F475434
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 298 | 683 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_102177956|Ga0068857_1021779561 |
| Length | 107 |
| Sequence | VDFTPESGISSQDLNCMILARVVGNVVATQKDLRYEGGRIMVVRPTNPDGSDGGDELLALDAVDSGVGDLVVVVREGWSASTTSTGSPGAAIDSAIIGIVDSVESDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 2 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 281 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 294 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.29 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.22 |
| Nodule | 0.29 |
| Rhizoplane | 1.59 |
| Rhizosphere | 90.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10191579 | 3300005288 | Unclassified | 926 |
| 2 | Ga0065712_10334447 | 3300005290 | Unclassified | 809 |
| 3 | Ga0065712_10570827 | 3300005290 | Bacteria | 606 |
| 4 | Ga0065715_10071658 | 3300005293 | Unclassified | 643 |
| 5 | Ga0065715_10208831 | 3300005293 | Bacteria | 1316 |
| 6 | Ga0065715_10822905 | 3300005293 | Bacteria | 602 |
| 7 | Ga0065715_10899858 | 3300005293 | Bacteria | 575 |
| 8 | Ga0065707_10156468 | 3300005295 | Bacteria | 1604 |
| 9 | Ga0065707_10206834 | 3300005295 | Unclassified | 1284 |
| 10 | Ga0070676_10050842 | 3300005328 | Bacteria | 2431 |
| 11 | Ga0070676_10978615 | 3300005328 | Bacteria | 634 |
| 12 | Ga0070676_11085377 | 3300005328 | Bacteria | 604 |
| 13 | Ga0070683_100049491 | 3300005329 | Bacteria | 3888 |
| 14 | Ga0070670_100040793 | 3300005331 | Bacteria | 3989 |
| 15 | Ga0070670_100047682 | 3300005331 | Bacteria | 3686 |
| 16 | Ga0070677_10341987 | 3300005333 | Bacteria | 773 |
| 17 | Ga0070677_10610927 | 3300005333 | Unclassified | 605 |
| 18 | Ga0070666_10032233 | 3300005335 | Bacteria | 3460 |
| 19 | Ga0070666_10151881 | 3300005335 | Bacteria | 1616 |
| 20 | Ga0070666_10193636 | 3300005335 | Bacteria | 1429 |
| 21 | Ga0070680_100115126 | 3300005336 | Bacteria | 2240 |
| 22 | Ga0070680_100313344 | 3300005336 | Bacteria | 1332 |
| 23 | Ga0070680_100435681 | 3300005336 | Bacteria | 1119 |
| 24 | Ga0070680_100638234 | 3300005336 | Bacteria | 915 |
| 25 | Ga0070682_101559978 | 3300005337 | Bacteria | 570 |
| 26 | Ga0068868_100132045 | 3300005338 | Bacteria | 2044 |
| 27 | Ga0068868_100772186 | 3300005338 | Bacteria | 865 |
| 28 | Ga0070660_100096787 | 3300005339 | Bacteria | 2335 |
| 29 | Ga0070660_100661703 | 3300005339 | Bacteria | 875 |
| 30 | Ga0070660_100678742 | 3300005339 | Bacteria | 863 |
| 31 | Ga0070691_10833362 | 3300005341 | Unclassified | 564 |
| 32 | Ga0070661_100555592 | 3300005344 | Bacteria | 924 |
| 33 | Ga0070668_100136209 | 3300005347 | Bacteria | 1975 |
| 34 | Ga0070669_100187620 | 3300005353 | Bacteria | 1621 |
| 35 | Ga0070675_100120981 | 3300005354 | Bacteria | 2224 |
| 36 | Ga0070675_100447906 | 3300005354 | Bacteria | 1158 |
| 37 | Ga0070675_100843305 | 3300005354 | Bacteria | 838 |
| 38 | Ga0070675_101788268 | 3300005354 | Unclassified | 567 |
| 39 | Ga0070671_101636265 | 3300005355 | Unclassified | 571 |
| 40 | Ga0070674_100097298 | 3300005356 | Bacteria | 2137 |
| 41 | Ga0070674_100358939 | 3300005356 | Bacteria | 1179 |
| 42 | Ga0070673_101400542 | 3300005364 | Bacteria | 658 |
| 43 | Ga0070659_100168933 | 3300005366 | Bacteria | 1791 |
| 44 | Ga0070659_100354644 | 3300005366 | Bacteria | 1231 |
| 45 | Ga0070659_100852790 | 3300005366 | Bacteria | 794 |
| 46 | Ga0070667_101631108 | 3300005367 | Unclassified | 606 |
| 47 | Ga0070703_10000084 | 3300005406 | Bacteria | 47544 |
| 48 | Ga0070703_10262313 | 3300005406 | Bacteria | 705 |
| 49 | Ga0070709_10000030 | 3300005434 | Bacteria | 118031 |
| 50 | Ga0070713_101953962 | 3300005436 | Bacteria | 569 |
| 51 | Ga0070701_10562916 | 3300005438 | Unclassified | 749 |
| 52 | Ga0070711_100635705 | 3300005439 | Bacteria | 893 |
| 53 | Ga0070705_100001592 | 3300005440 | Bacteria | 11889 |
| 54 | Ga0070700_101044495 | 3300005441 | Unclassified | 674 |
| 55 | Ga0070700_101261217 | 3300005441 | Unclassified | 620 |
| 56 | Ga0070700_101544079 | 3300005441 | Bacteria | 566 |
| 57 | Ga0070694_100026651 | 3300005444 | Bacteria | 3748 |
| 58 | Ga0070694_101289438 | 3300005444 | Unclassified | 614 |
| 59 | Ga0070694_101452122 | 3300005444 | Unclassified | 580 |
| 60 | Ga0070708_100026034 | 3300005445 | Bacteria | 5004 |
| 61 | Ga0070708_100391122 | 3300005445 | Bacteria | 1311 |
| 62 | Ga0070708_101076620 | 3300005445 | Unclassified | 753 |
| 63 | Ga0070708_101740244 | 3300005445 | Unclassified | 579 |
| 64 | Ga0070663_100390052 | 3300005455 | Bacteria | 1136 |
| 65 | Ga0070662_100918047 | 3300005457 | Bacteria | 747 |
| 66 | Ga0070662_101320005 | 3300005457 | Bacteria | 621 |
| 67 | Ga0070681_10108734 | 3300005458 | Bacteria | 2713 |
| 68 | Ga0070681_10283684 | 3300005458 | Bacteria | 1567 |
| 69 | Ga0068867_100005839 | 3300005459 | Bacteria | 8731 |
| 70 | Ga0068867_100284598 | 3300005459 | Unclassified | 1357 |
| 71 | Ga0068867_100973207 | 3300005459 | Unclassified | 768 |
| 72 | Ga0070706_100000409 | 3300005467 | Bacteria | 51687 |
| 73 | Ga0070706_100794605 | 3300005467 | Bacteria | 876 |
| 74 | Ga0070707_100042572 | 3300005468 | Bacteria | 4348 |
| 75 | Ga0070707_100445459 | 3300005468 | Unclassified | 1255 |
| 76 | Ga0070707_101771132 | 3300005468 | Bacteria | 585 |
| 77 | Ga0070698_100969499 | 3300005471 | Unclassified | 797 |
| 78 | Ga0070698_101119969 | 3300005471 | Bacteria | 736 |
| 79 | Ga0070698_101403925 | 3300005471 | Bacteria | 649 |
| 80 | Ga0070698_101589628 | 3300005471 | Bacteria | 606 |
| 81 | Ga0070698_101925390 | 3300005471 | Unclassified | 544 |
| 82 | Ga0070699_100000088 | 3300005518 | Bacteria | 88268 |
| 83 | Ga0070699_100213951 | 3300005518 | Bacteria | 1717 |
| 84 | Ga0070699_100414444 | 3300005518 | Bacteria | 1219 |
| 85 | Ga0070699_100969841 | 3300005518 | Bacteria | 779 |
| 86 | Ga0070699_101677239 | 3300005518 | Unclassified | 582 |
| 87 | Ga0070679_100177486 | 3300005530 | Bacteria | 2103 |
