0207662_10019596
985 Ga0207657_10061180
986 Ga0207657_10083925
987 Ga0207657_10261616
988 Ga0207652_10029836
989 Ga0207681_10063991
990 Ga0207650_10031566
991 Ga0207659_10036782
992 Ga0207659_10590441
993 Ga0207687_10008243
994 Ga0207687_10009871
995 Ga0207687_10149303
996 Ga0207687_10904761
997 Ga0207700_10185218
998 Ga0207700_10207423
999 Ga0207700_10280475
1000 Ga0207700_11020677
1001 Ga0207664_10134428
1002 Ga0207664_10237095
1003 Ga0207644_10032220
1004 Ga0207690_10046165
1005 Ga0207690_10221948
1006 Ga0207690_10566069
1007 Ga0207690_10988040
1008 Ga0207706_10108825
1009 Ga0207706_10176812
1010 Ga0207686_10031284
1011 Ga0207686_10045138
1012 Ga0207709_10022442
1013 Ga0207709_10120563
1014 Ga0207670_10001209
1015 Ga0207669_10091986
1016 Ga0207704_10146008
1017 Ga0207704_10192908
1018 Ga0207665_10000939
1019 Ga0207665_10229471
1020 Ga0207691_10004214
1021 Ga0207711_10036799
1022 Ga0207711_10060091
1023 Ga0207711_10168638
1024 Ga0207689_10022049
1025 Ga0207679_10042782
1026 Ga0207679_10234288
1027 Ga0207667_10174086
1028 Ga0207651_10868451
1029 Ga0207712_10012728
1030 Ga0207712_10079043
1031 Ga0207712_10171081
1032 Ga0207668_10146054
1033 Ga0207640_10150377
1034 Ga0207658_10057667
1035 Ga0207658_10148526
1036 Ga0207677_10094202
1037 Ga0207703_10098546
1038 Ga0207639_10176774
1039 Ga0207678_10009723
1040 Ga0207708_10282745
1041 Ga0207708_10688145
1042 Ga0207702_10101273
1043 Ga0207702_10204207
1044 Ga0207702_10375458
1045 Ga0207641_10149700
1046 Ga0207641_10496183
1047 Ga0207648_10208843
1048 Ga0207676_10009182
1049 Ga0207676_10083520
1050 Ga0207676_10421582
1051 Ga0207676_11049226
1052 Ga0207674_10184289
1053 Ga0207674_10402378
1054 Ga0207675_100002495
1055 Ga0207675_100075039
1056 Ga0207683_10028413
1057 Ga0207683_10077877
1058 Ga0207698_10223226
1059 Ga0207428_10021089
1060 Ga0268266_10004249
1061 Ga0268266_10018150
1062 Ga0268266_10221985
1063 Ga0268266_10545421
1064 Ga0268265_10038724
1065 Ga0268264_10023619
1066 Ga0268264_10048278
1067 Ga0268264_10245956
1068 Ga0268264_10701619
1069 Ga0265334_10003076
1070 Ga0265325_10005527
1071 Ga0265325_10124843
1072 Ga0265342_10234430
1073 Ga0307416_100397160
1074 Ga0307416_100617137
1075 Ga0373944_0015715
1076 Ga0373932_0037985
1077 Ga0373936_0004777
1078 Ga0373941_0008716
1079 Ga0373941_0164072
1080 Ga0373945_0007175
1081 Ga0373943_0076283
1082 Ga0373943_0172398
1083 Ga0373946_0013318
1084 Ga0373946_0085541
1085 Ga0373961_0218763
1086 Ga0373924_0260909
1087 Ga0373931_0014471
1088 Ga0373931_0022458
1089 Ga0373931_0051802
1090 Ga0373931_0300110
1091 Ga0373935_0039766
1092 Ga0373935_0354204
1093 Ga0373927_0029382
1094 Ga0373927_0038736
1095 Ga0373927_0178641
1096 Ga0373927_0268190
1097 Ga0373947_0006765
1098 Ga0373947_0193949
1099 Ga0373937_0020008