| 88 | Ga0070684_101087786 | 3300005535 | Unclassified | 751 |
| 89 | Ga0070684_101177090 | 3300005535 | Unclassified | 721 |
| 90 | Ga0070684_101238640 | 3300005535 | Bacteria | 702 |
| 91 | Ga0070697_101164493 | 3300005536 | Unclassified | 687 |
| 92 | Ga0070697_101350173 | 3300005536 | Unclassified | 636 |
| 93 | Ga0068853_100893042 | 3300005539 | Bacteria | 853 |
| 94 | Ga0070672_101052520 | 3300005543 | Unclassified | 722 |
| 95 | Ga0070686_100306156 | 3300005544 | Unclassified | 1180 |
| 96 | Ga0070686_101631728 | 3300005544 | Unclassified | 546 |
| 97 | Ga0070686_101965881 | 3300005544 | Bacteria | 500 |
| 98 | Ga0070695_100030293 | 3300005545 | Bacteria | 3368 |
| 99 | Ga0070695_100183579 | 3300005545 | Bacteria | 1484 |
| 100 | Ga0070696_100002481 | 3300005546 | Bacteria | 12226 |
| 101 | Ga0070696_100043573 | 3300005546 | Bacteria | 3105 |
| 102 | Ga0070696_100172267 | 3300005546 | Bacteria | 1601 |
| 103 | Ga0070693_100002568 | 3300005547 | Bacteria | 8370 |
| 104 | Ga0070693_100746227 | 3300005547 | Bacteria | 721 |
| 105 | Ga0070665_100003124 | 3300005548 | Bacteria | 17837 |
| 106 | Ga0070665_100006541 | 3300005548 | Bacteria | 11841 |
| 107 | Ga0070665_100092857 | 3300005548 | Unclassified | 3023 |
| 108 | Ga0070665_101085551 | 3300005548 | Bacteria | 812 |
| 109 | Ga0070704_100026555 | 3300005549 | Bacteria | 3828 |
| 110 | Ga0070704_100175306 | 3300005549 | Bacteria | 1710 |
| 111 | Ga0070704_100454385 | 3300005549 | Unclassified | 1104 |
| 112 | Ga0070704_100647550 | 3300005549 | Unclassified | 933 |
| 113 | Ga0070704_100748560 | 3300005549 | Bacteria | 870 |
| 114 | Ga0070704_101040332 | 3300005549 | Bacteria | 742 |
| 115 | Ga0070704_101415269 | 3300005549 | Bacteria | 638 |
| 116 | Ga0068855_100349814 | 3300005563 | Bacteria | 1628 |
| 117 | Ga0068857_102177956 | 3300005577 | Unclassified | 544 |
| 118 | Ga0068854_100436159 | 3300005578 | Bacteria | 1091 |
| 119 | Ga0068852_100370472 | 3300005616 | Bacteria | 1403 |
| 120 | Ga0068859_100003822 | 3300005617 | Bacteria | 15377 |
| 121 | Ga0068859_101661398 | 3300005617 | Bacteria | 705 |
| 122 | Ga0068864_100158793 | 3300005618 | Bacteria | 2054 |
| 123 | Ga0068864_100472692 | 3300005618 | Bacteria | 1202 |
| 124 | Ga0068864_100659786 | 3300005618 | Unclassified | 1019 |
| 125 | Ga0068864_100732842 | 3300005618 | Bacteria | 968 |
| 126 | Ga0068864_101462168 | 3300005618 | Bacteria | 686 |
| 127 | Ga0068866_10044178 | 3300005718 | Bacteria | 2228 |
| 128 | Ga0068866_10051426 | 3300005718 | Bacteria | 2097 |
| 129 | Ga0068866_10275486 | 3300005718 | Unclassified | 1040 |
| 130 | Ga0068861_100479695 | 3300005719 | Bacteria | 1120 |
| 131 | Ga0068861_101350773 | 3300005719 | Bacteria | 695 |
| 132 | Ga0068861_102520268 | 3300005719 | Unclassified | 518 |
| 133 | Ga0068870_11205810 | 3300005840 | Unclassified | 548 |
| 134 | Ga0068863_100120412 | 3300005841 | Bacteria | 2502 |
| 135 | Ga0068863_100665493 | 3300005841 | Unclassified | 1033 |
| 136 | Ga0068863_100694189 | 3300005841 | Bacteria | 1011 |
| 137 | Ga0068858_100111150 | 3300005842 | Bacteria | 2559 |
| 138 | Ga0068858_100198644 | 3300005842 | Bacteria | 1896 |
| 139 | Ga0068858_100230961 | 3300005842 | Bacteria | 1754 |
| 140 | Ga0068858_100567704 | 3300005842 | Bacteria | 1099 |
| 141 | Ga0068858_101084490 | 3300005842 | Bacteria | 786 |
| 142 | Ga0068858_102074291 | 3300005842 | Bacteria | 562 |
| 143 | Ga0068860_100410375 | 3300005843 | Bacteria | 1341 |
| 144 | Ga0068860_100776060 | 3300005843 | Unclassified | 971 |
| 145 | Ga0068860_101007946 | 3300005843 | Bacteria | 851 |
| 146 | Ga0068862_100435398 | 3300005844 | Unclassified | 1233 |
| 147 | Ga0068862_100726479 | 3300005844 | Unclassified | 964 |
| 148 | Ga0081539_10000025 | 3300005985 | Bacteria | 340255 |
| 149 | Ga0075365_10000562 | 3300006038 | Bacteria | 14387 |
| 150 | Ga0075368_10053538 | 3300006042 | Bacteria | 1607 |
| 151 | Ga0075368_10203973 | 3300006042 | Bacteria | 837 |
| 152 | Ga0075363_100398047 | 3300006048 | Bacteria | 809 |
| 153 | Ga0075363_100734936 | 3300006048 | Bacteria | 597 |
| 154 | Ga0075364_10004066 | 3300006051 | Bacteria | 8395 |
| 155 | Ga0075364_10005645 | 3300006051 | Bacteria | 7292 |
| 156 | Ga0075364_10252862 | 3300006051 | Bacteria | 1198 |
| 157 | Ga0070715_10330220 | 3300006163 | Unclassified | 826 |
| 158 | Ga0070716_100353031 | 3300006173 | Unclassified | 1042 |
| 159 | Ga0070712_101254403 | 3300006175 | Bacteria | 645 |
| 160 | Ga0075362_10105944 | 3300006177 | Bacteria | 1319 |
| 161 | Ga0075367_10010080 | 3300006178 | Bacteria | 4954 |
| 162 | Ga0075367_10033063 | 3300006178 | Bacteria | 2979 |
| 163 | Ga0075367_10501167 | 3300006178 | Bacteria | 770 |
| 164 | Ga0075367_10832755 | 3300006178 | Unclassified | 588 |
| 165 | Ga0075366_10000965 | 3300006195 | Bacteria | 14034 |
| 166 | Ga0075366_10470540 | 3300006195 | Bacteria | 776 |
| 167 | Ga0097621_100001463 | 3300006237 | Bacteria | 16164 |
| 168 | Ga0097621_100069168 | 3300006237 | Bacteria | 2914 |
| 169 | Ga0097621_101178629 | 3300006237 | Unclassified | 721 |
| 170 | Ga0097621_101511432 | 3300006237 | Bacteria | 637 |
| 171 | Ga0068871_100012694 | 3300006358 | Bacteria | 6225 |
| 172 | Ga0068871_100260003 | 3300006358 | Unclassified | 1514 |
| 173 | Ga0068871_100406573 | 3300006358 | Bacteria | 1213 |
| 174 | Ga0068871_100519413 | 3300006358 | Bacteria | 1075 |
| 175 | Ga0075428_100016928 | 3300006844 | Bacteria | 8050 |
| 176 | Ga0075428_100335992 | 3300006844 | Bacteria | 1623 |
| 177 | Ga0075428_101100872 | 3300006844 | Bacteria | 839 |
| 178 | Ga0075430_100292790 | 3300006846 | Unclassified | 1347 |
| 179 | Ga0075431_100014795 | 3300006847 | Bacteria | 7898 |
| 180 | Ga0075431_100542748 | 3300006847 | Bacteria | 1151 |
| 181 | Ga0075431_100736104 | 3300006847 | Bacteria | 962 |
| 182 | Ga0075431_101004696 | 3300006847 | Bacteria | 801 |
| 183 | Ga0075431_102175835 | 3300006847 | Bacteria | 509 |
| 184 | Ga0075431_102215036 | 3300006847 | Unclassified | 504 |
| 185 | Ga0075433_10029945 | 3300006852 | Unclassified | 4641 |
| 186 | Ga0075433_10058944 | 3300006852 | Bacteria | 3359 |
| 187 | Ga0075433_10252342 | 3300006852 | Bacteria | 1565 |
| 188 | Ga0075433_10303106 | 3300006852 | Bacteria | 1415 |
| 189 | Ga0075433_10316256 | 3300006852 | Unclassified | 1381 |
| 190 | Ga0075433_10324656 | 3300006852 | Bacteria | 1361 |
| 191 | Ga0075433_10914947 | 3300006852 | Bacteria | 765 |
| 192 | Ga0075434_100000049 | 3300006871 | Bacteria | 57417 |
| 193 | Ga0075434_100082014 | 3300006871 | Bacteria | 3222 |
| 194 | Ga0075434_100119475 | 3300006871 | Bacteria | 2650 |
| 195 | Ga0075434_100260498 | 3300006871 | Bacteria | 1753 |
| 196 | Ga0075434_100321389 | 3300006871 | Bacteria | 1568 |
| 197 | Ga0075429_100069156 | 3300006880 | Bacteria | 3074 |
| 198 | Ga0068865_100009117 | 3300006881 | Bacteria | 6141 |
| 199 | Ga0068865_100598161 | 3300006881 | Unclassified | 932 |
| 200 | Ga0068865_100726241 | 3300006881 | Unclassified | 851 |
| 201 | Ga0068865_101124220 | 3300006881 | Bacteria | 693 |
| 202 | Ga0075436_100000420 | 3300006914 | Bacteria | 27162 |
| 203 | Ga0075436_100018228 | 3300006914 | Bacteria | 4807 |
| 204 | Ga0097620_100003822 | 3300006931 | Bacteria | 15377 |
| 205 | Ga0097620_101661263 | 3300006931 | Bacteria | 705 |
| 206 | Ga0079104_1000103 | 3300006946 | Bacteria | 124578 |
| 207 | Ga0075435_100000059 | 3300007076 | Bacteria | 56189 |
| 208 | Ga0075435_100005562 | 3300007076 | Bacteria | 8819 |
| 209 | Ga0075435_100335604 | 3300007076 | Bacteria | 1295 |
| 210 | Ga0075435_100655502 | 3300007076 | Bacteria | 911 |
| 211 | Ga0099794_10289498 | 3300007265 | Bacteria | 847 |
| 212 | Ga0105240_10059564 | 3300009093 | Bacteria | 4764 |
| 213 | Ga0105240_11641437 | 3300009093 | Bacteria | 672 |
| 214 | Ga0111539_10002313 | 3300009094 | Bacteria | 25348 |
| 215 | Ga0111539_10007363 | 3300009094 | Bacteria | 14101 |
| 216 | Ga0111539_10058785 | 3300009094 | Bacteria | 4560 |
| 217 | Ga0111539_10269287 | 3300009094 | Bacteria | 1983 |
| 218 | Ga0111539_10862413 | 3300009094 | Bacteria | 1053 |
| 219 | Ga0111539_11791798 | 3300009094 | Bacteria | 712 |
| 220 | Ga0111539_11912544 | 3300009094 | Bacteria | 688 |
| 221 | Ga0105245_10130030 | 3300009098 | Bacteria | 2361 |
| 222 | Ga0105245_10146471 | 3300009098 | Unclassified | 2228 |
| 223 | Ga0105245_10794793 | 3300009098 | Bacteria | 984 |
| 224 | Ga0105245_10831831 | 3300009098 | Unclassified | 962 |
| 225 | Ga0105247_10301812 | 3300009101 | Unclassified | 1111 |
| 226 | Ga0114129_10002862 | 3300009147 | Bacteria | 24132 |
| 227 | Ga0114129_10004267 | 3300009147 | Bacteria | 20199 |
| 228 | Ga0114129_10007233 | 3300009147 | Bacteria | 15803 |
| 229 | Ga0114129_10015216 | 3300009147 | Bacteria | 10950 |
| 230 | Ga0114129_10031782 | 3300009147 | Bacteria | 7463 |
| 231 | Ga0114129_10042536 | 3300009147 | Bacteria | 6397 |
| 232 | Ga0114129_10118287 | 3300009147 | Bacteria | 3650 |
| 233 | Ga0114129_10339813 | 3300009147 | Unclassified | 1992 |
| 234 | Ga0114129_10679701 | 3300009147 | Unclassified | 1325 |
| 235 | Ga0114129_11259235 | 3300009147 | Bacteria | 918 |
| 236 | Ga0114129_11936848 | 3300009147 | Bacteria | 714 |
| 237 | Ga0105243_10714254 | 3300009148 | Unclassified | 979 |
| 238 | Ga0105243_11912600 | 3300009148 | Bacteria | 626 |
| 239 | Ga0105243_12907880 | 3300009148 | Unclassified | 519 |
| 240 | Ga0105241_11413370 | 3300009174 | Unclassified | 667 |
| 241 | Ga0105241_11576514 | 3300009174 | Unclassified | 634 |
| 242 | Ga0105241_12676991 | 3300009174 | Unclassified | 502 |
| 243 | Ga0105242_10027323 | 3300009176 | Bacteria | 4529 |
| 244 | Ga0105242_10097363 | 3300009176 | Bacteria | 2487 |
| 245 | Ga0105242_10690648 | 3300009176 | Bacteria | 997 |
| 246 | Ga0105242_11465541 | 3300009176 | Bacteria | 712 |
| 247 | Ga0105248_10074545 | 3300009177 | Unclassified | 3814 |
| 248 | Ga0105248_10708929 | 3300009177 | Bacteria | 1135 |
| 249 | Ga0105237_11495129 | 3300009545 | Unclassified | 682 |
| 250 | Ga0105238_11125985 | 3300009551 | Bacteria | 808 |
| 251 | Ga0105238_11423263 | 3300009551 | Bacteria | 721 |
| 252 | Ga0105249_10352906 | 3300009553 | Unclassified | 1490 |
| 253 | Ga0105249_10530356 | 3300009553 | Bacteria | 1226 |
| 254 | Ga0105249_10738737 | 3300009553 | Bacteria | 1046 |
| 255 | Ga0105249_11997950 | 3300009553 | Bacteria | 653 |
| 256 | Ga0105249_12314611 | 3300009553 | Unclassified | 610 |
| 257 | Ga0105249_12436284 | 3300009553 | Bacteria | 596 |
| 258 | Ga0105239_10213422 | 3300010375 | Bacteria | 2164 |
| 259 | Ga0157373_11476904 | 3300013100 | Unclassified | 518 |
| 260 | Ga0157369_10085696 | 3300013105 | Bacteria | 3366 |
| 261 | Ga0157369_10753118 | 3300013105 | Bacteria | 1002 |
| 262 | Ga0157369_12014540 | 3300013105 | Bacteria | 586 |
| 263 | Ga0157374_10217678 | 3300013296 | Bacteria | 1873 |
| 264 | Ga0157378_10155036 | 3300013297 | Unclassified | 2137 |
| 265 | Ga0157378_10728496 | 3300013297 | Unclassified | 1013 |
| 266 | Ga0157378_13251137 | 3300013297 | Unclassified | 505 |
| 267 | Ga0163162_10414620 | 3300013306 | Bacteria | 1479 |
| 268 | Ga0163162_11465257 | 3300013306 | Bacteria | 777 |
| 269 | Ga0163162_11622783 | 3300013306 | Bacteria | 738 |
| 270 | Ga0157372_10225441 | 3300013307 | Bacteria | 2173 |
| 271 | Ga0157372_11733313 | 3300013307 | Bacteria | 719 |
| 272 | Ga0157372_11982882 | 3300013307 | Bacteria | 669 |
| 273 | Ga0157375_10687700 | 3300013308 | Unclassified | 1177 |
| 274 | Ga0157375_11710957 | 3300013308 | Unclassified | 745 |
| 275 | Ga0163163_10182331 | 3300014325 | Bacteria | 2147 |
| 276 | Ga0163163_11172677 | 3300014325 | Bacteria | 831 |
| 277 | Ga0163163_11328506 | 3300014325 | Unclassified | 781 |
| 278 | Ga0163163_11849043 | 3300014325 | Unclassified | 664 |
| 279 | Ga0157380_10008213 | 3300014326 | Bacteria | 7438 |
| 280 | Ga0157380_10010700 | 3300014326 | Bacteria | 6610 |
| 281 | Ga0157380_10032772 | 3300014326 | Bacteria | 3998 |
| 282 | Ga0157380_10379442 | 3300014326 | Unclassified | 1334 |