1100 Ga0373925_0030990
1101 Ga0373925_0072598
1102 Ga0373925_0116206
1103 Ga0373925_0137812
1104 Ga0373925_0380506
1105 Ga0395899_0099424
1106 Ga0395900_0053573
1107 Ga0395900_0063098
1108 Ga0395900_0579318
1109 Ga0395900_0707485
1110 Ga0395898_0360867
1111 Ga0395898_1161260
1112 Ga0395901_0007147
1113 Ga0395901_0047246
1114 Ga0395901_0073184
1115 Ga0395901_1269495
1116 Ga0400483_071423
1117 Ga0436365_0569252
1118 Ga0436360_0031653
1119 Ga0436360_1200262
1120 Ga0436361_0180188
1121 Ga0436361_0430432
1122 Ga0436361_0991103
1123 Ga0451800_0878792
1124 Ga0451576_0815737
1125 Ga0495617_037001
1126 Ga0495627_071932
1127 Ga0495592_0072327
1128 Ga0495592_0076857
1129 Ga0495603_0122724
1130 Ga0495638_0370377
1131 Ga0495641_0083518
1132 Ga0495582_0015749
1133 Ga0495582_0035955
1134 Ga0495639_0059302
1135 Ga0495639_0224620
1136 Ga0495662_0020074
1137 Ga0495584_0318819
1138 Ga0495585_0025036
1139 Ga0495585_0220522
1140 Ga0495594_0014984
1141 Ga0495607_0195069
1142 Ga0495616_0100305
1143 Ga0495620_0114614
1144 Ga0495630_0280131
1145 Ga0495630_0466824
1146 Ga0495631_0153423
1147 Ga0495632_0218337
1148 Ga0495637_0061385
1149 Ga0495637_0108625
1150 Ga0495644_0016520
1151 Ga0495663_0051012
1152 Ga0495663_0097373
1153 Ga0495665_0179644
1154 Ga0495640_0075833
1155 Ga0495640_0318034
1156 Ga0495598_0001739
1157 Ga0495598_0011965
1158 Ga0495621_0058919
1159 Ga0495633_0015732
1160 Ga0495656_0013578
1161 Ga0495656_0230510
1162 Ga0495668_0104437
1163 Ga0495634_0054703
1164 Ga0495611_0188993
1165 Ga0495659_0032331
1166 Ga0495661_0161127
1167 Ga0495661_0242488
1168 Ga0495588_0005847
1169 Ga0495647_0035817
1170 Ga0495658_0054933
1171 Ga0495613_0621227
1172 Ga0495624_0020274
1173 Ga0495670_0030623
1174 Ga0495670_0119750
1175 Ga0495670_0139595
1176 Ga0495649_0106289
1177 Ga0495589_0063227
1178 Ga0495589_0213145
1179 Ga0495589_0280431
1180 Ga0495604_0051091
1181 Ga0495674_0038021
1182 Ga0495674_0211302
1183 Ga0495676_0007833
1184 Ga0495677_0153511
1185 Ga0495677_0174312
1186 Ga0495684_0362974
1187 Ga0495615_0043163
1188 Ga0496100_0020359
1189 Ga0496100_0029666
1190 Ga0496100_0050806
1191 Ga0496100_0082193
1192 Ga0496100_0337865
1193 Ga0496100_0443495
1194 Ga0496101_0021506
1195 Ga0496101_0027790
1196 Ga0496101_0038842
1197 Ga0496101_0282921
1198 Ga0496102_0014795
1199 Ga0496102_0058003
1200 Ga0496102_0280910
1201 Ga0496102_0281170
1202 Ga0496103_0002508
1203 Ga0496103_0012368
1204 Ga0496104_0022526
1205 Ga0496104_0090239
1206 Ga0496104_0665952
1207 Ga0496105_0002763
1208 Ga0496105_0003909
1209 Ga0496105_0314134
1210 Ga0496106_0013380
1211 Ga0496106_0021610
1212 Ga0496106_0030512
1213 Ga0496106_0049560
1214 Ga0496106_0149855
1215 Ga0496106_0443335
1216 Ga0496107_0006397
1217 Ga0496107_0013872
1218 Ga0496107_0039513