| 283 | Ga0157380_13053528 | 3300014326 | Bacteria | 534 |
| 284 | Ga0157379_10004956 | 3300014968 | Bacteria | 11421 |
| 285 | Ga0157379_10367625 | 3300014968 | Unclassified | 1319 |
| 286 | Ga0157379_11522138 | 3300014968 | Unclassified | 651 |
| 287 | Ga0157376_10038389 | 3300014969 | Bacteria | 3896 |
| 288 | Ga0157376_10497805 | 3300014969 | Unclassified | 1197 |
| 289 | Ga0157376_10593640 | 3300014969 | Bacteria | 1101 |
| 290 | Ga0157376_10684452 | 3300014969 | Bacteria | 1029 |
| 291 | Ga0157376_11373508 | 3300014969 | Unclassified | 737 |
| 292 | Ga0206356_11405878 | 3300020070 | Bacteria | 605 |
| 293 | Ga0206354_11444070 | 3300020081 | Bacteria | 579 |
| 294 | Ga0213876_10119947 | 3300021384 | Bacteria | 1396 |
| 295 | Ga0213876_10430704 | 3300021384 | Bacteria | 701 |
| 296 | Ga0213875_10000043 | 3300021388 | Bacteria | 152637 |
| 297 | Ga0207697_10360959 | 3300025315 | Unclassified | 645 |
| 298 | Ga0207653_10000271 | 3300025885 | Bacteria | 30910 |
| 299 | Ga0207642_10121656 | 3300025899 | Unclassified | 1347 |
| 300 | Ga0207642_10133257 | 3300025899 | Unclassified | 1300 |
| 301 | Ga0207642_10167053 | 3300025899 | Bacteria | 1187 |
| 302 | Ga0207710_10151819 | 3300025900 | Unclassified | 1124 |
| 303 | Ga0207688_10175809 | 3300025901 | Bacteria | 1275 |
| 304 | Ga0207680_10042035 | 3300025903 | Bacteria | 2671 |
| 305 | Ga0207680_10287234 | 3300025903 | Bacteria | 1144 |
| 306 | Ga0207699_10000001 | 3300025906 | Bacteria | 695560 |
| 307 | Ga0207645_10652480 | 3300025907 | Bacteria | 715 |
| 308 | Ga0207645_10937110 | 3300025907 | Unclassified | 588 |
| 309 | Ga0207684_10000881 | 3300025910 | Bacteria | 34236 |
| 310 | Ga0207684_10364960 | 3300025910 | Bacteria | 1243 |
| 311 | Ga0207684_10778491 | 3300025910 | Bacteria | 810 |
| 312 | Ga0207654_10543230 | 3300025911 | Unclassified | 825 |
| 313 | Ga0207707_10332540 | 3300025912 | Bacteria | 1311 |
| 314 | Ga0207707_10423828 | 3300025912 | Bacteria | 1141 |
| 315 | Ga0207707_10561950 | 3300025912 | Bacteria | 969 |
| 316 | Ga0207707_10859476 | 3300025912 | Bacteria | 752 |
| 317 | Ga0207707_11113714 | 3300025912 | Bacteria | 643 |
| 318 | Ga0207695_10223593 | 3300025913 | Bacteria | 1789 |
| 319 | Ga0207671_10941099 | 3300025914 | Unclassified | 682 |
| 320 | Ga0207663_11192825 | 3300025916 | Bacteria | 613 |
| 321 | Ga0207660_10291109 | 3300025917 | Bacteria | 1298 |
| 322 | Ga0207660_10531764 | 3300025917 | Bacteria | 955 |
| 323 | Ga0207660_10638366 | 3300025917 | Bacteria | 868 |
| 324 | Ga0207657_10201517 | 3300025919 | Bacteria | 1600 |
| 325 | Ga0207657_10513034 | 3300025919 | Bacteria | 939 |
| 326 | Ga0207649_10304409 | 3300025920 | Unclassified | 1166 |
| 327 | Ga0207652_10183004 | 3300025921 | Bacteria | 1884 |
| 328 | Ga0207652_11382740 | 3300025921 | Bacteria | 607 |
| 329 | Ga0207646_10009032 | 3300025922 | Bacteria | 9905 |
| 330 | Ga0207646_10606232 | 3300025922 | Unclassified | 983 |
| 331 | Ga0207646_11201641 | 3300025922 | Bacteria | 665 |
| 332 | Ga0207681_10242894 | 3300025923 | Unclassified | 1402 |
| 333 | Ga0207681_11064549 | 3300025923 | Bacteria | 679 |
| 334 | Ga0207650_10029687 | 3300025925 | Bacteria | 3933 |
| 335 | Ga0207650_10363099 | 3300025925 | Unclassified | 1193 |
| 336 | Ga0207650_11451441 | 3300025925 | Bacteria | 583 |
| 337 | Ga0207659_10187372 | 3300025926 | Bacteria | 1644 |
| 338 | Ga0207659_10298747 | 3300025926 | Bacteria | 1322 |
| 339 | Ga0207659_10384772 | 3300025926 | Bacteria | 1170 |
| 340 | Ga0207687_10101465 | 3300025927 | Bacteria | 2118 |
| 341 | Ga0207687_10107302 | 3300025927 | Unclassified | 2066 |
| 342 | Ga0207687_10534569 | 3300025927 | Bacteria | 982 |
| 343 | Ga0207690_10254468 | 3300025932 | Bacteria | 1358 |
| 344 | Ga0207690_10271928 | 3300025932 | Bacteria | 1317 |
| 345 | Ga0207690_10736624 | 3300025932 | Bacteria | 812 |
| 346 | Ga0207706_10266250 | 3300025933 | Bacteria | 1496 |
| 347 | Ga0207706_10822047 | 3300025933 | Bacteria | 788 |
| 348 | Ga0207686_10027009 | 3300025934 | Bacteria | 3356 |
| 349 | Ga0207686_10093220 | 3300025934 | Bacteria | 1993 |
| 350 | Ga0207686_11565148 | 3300025934 | Unclassified | 544 |
| 351 | Ga0207709_10547611 | 3300025935 | Bacteria | 909 |
| 352 | Ga0207669_10109383 | 3300025937 | Bacteria | 1848 |
| 353 | Ga0207669_10319149 | 3300025937 | Bacteria | 1188 |
| 354 | Ga0207669_10593369 | 3300025937 | Bacteria | 899 |
| 355 | Ga0207704_10058201 | 3300025938 | Bacteria | 2378 |
| 356 | Ga0207704_10197207 | 3300025938 | Unclassified | 1470 |
| 357 | Ga0207665_10481108 | 3300025939 | Bacteria | 957 |
| 358 | Ga0207665_11675220 | 3300025939 | Unclassified | 504 |
| 359 | Ga0207691_11519876 | 3300025940 | Bacteria | 547 |
| 360 | Ga0207691_11520435 | 3300025940 | Unclassified | 547 |
| 361 | Ga0207711_10053178 | 3300025941 | Unclassified | 3473 |
| 362 | Ga0207711_10621316 | 3300025941 | Bacteria | 1008 |
| 363 | Ga0207711_11195400 | 3300025941 | Unclassified | 702 |
| 364 | Ga0207689_10414082 | 3300025942 | Bacteria | 1124 |
| 365 | Ga0207661_10012308 | 3300025944 | Bacteria | 6215 |
| 366 | Ga0207651_11578682 | 3300025960 | Bacteria | 591 |
| 367 | Ga0207651_11755637 | 3300025960 | Bacteria | 559 |
| 368 | Ga0207712_11212790 | 3300025961 | Unclassified | 673 |
| 369 | Ga0207712_11257449 | 3300025961 | Unclassified | 661 |
| 370 | Ga0207712_11391467 | 3300025961 | Unclassified | 628 |
| 371 | Ga0207712_11605380 | 3300025961 | Unclassified | 583 |
| 372 | Ga0207640_11810564 | 3300025981 | Bacteria | 552 |
| 373 | Ga0207640_11929341 | 3300025981 | Bacteria | 535 |
| 374 | Ga0207658_10534881 | 3300025986 | Unclassified | 1047 |
| 375 | Ga0207677_10100110 | 3300026023 | Bacteria | 2130 |
| 376 | Ga0207677_10129928 | 3300026023 | Bacteria | 1911 |
| 377 | Ga0207677_10413697 | 3300026023 | Bacteria | 1147 |
| 378 | Ga0207703_10045825 | 3300026035 | Bacteria | 3519 |
| 379 | Ga0207703_10421748 | 3300026035 | Bacteria | 1242 |