1219 Ga0496107_0093054
1220 Ga0496107_0204036
1221 Ga0496107_0450147
1222 Ga0496107_0495152
1223 Ga0496108_0000378
1224 Ga0496108_0029956
1225 Ga0496108_0035448
1226 Ga0496108_0113679
1227 Ga0496109_0000386
1228 Ga0496109_0016816
1229 Ga0496109_0104545
1230 Ga0496110_0002683
1231 Ga0496110_0006786
1232 Ga0496110_0018615
1233 Ga0496110_0168826
1234 Ga0496111_0000198
1235 Ga0496111_0019586
1236 Ga0496111_0043931
1237 Ga0496111_0125552
1238 Ga0496112_0000681
1239 Ga0496112_0066432
1240 Ga0496112_0106151
1241 Ga0496112_0116565
1242 Ga0496113_0000214
1243 Ga0496113_0000558
1244 Ga0496113_0042466
1245 Ga0496113_0288568
1246 Ga0496114_0037200
1247 Ga0496114_0064713
1248 Ga0496114_0145526
1249 Ga0496115_0007951
1250 Ga0496115_0136319
1251 Ga0496115_0242151
1252 Ga0496115_0452174
1253 Ga0496115_0547239
1254 Ga0496126_0247957
1255 Ga0501031_0024085
1256 Ga0501032_0005298
1257 Ga0501033_0155713
1258 Ga0501033_0315331
1259 Ga0501033_0528156
1260 Ga0501034_0196796
1261 Ga0501034_0228276
1262 Ga0501034_0400447
1263 Ga0501036_0008867
1264 Ga0501038_0229613
1265 Ga0501038_0263940
1266 Ga0501039_0009809
1267 Ga0501039_0780376
1268 Ga0501040_0372828
1269 Ga0501041_0202751
1270 Ga0501042_0018103
1271 Ga0501042_0114851
1272 Ga0501042_0377729
1273 Ga0501043_0105289
1274 Ga0501043_0252287
1275 Ga0501043_0419264
1276 Ga0501046_0089636
1277 Ga0501046_0131582
1278 Ga0501047_0249504
1279 Ga0501047_0290501
1280 Ga0501047_0378169
1281 Ga0501047_0432146
1282 Ga0501048_0004435
1283 Ga0501048_0286605
1284 Ga0501067_0006486
1285 Ga0501068_0067158
1286 Ga0501068_0203137
1287 Ga0501069_0059200
1288 Ga0501069_0067034
1289 Ga0501070_0105751
1290 Ga0501070_0446646
1291 Ga0501070_0674202
1292 Ga0501071_0055339
1293 Ga0501072_0238204
1294 Ga0501072_0566582
1295 Ga0501073_0120091
1296 Ga0501073_0409229
1297 Ga0501074_0105592
1298 Ga0501074_0395018
1299 Ga0501076_0110524
1300 Ga0501076_0330317
1301 Ga0501076_0334220
1302 Ga0501076_0497225
1303 Ga0501079_0262566
1304 Ga0501080_0247817
1305 Ga0501080_0280255
1306 Ga0501080_0420488
1307 Ga0501080_0691849
1308 Ga0501083_0114482
1309 Ga0501035_0501181
1310 Ga0501035_0514490
1311 Ga0501044_0002125
1312 Ga0501044_0217230
1313 Ga0501045_0088320
1314 Ga0501045_0165431
1315 nmdc:mga03683_85052_c1
1316 nmdc:mga03n38_286117_c1
1317 nmdc:mga03n38_98166_c1
1318 nmdc:mga0yw44_266_c1
1319 nmdc:mga0yw44_288522_c1
1320 nmdc:mga0yw44_34138_c1
1321 nmdc:mga0k408_502032_c1
1322 nmdc:mga06z11_403266_c1
1323 nmdc:mga06z11_48949_c1
1324 nmdc:mga04h51_36465_c1
1325 nmdc:mga07m45_326466_c1
1326 nmdc:mga05p37_168447_c1
1327 nmdc:mga05p37_170690_c1
1328 nmdc:mga05p37_526183_c1
1329 nmdc:mga05p37_54767_c1
1330 nmdc:mga05p37_635174_c1
1331 nmdc:mga05p37_640622_c1
1332 nmdc:mga05p37_65579_c1
1333 nmdc:mga05p37_9754_c1