| 380 | Ga0207703_11809146 | 3300026035 | Bacteria | 587 |
| 381 | Ga0207703_12246352 | 3300026035 | Unclassified | 521 |
| 382 | Ga0207678_10402467 | 3300026067 | Bacteria | 1185 |
| 383 | Ga0207708_10449780 | 3300026075 | Bacteria | 1073 |
| 384 | Ga0207702_10171726 | 3300026078 | Bacteria | 1988 |
| 385 | Ga0207641_10246594 | 3300026088 | Unclassified | 1667 |
| 386 | Ga0207641_10356163 | 3300026088 | Bacteria | 1396 |
| 387 | Ga0207641_11068326 | 3300026088 | Bacteria | 805 |
| 388 | Ga0207648_10022113 | 3300026089 | Bacteria | 5713 |
| 389 | Ga0207648_10355543 | 3300026089 | Unclassified | 1321 |
| 390 | Ga0207648_10878831 | 3300026089 | Bacteria | 837 |
| 391 | Ga0207676_10104875 | 3300026095 | Bacteria | 2352 |
| 392 | Ga0207676_10685769 | 3300026095 | Unclassified | 991 |
| 393 | Ga0207676_11721762 | 3300026095 | Bacteria | 625 |
| 394 | Ga0207674_11862237 | 3300026116 | Bacteria | 568 |
| 395 | Ga0207675_100564433 | 3300026118 | Bacteria | 1138 |
| 396 | Ga0207675_100811509 | 3300026118 | Unclassified | 949 |
| 397 | Ga0207675_101576150 | 3300026118 | Bacteria | 677 |
| 398 | Ga0207683_10570833 | 3300026121 | Bacteria | 1046 |
| 399 | Ga0207683_10779952 | 3300026121 | Bacteria | 887 |
| 400 | Ga0207698_10729039 | 3300026142 | Bacteria | 988 |
| 401 | Ga0209281_1000512 | 3300027111 | Bacteria | 50723 |
| 402 | Ga0209998_10071622 | 3300027717 | Unclassified | 829 |
| 403 | Ga0209813_10085216 | 3300027866 | Bacteria | 1052 |
| 404 | Ga0209813_10134450 | 3300027866 | Bacteria | 873 |
| 405 | Ga0207428_10023711 | 3300027907 | Bacteria | 5155 |
| 406 | Ga0207428_10190627 | 3300027907 | Unclassified | 1546 |
| 407 | Ga0207428_10262616 | 3300027907 | Bacteria | 1285 |
| 408 | Ga0207428_10574573 | 3300027907 | Unclassified | 814 |
| 409 | Ga0207428_11119984 | 3300027907 | Bacteria | 550 |
| 410 | Ga0268266_10008922 | 3300028379 | Bacteria | 8873 |
| 411 | Ga0268266_10015800 | 3300028379 | Bacteria | 6463 |
| 412 | Ga0268266_10165303 | 3300028379 | Bacteria | 2004 |
| 413 | Ga0268266_10801061 | 3300028379 | Bacteria | 910 |
| 414 | Ga0268265_10341819 | 3300028380 | Bacteria | 1363 |
| 415 | Ga0268265_10438571 | 3300028380 | Bacteria | 1217 |
| 416 | Ga0268265_10642223 | 3300028380 | Unclassified | 1019 |
| 417 | Ga0268265_12449760 | 3300028380 | Unclassified | 528 |
| 418 | Ga0268264_10387130 | 3300028381 | Bacteria | 1340 |
| 419 | Ga0268264_10733703 | 3300028381 | Bacteria | 983 |
| 420 | Ga0268264_11025379 | 3300028381 | Unclassified | 832 |
| 421 | Ga0307513_10213788 | 3300031456 | Bacteria | 1757 |
| 422 | Ga0307408_100789016 | 3300031548 | Bacteria | 861 |
| 423 | Ga0307408_100887435 | 3300031548 | Bacteria | 815 |
| 424 | Ga0265314_10010737 | 3300031711 | Bacteria | 7622 |
| 425 | Ga0307410_10458030 | 3300031852 | Bacteria | 1042 |
| 426 | Ga0307410_12101196 | 3300031852 | Bacteria | 505 |
| 427 | Ga0307412_10111430 | 3300031911 | Bacteria | 1955 |
| 428 | Ga0307412_11145685 | 3300031911 | Bacteria | 694 |
| 429 | Ga0307412_11788100 | 3300031911 | Bacteria | 565 |
| 430 | Ga0307409_100254717 | 3300031995 | Bacteria | 1607 |
| 431 | Ga0307409_102975689 | 3300031995 | Bacteria | 500 |
| 432 | Ga0307416_100445454 | 3300032002 | Bacteria | 1346 |
| 433 | Ga0307416_100893111 | 3300032002 | Bacteria | 988 |
| 434 | Ga0307416_101056563 | 3300032002 | Bacteria | 916 |
| 435 | Ga0307416_101095319 | 3300032002 | Bacteria | 901 |
| 436 | Ga0307416_101423735 | 3300032002 | Bacteria | 799 |
| 437 | Ga0307416_101660332 | 3300032002 | Bacteria | 744 |
| 438 | Ga0307416_101886309 | 3300032002 | Bacteria | 701 |
| 439 | Ga0307416_102778812 | 3300032002 | Bacteria | 585 |
| 440 | Ga0307416_103481219 | 3300032002 | Unclassified | 527 |
| 441 | Ga0307416_103896051 | 3300032002 | Bacteria | 500 |
| 442 | Ga0307411_10465514 | 3300032005 | Bacteria | 1061 |
| 443 | Ga0373944_0016046 | 3300035089 | Unclassified | 2107 |
| 444 | Ga0373954_0315421 | 3300035118 | Bacteria | 772 |
| 445 | Ga0373957_0191541 | 3300035120 | Bacteria | 850 |
| 446 | Ga0373957_0514641 | 3300035120 | Bacteria | 522 |
| 447 | Ga0373946_0589137 | 3300035171 | Bacteria | 576 |
| 448 | Ga0373955_0738026 | 3300035172 | Bacteria | 605 |
| 449 | Ga0373942_0374266 | 3300035207 | Bacteria | 507 |
| 450 | Ga0373961_0438960 | 3300035241 | Bacteria | 507 |
| 451 | Ga0373924_0050038 | 3300035410 | Bacteria | 1731 |
| 452 | Ga0373935_0285873 | 3300035692 | Bacteria | 1162 |
| 453 | Ga0373935_0881194 | 3300035692 | Bacteria | 663 |
| 454 | Ga0373947_0175222 | 3300035725 | Bacteria | 1394 |
| 455 | Ga0373947_0246251 | 3300035725 | Unclassified | 1181 |
| 456 | Ga0373947_1163292 | 3300035725 | Bacteria | 526 |
| 457 | Ga0373937_1263842 | 3300036401 | Unclassified | 686 |
| 458 | Ga0373925_0659605 | 3300037068 | Bacteria | 862 |
| 459 | Ga0373925_1133548 | 3300037068 | Unclassified | 643 |
| 460 | Ga0436364_0413139 | 3300037853 | Bacteria | 254582 |
| 461 | Ga0436365_0113116 | 3300039437 | Bacteria | 1636 |
| 462 | Ga0436365_1621027 | 3300039437 | Unclassified | 1230 |
| 463 | Ga0451853_0056793 | 3300041512 | Bacteria | 841 |
| 464 | Ga0451853_2018823 | 3300041512 | Bacteria | 1263 |
| 465 | Ga0451853_3602046 | 3300041512 | Bacteria | 919 |
| 466 | Ga0439431_0091320 | 3300041997 | Bacteria | 830 |
| 467 | Ga0439431_0168300 | 3300041997 | Bacteria | 629 |
| 468 | Ga0439449_0033470 | 3300042007 | Bacteria | 1914 |
| 469 | Ga0439446_0245403 | 3300042156 | Bacteria | 616 |
| 470 | Ga0439446_0279182 | 3300042156 | Bacteria | 582 |
| 471 | Ga0439434_0102015 | 3300042435 | Bacteria | 925 |
| 472 | Ga0439435_0232447 | 3300042436 | Bacteria | 616 |
| 473 | Ga0439464_0208484 | 3300042439 | Unclassified | 625 |
| 474 | Ga0439460_0028314 | 3300042461 | Bacteria | 1580 |
| 475 | Ga0451577_0872012 | 3300042876 | Bacteria | 811 |
| 476 | Ga0466964_0548184 | 3300044706 | Bacteria | 627 |
| 477 | Ga0453684_1657409 | 3300044712 | Unclassified | 655 |
| 478 | Ga0451576_0280843 | 3300045051 | Bacteria | 1741 |