1334 nmdc:mga09592_65199_c1
1335 nmdc:mga09592_86243_c1
1336 nmdc:mga0qj67_123403_c1
1337 nmdc:mga0qj67_133787_c1
1338 nmdc:mga0qj67_51396_c1
1339 nmdc:mga0qj67_712_c1
1340 nmdc:mga06r32_109758_c1
1341 nmdc:mga06r32_287947_c1
1342 nmdc:mga06r32_303013_c1
1343 nmdc:mga08y16_128919_c1
1344 nmdc:mga08y16_211933_c1
1345 nmdc:mga08y16_26094_c1
1346 nmdc:mga08y16_550658_c1
1347 nmdc:mga08y16_655680_c1
1348 nmdc:mga0n895_22461_c1
1349 nmdc:mga0n895_32245_c1
1350 nmdc:mga0n895_423942_c1
1351 nmdc:mga0n895_49309_c1
1352 nmdc:mga0rr50_144163_c1
1353 nmdc:mga0rr50_186357_c1
1354 nmdc:mga0rr50_271746_c1
1355 nmdc:mga0rr50_35576_c1
1356 nmdc:mga08x19_24_c1
1357 nmdc:mga08x19_40790_c1
1358 nmdc:mga0a205_19705_c2
1359 nmdc:mga0a205_51955_c1
1360 nmdc:mga0a205_72911_c1
1361 Ga0495601_0022184
1362 Ga0495601_0084827
1363 Ga0495612_0006578
1364 Ga0495612_0179954
1365 Ga0495655_0010773
1366 Ga0495619_0018105
1367 Ga0495619_0036279
1368 Ga0495619_0048678
1369 Ga0495619_0127725
1370 Ga0500562_024567
1371 Ga0500593_003060
1372 Ga0501084_0037485
1373 Ga0501084_0159360
1374 Ga0501084_0283997
1375 Ga0501082_0152984
1376 Ga0501082_0184204
1377 Ga0501082_0354336
1378 Ga0501082_0698180
1379 Ga0530510_0031715
1380 Ga0530510_0062528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

165

239

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

39

115

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

49

116

0.95

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

155

243

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

43

121

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9613 6 205
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9518 6 206
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9341 6 205
7miq-assembly1.cif.gz_B crystal structure of a glutathione s-transferase class gtt2 of vibrio parahaemolyticus (vpgstt2) 0.9304 6 207
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9208 6 206
ID Description Score Start End Superfamily
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9504 86 202 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9463 86 202 1.20.1050.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9462 4 79 3.40.30.10
af_Q7JYX0_7_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9429 7 83 3.40.30.10
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9351 86 202 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A537PAP8-F1-model_v4 Glutathione S-transferase 0.9996 6 207 GO:0016740
AF-A0A2P5LXZ4-F1-model_v4 Glutathione S-transferase 0.9944 6 207 GO:0016740
AF-A0A7R6Y740-F1-model_v4 deleted 0.9922 2 207
AF-A0A5E9BB14-F1-model_v4 Glutathione S-transferase 0.9908 67 207 GO:0016740
AF-A0A2D9LGP0-F1-model_v4 Glutathione S-transferase 0.9905 6 205 GO:0016740

Map