| 479 | Ga0451576_0548805 | 3300045051 | Bacteria | 1214 |
| 480 | Ga0451576_1267853 | 3300045051 | Unclassified | 769 |
| 481 | Ga0451576_2746805 | 3300045051 | Unclassified | 501 |
| 482 | Ga0466967_0212063 | 3300045976 | Bacteria | 1837 |
| 483 | Ga0495592_0039536 | 3300046454 | Bacteria | 3543 |
| 484 | Ga0495603_0045408 | 3300046455 | Bacteria | 2620 |
| 485 | Ga0495629_0165632 | 3300046459 | Bacteria | 1535 |
| 486 | Ga0495638_0003582 | 3300046460 | Bacteria | 12162 |
| 487 | Ga0495651_0155161 | 3300046462 | Bacteria | 1646 |
| 488 | Ga0495639_0163388 | 3300046475 | Bacteria | 1079 |
| 489 | Ga0495662_0644877 | 3300046476 | Bacteria | 517 |
| 490 | Ga0495664_0869783 | 3300046477 | Bacteria | 528 |
| 491 | Ga0495594_0235853 | 3300046499 | Bacteria | 1043 |
| 492 | Ga0495607_0382971 | 3300046501 | Bacteria | 643 |
| 493 | Ga0495628_0155017 | 3300046516 | Bacteria | 1743 |
| 494 | Ga0495630_0354016 | 3300046517 | Bacteria | 1124 |
| 495 | Ga0495640_0603174 | 3300046533 | Bacteria | 663 |
| 496 | Ga0495586_0282431 | 3300046535 | Bacteria | 950 |
| 497 | Ga0495586_0668261 | 3300046535 | Bacteria | 600 |
| 498 | Ga0495621_0190859 | 3300046539 | Bacteria | 821 |
| 499 | Ga0495633_0155189 | 3300046558 | Bacteria | 1057 |
| 500 | Ga0495667_0114538 | 3300046559 | Bacteria | 1742 |
| 501 | Ga0495667_0248713 | 3300046559 | Bacteria | 1132 |
| 502 | Ga0495634_0579531 | 3300046642 | Bacteria | 652 |
| 503 | Ga0495611_0418074 | 3300046648 | Bacteria | 612 |
| 504 | Ga0495635_0041962 | 3300046663 | Bacteria | 3161 |
| 505 | Ga0495635_0410209 | 3300046663 | Bacteria | 899 |
| 506 | Ga0495599_0060880 | 3300046678 | Bacteria | 2360 |
| 507 | Ga0495599_0133559 | 3300046678 | Bacteria | 1541 |
| 508 | Ga0495647_0011190 | 3300046681 | Bacteria | 3070 |
| 509 | Ga0495647_0097366 | 3300046681 | Bacteria | 1214 |
| 510 | Ga0495658_0064656 | 3300046683 | Bacteria | 2108 |
| 511 | Ga0495658_0086966 | 3300046683 | Bacteria | 1845 |
| 512 | Ga0495658_0664263 | 3300046683 | Bacteria | 668 |
| 513 | Ga0495613_0047197 | 3300046689 | Bacteria | 3182 |
| 514 | Ga0495624_0712003 | 3300046690 | Bacteria | 596 |
| 515 | Ga0495600_0701534 | 3300046809 | Bacteria | 609 |
| 516 | Ga0495674_0320821 | 3300047319 | Bacteria | 1262 |
| 517 | Ga0495676_0645725 | 3300047321 | Bacteria | 687 |
| 518 | Ga0495680_0334340 | 3300047322 | Bacteria | 1058 |
| 519 | Ga0496101_1261968 | 3300048904 | Bacteria | 578 |
| 520 | Ga0496102_0702480 | 3300048905 | Bacteria | 934 |
| 521 | Ga0496102_1028148 | 3300048905 | Unclassified | 744 |
| 522 | Ga0496104_0146666 | 3300048907 | Bacteria | 2266 |
| 523 | Ga0496109_0142700 | 3300048912 | Bacteria | 2240 |
| 524 | Ga0496109_0394146 | 3300048912 | Bacteria | 1308 |
| 525 | Ga0496110_1383736 | 3300048913 | Bacteria | 613 |
| 526 | Ga0496112_0158836 | 3300048915 | Bacteria | 2227 |
| 527 | Ga0496112_0387939 | 3300048915 | Bacteria | 1337 |
| 528 | Ga0496114_0187739 | 3300048917 | Bacteria | 1807 |
| 529 | Ga0496115_0028623 | 3300048918 | Bacteria | 4369 |
| 530 | Ga0496121_0017161 | 3300048924 | Bacteria | 7415 |
| 531 | Ga0496124_0017108 | 3300048927 | Bacteria | 6855 |
| 532 | Ga0501031_0108509 | 3300049568 | Bacteria | 1812 |
| 533 | Ga0501034_0006113 | 3300049571 | Bacteria | 12991 |
| 534 | Ga0501036_0175496 | 3300049572 | Bacteria | 1804 |
| 535 | Ga0501036_0395912 | 3300049572 | Bacteria | 1152 |
| 536 | Ga0501036_1551075 | 3300049572 | Bacteria | 535 |
| 537 | Ga0501038_0516592 | 3300049574 | Bacteria | 912 |
| 538 | Ga0501038_0557184 | 3300049574 | Bacteria | 871 |
| 539 | Ga0501039_0059409 | 3300049575 | Bacteria | 2962 |
| 540 | Ga0501039_0485550 | 3300049575 | Bacteria | 970 |
| 541 | Ga0501039_0614514 | 3300049575 | Bacteria | 852 |
| 542 | Ga0501040_0348611 | 3300049576 | Bacteria | 1060 |
| 543 | Ga0501040_0428012 | 3300049576 | Bacteria | 952 |
| 544 | Ga0501040_0810582 | 3300049576 | Bacteria | 677 |
| 545 | Ga0501040_0878674 | 3300049576 | Bacteria | 649 |
| 546 | Ga0501040_0974943 | 3300049576 | Bacteria | 614 |
| 547 | Ga0501041_0065209 | 3300049577 | Bacteria | 2231 |
| 548 | Ga0501041_0602352 | 3300049577 | Bacteria | 701 |
| 549 | Ga0501042_0488375 | 3300049578 | Bacteria | 894 |
| 550 | Ga0501046_0187403 | 3300049580 | Bacteria | 1545 |
| 551 | Ga0501046_0654524 | 3300049580 | Unclassified | 742 |
| 552 | Ga0501048_0054902 | 3300049582 | Bacteria | 2830 |
| 553 | Ga0501048_0110951 | 3300049582 | Bacteria | 1937 |
| 554 | Ga0501048_0240791 | 3300049582 | Bacteria | 1284 |
| 555 | Ga0501048_1256326 | 3300049582 | Bacteria | 532 |
| 556 | Ga0501067_0379039 | 3300049583 | Bacteria | 789 |
| 557 | Ga0501068_0437674 | 3300049584 | Bacteria | 845 |
| 558 | Ga0501069_0856767 | 3300049585 | Bacteria | 552 |
| 559 | Ga0501069_0895520 | 3300049585 | Bacteria | 540 |
| 560 | Ga0501069_0957346 | 3300049585 | Bacteria | 522 |
| 561 | Ga0501071_0035635 | 3300049587 | Bacteria | 3545 |
| 562 | Ga0501071_0055007 | 3300049587 | Bacteria | 2872 |
| 563 | Ga0501071_0510590 | 3300049587 | Bacteria | 922 |
| 564 | Ga0501071_0823465 | 3300049587 | Bacteria | 716 |
| 565 | Ga0501072_0129519 | 3300049588 | Bacteria | 2011 |
| 566 | Ga0501072_0347587 | 3300049588 | Bacteria | 1177 |
| 567 | Ga0501072_0529226 | 3300049588 | Unclassified | 932 |
| 568 | Ga0501072_0611824 | 3300049588 | Bacteria | 859 |
| 569 | Ga0501072_0850195 | 3300049588 | Unclassified | 713 |
| 570 | Ga0501072_0915201 | 3300049588 | Bacteria | 685 |
| 571 | Ga0501073_0424115 | 3300049589 | Unclassified | 919 |
| 572 | Ga0501073_0548171 | 3300049589 | Bacteria | 799 |
| 573 | Ga0501074_0162251 | 3300049590 | Bacteria | 1596 |
| 574 | Ga0501074_0673670 | 3300049590 | Bacteria | 730 |
| 575 | Ga0501074_0684422 | 3300049590 | Bacteria | 724 |
| 576 | Ga0501074_0706996 | 3300049590 | Bacteria | 711 |
| 577 | Ga0501075_0037021 | 3300049591 | Bacteria | 3643 |
| 578 | Ga0501075_0104298 | 3300049591 | Bacteria | 2155 |
| 579 | Ga0501075_0183380 | 3300049591 | Bacteria | 1597 |
| 580 | Ga0501075_0192293 | 3300049591 | Bacteria | 1556 |
| 581 | Ga0501076_0056689 | 3300049592 | Bacteria | 3110 |
| 582 | Ga0501076_0306645 | 3300049592 | Bacteria | 1302 |
| 583 | Ga0501076_0323568 | 3300049592 | Bacteria | 1265 |
| 584 | Ga0501076_0402508 | 3300049592 | Bacteria | 1125 |
| 585 | Ga0501076_0775457 | 3300049592 | Unclassified | 791 |
| 586 | Ga0501076_1156952 | 3300049592 | Bacteria | 637 |
| 587 | Ga0501077_0086806 | 3300049593 | Bacteria | 1983 |
| 588 | Ga0501077_0184000 | 3300049593 | Bacteria | 1328 |
| 589 | Ga0501079_0035909 | 3300049741 | Bacteria | 3817 |
| 590 | Ga0501079_0040600 | 3300049741 | Bacteria | 3590 |
| 591 | Ga0501079_0054982 | 3300049741 | Bacteria | 3071 |
| 592 | Ga0501079_0881503 | 3300049741 | Unclassified | 705 |
| 593 | Ga0501080_0243446 | 3300049742 | Bacteria | 1641 |
| 594 | Ga0501080_0287010 | 3300049742 | Bacteria | 1495 |
| 595 | Ga0501080_1440521 | 3300049742 | Unclassified | 587 |
| 596 | Ga0501081_0051492 | 3300049743 | Bacteria | 2840 |
| 597 | Ga0501081_0063454 | 3300049743 | Bacteria | 2564 |
| 598 | Ga0501081_0341504 | 3300049743 | Bacteria | 1103 |
| 599 | Ga0501081_0843868 | 3300049743 | Unclassified | 690 |
| 600 | Ga0501035_0104196 | 3300049822 | Bacteria | 2488 |
| 601 | Ga0501045_0037298 | 3300049824 | Bacteria | 3532 |
| 602 | Ga0501045_0084759 | 3300049824 | Bacteria | 2338 |
| 603 | Ga0501045_0128366 | 3300049824 | Bacteria | 1884 |
| 604 | Ga0501045_0520873 | 3300049824 | Bacteria | 883 |
| 605 | Ga0501045_1085318 | 3300049824 | Bacteria | 586 |
| 606 | nmdc:mga03683_11941_c1 | 3300050489 | Bacteria | 3159 |
| 607 | nmdc:mga03683_383738_c1 | 3300050489 | Bacteria | 669 |
| 608 | nmdc:mga00v17_581074_c1 | 3300050491 | Bacteria | 723 |
| 609 | nmdc:mga00v17_59698_c1 | 3300050491 | Bacteria | 2341 |
| 610 | nmdc:mga00v17_791888_c1 | 3300050491 | Bacteria | 604 |
| 611 | nmdc:mga0yw44_78290_c1 | 3300050492 | Bacteria | 2067 |
| 612 | nmdc:mga0k408_290120_c1 | 3300050493 | Bacteria | 976 |
| 613 | nmdc:mga0k408_6905_c1 | 3300050493 | Bacteria | 6057 |
| 614 | nmdc:mga06z11_18241_c1 | 3300050494 | Bacteria | 3201 |
| 615 | nmdc:mga06z11_294816_c1 | 3300050494 | Unclassified | 963 |
| 616 | nmdc:mga06z11_466321_c1 | 3300050494 | Bacteria | 764 |
| 617 | nmdc:mga06z11_88085_c1 | 3300050494 | Bacteria | 1680 |
| 618 | nmdc:mga04h51_72200_c1 | 3300050495 | Bacteria | 1207 |
| 619 | nmdc:mga04h51_87063_c1 | 3300050495 | Bacteria | 1118 |
| 620 | nmdc:mga05p37_1068279_c1 | 3300050507 | Bacteria | 849 |
| 621 | nmdc:mga05p37_120743_c1 | 3300050507 | Bacteria | 3219 |
| 622 | nmdc:mga05p37_1678819_c1 | 3300050507 | Unclassified | 621 |
| 623 | nmdc:mga05p37_2169_c1 | 3300050507 | Bacteria | 22888 |
| 624 | nmdc:mga05p37_2454_c1 | 3300050507 | Bacteria | 21555 |
| 625 | nmdc:mga05p37_30866_c1 | 3300050507 | Bacteria | 6541 |
| 626 | nmdc:mga05p37_41627_c1 | 3300050507 | Bacteria | 5641 |
| 627 | nmdc:mga05p37_494868_c1 | 3300050507 | Bacteria | 1405 |
| 628 | nmdc:mga05p37_582884_c1 | 3300050507 | Unclassified | 1266 |
| 629 | nmdc:mga05p37_6745_c1 | 3300050507 | Bacteria | 13538 |
| 630 | nmdc:mga05p37_89734_c1 | 3300050507 | Bacteria | 3788 |
| 631 | nmdc:mga09592_1412571_c1 | 3300050508 | Bacteria | 569 |
| 632 | nmdc:mga09592_1525523_c1 | 3300050508 | Bacteria | 543 |
| 633 | nmdc:mga09592_77587_c1 | 3300050508 | Bacteria | 2826 |
| 634 | nmdc:mga0qj67_451238_c1 | 3300050509 | Bacteria | 1036 |
| 635 | nmdc:mga06r32_1242647_c1 | 3300050510 | Unclassified | 690 |
| 636 | nmdc:mga06r32_1384744_c1 | 3300050510 | Bacteria | 645 |
| 637 | nmdc:mga06r32_241870_c1 | 3300050510 | Bacteria | 1792 |
| 638 | nmdc:mga06r32_36771_c1 | 3300050510 | Bacteria | 4629 |
| 639 | nmdc:mga06r32_521401_c1 | 3300050510 | Bacteria | 1164 |
| 640 | nmdc:mga08y16_19188_c1 | 3300050511 | Bacteria | 7204 |
| 641 | nmdc:mga08y16_1975598_c1 | 3300050511 | Bacteria | 533 |
| 642 | nmdc:mga08y16_403451_c1 | 3300050511 | Bacteria | 1399 |
| 643 | nmdc:mga08y16_533867_c1 | 3300050511 | Bacteria | 1189 |
| 644 | nmdc:mga08y16_657189_c1 | 3300050511 | Bacteria | 1052 |
| 645 | nmdc:mga0n895_127339_c1 | 3300050512 | Bacteria | 2570 |
| 646 | nmdc:mga0n895_152513_c1 | 3300050512 | Bacteria | 2341 |
| 647 | nmdc:mga0n895_1843181_c1 | 3300050512 | Bacteria | 565 |
| 648 | nmdc:mga0n895_186941_c1 | 3300050512 | Bacteria | 2103 |
| 649 | nmdc:mga0n895_805045_c1 | 3300050512 | Bacteria | 930 |
| 650 | nmdc:mga0n895_95_c1 | 3300050512 | Bacteria | 52030 |
| 651 | nmdc:mga0rr50_165429_c1 | 3300050513 | Bacteria | 1798 |
| 652 | nmdc:mga0rr50_17771_c1 | 3300050513 | Bacteria | 4759 |
| 653 | nmdc:mga0rr50_28_c1 | 3300050513 | Bacteria | 108950 |
| 654 | nmdc:mga0rr50_706771_c1 | 3300050513 | Bacteria | 860 |
| 655 | nmdc:mga08x19_121_c1 | 3300050514 | Bacteria | 69968 |
| 656 | nmdc:mga08x19_318640_c1 | 3300050514 | Bacteria | 1082 |
| 657 | nmdc:mga0a205_111836_c1 | 3300050515 | Bacteria | 2630 |
| 658 | nmdc:mga0a205_160653_c1 | 3300050515 | Unclassified | 2144 |
| 659 | nmdc:mga0a205_275666_c1 | 3300050515 | Bacteria | 1558 |
| 660 | nmdc:mga0a205_328334_c1 | 3300050515 | Bacteria | 1400 |
| 661 | nmdc:mga0a205_65091_c1 | 3300050515 | Bacteria | 3521 |
| 662 | nmdc:mga0a205_809171_c1 | 3300050515 | Bacteria | 785 |
| 663 | Ga0495595_0300677 | 3300053084 | Bacteria | 807 |
| 664 | Ga0495595_0400799 | 3300053084 | Bacteria | 695 |
| 665 | Ga0500566_0342628 | 3300053094 | Bacteria | 688 |
| 666 | Ga0500566_0492841 | 3300053094 | Unclassified | 529 |
| 667 | Ga0500592_049854 | 3300053116 | Bacteria | 680 |
| 668 | Ga0500618_000025 | 3300053125 | Bacteria | 150583 |
| 669 | Ga0500627_0353441 | 3300053158 | Unclassified | 634 |
| 670 | Ga0501084_0116139 | 3300054114 | Bacteria | 2250 |
| 671 | Ga0501084_0855243 | 3300054114 | Bacteria | 765 |
| 672 | Ga0501084_0926358 | 3300054114 | Bacteria | 733 |
| 673 | Ga0501084_0980842 | 3300054114 | Bacteria | 710 |
| 674 | Ga0501084_1429638 | 3300054114 | Unclassified | 579 |
| 675 | Ga0501082_0047449 | 3300060353 | Bacteria | 3701 |
| 676 | Ga0501082_0270103 | 3300060353 | Bacteria | 1480 |
| 677 | Ga0501082_0430103 | 3300060353 | Unclassified | 1153 |
| 678 | Ga0501082_1397468 | 3300060353 | Bacteria | 611 |
| 679 | Ga0501082_1847788 | 3300060353 | Bacteria | 527 |
| 680 | Ga0530510_0243740 | 3300061734 | Bacteria | 1338 |
| 681 | Ga0530510_0344118 | 3300061734 | Bacteria | 1120 |
| 682 | Ga0530510_0728180 | 3300061734 | Bacteria | 756 |
| 683 | Ga0530510_0736926 | 3300061734 | Unclassified | 751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_11622783 | Ga0163162_116227832 | 79 |
| 2 | 3300049742 | Ga0501080_1440521 | Ga0501080_1440521_103_372 | 79 |
| 3 | 3300060353 | Ga0501082_1847788 | Ga0501082_1847788_71_343 | 80 |
| 4 | 3300005535 | Ga0070684_101238640 | Ga0070684_1012386402 | 81 |
| 5 | 3300013100 | Ga0157373_11476904 | Ga0157373_114769041 | 81 |
| 6 | 3300013306 | Ga0163162_11465257 | Ga0163162_114652572 | 81 |
| 7 | 3300005406 | Ga0070703_10000084 | Ga0070703_1000008412 | 87 |
| 8 | 3300005445 | Ga0070708_100026034 | Ga0070708_1000260345 | 87 |
| 9 | 3300005467 | Ga0070706_100000409 | Ga0070706_10000040930 | 87 |
| 10 | 3300005518 | Ga0070699_100000088 | Ga0070699_10000008874 | 87 |
| 11 | 3300005545 | Ga0070695_100183579 | Ga0070695_1001835792 | 87 |
| 12 | 3300005546 | Ga0070696_100002481 | Ga0070696_10000248111 | 87 |
| 13 | 3300005546 | Ga0070696_100172267 | Ga0070696_1001722672 | 87 |
| 14 | 3300005547 | Ga0070693_100002568 | Ga0070693_1000025688 | 87 |
| 15 | 3300013297 | Ga0157378_10728496 | Ga0157378_107284962 | 87 |
| 16 | 3300025885 | Ga0207653_10000271 | Ga0207653_1000027114 | 87 |
| 17 | 3300025910 | Ga0207684_10000881 | Ga0207684_1000088111 | 87 |
| 18 | iso_pu_bacteria | 2821123053 | 2821128840 | 87 |
| 19 | iso_pu_bacteria | 2857531043 | 2857534007 | 87 |
| 20 | 3300005293 | Ga0065715_10071658 | Ga0065715_100716581 | 89 |
| 21 | 3300005293 | Ga0065715_10208831 | Ga0065715_102088313 | 89 |
| 22 | 3300005328 | Ga0070676_10050842 | Ga0070676_100508426 | 89 |
| 23 | 3300005328 | Ga0070676_10978615 | Ga0070676_109786152 | 89 |
| 24 | 3300005331 | Ga0070670_100040793 | Ga0070670_1000407935 | 89 |
| 25 | 3300005333 | Ga0070677_10341987 | Ga0070677_103419872 | 89 |
| 26 | 3300005335 | Ga0070666_10193636 | Ga0070666_101936364 | 89 |
| 27 | 3300005336 | Ga0070680_100435681 | Ga0070680_1004356812 | 89 |
| 28 | 3300005336 | Ga0070680_100638234 | Ga0070680_1006382342 | 89 |
| 29 | 3300005337 | Ga0070682_101559978 | Ga0070682_1015599782 | 89 |
| 30 | 3300005338 | Ga0068868_100772186 | Ga0068868_1007721862 | 89 |
| 31 | 3300005339 | Ga0070660_100661703 | Ga0070660_1006617032 | 89 |
| 32 | 3300005353 | Ga0070669_100187620 | Ga0070669_1001876203 | 89 |
| 33 | 3300005354 | Ga0070675_100843305 | Ga0070675_1008433051 | 89 |
| 34 | 3300005354 | Ga0070675_101788268 | Ga0070675_1017882682 | 89 |
| 35 | 3300005356 | Ga0070674_100097298 | Ga0070674_1000972983 | 89 |
| 36 | 3300005364 | Ga0070673_101400542 | Ga0070673_1014005422 | 89 |
| 37 | 3300005366 | Ga0070659_100168933 | Ga0070659_1001689335 | 89 |
| 38 | 3300005440 | Ga0070705_100001592 | Ga0070705_10000159211 | 89 |
| 39 | 3300005441 | Ga0070700_101044495 | Ga0070700_1010444952 | 89 |
| 40 | 3300005441 | Ga0070700_101544079 | Ga0070700_1015440792 | 89 |
| 41 | 3300005444 | Ga0070694_101289438 | Ga0070694_1012894382 | 89 |
| 42 | 3300005459 | Ga0068867_100005839 | Ga0068867_1000058399 | 89 |
| 43 | 3300005468 | Ga0070707_101771132 | Ga0070707_1017711321 | 89 |
| 44 | 3300005471 | Ga0070698_101119969 | Ga0070698_1011199691 | 89 |
| 45 | 3300005536 | Ga0070697_101350173 | Ga0070697_1013501732 | 89 |
| 46 | 3300005547 | Ga0070693_100746227 | Ga0070693_1007462272 | 89 |
| 47 | 3300005548 | Ga0070665_100006541 | Ga0070665_1000065416 | 89 |
| 48 | 3300005549 | Ga0070704_100175306 | Ga0070704_1001753062 | 89 |
| 49 | 3300005617 | Ga0068859_100003822 | Ga0068859_1000038227 | 89 |
| 50 | 3300005618 | Ga0068864_100158793 | Ga0068864_1001587932 | 89 |
| 51 | 3300005618 | Ga0068864_100659786 | Ga0068864_1006597862 | 89 |
| 52 | 3300005618 | Ga0068864_101462168 | Ga0068864_1014621682 | 89 |
| 53 | 3300005718 | Ga0068866_10044178 | Ga0068866_100441785 | 89 |
| 54 | 3300005719 | Ga0068861_100479695 | Ga0068861_1004796952 | 89 |
| 55 | 3300005719 | Ga0068861_102520268 | Ga0068861_1025202681 | 89 |
| 56 | 3300005841 | Ga0068863_100694189 | Ga0068863_1006941892 | 89 |
| 57 | 3300005842 | Ga0068858_100230961 | Ga0068858_1002309614 | 89 |
| 58 | 3300005842 | Ga0068858_100567704 | Ga0068858_1005677043 | 89 |
| 59 | 3300005842 | Ga0068858_101084490 | Ga0068858_1010844902 | 89 |
| 60 | 3300005843 | Ga0068860_101007946 | Ga0068860_1010079462 | 89 |
| 61 | 3300005844 | Ga0068862_100435398 | Ga0068862_1004353985 | 89 |
| 62 | 3300005844 | Ga0068862_100726479 | Ga0068862_1007264791 | 89 |
| 63 | 3300006038 | Ga0075365_10000562 | Ga0075365_1000056214 | 89 |
| 64 | 3300006042 | Ga0075368_10203973 | Ga0075368_102039732 | 89 |
| 65 | 3300006048 | Ga0075363_100398047 | Ga0075363_1003980472 | 89 |
| 66 | 3300006048 | Ga0075363_100734936 | Ga0075363_1007349362 | 89 |
| 67 | 3300006051 | Ga0075364_10252862 | Ga0075364_102528622 | 89 |
| 68 | 3300006178 | Ga0075367_10010080 | Ga0075367_100100803 | 89 |
| 69 | 3300006237 | Ga0097621_100001463 | Ga0097621_10000146316 | 89 |
| 70 | 3300006237 | Ga0097621_101511432 | Ga0097621_1015114322 | 89 |
| 71 | 3300006358 | Ga0068871_100012694 | Ga0068871_1000126945 | 89 |
| 72 | 3300006358 | Ga0068871_100519413 | Ga0068871_1005194133 | 89 |
| 73 | 3300006844 | Ga0075428_101100872 | Ga0075428_1011008723 | 89 |
| 74 | 3300006846 | Ga0075430_100292790 | Ga0075430_1002927903 | 89 |
| 75 | 3300006847 | Ga0075431_100736104 | Ga0075431_1007361043 | 89 |
| 76 | 3300006852 | Ga0075433_10058944 | Ga0075433_100589446 | 89 |
| 77 | 3300006871 | Ga0075434_100260498 | Ga0075434_1002604982 | 89 |
| 78 | 3300006880 | Ga0075429_100069156 | Ga0075429_1000691562 | 89 |
| 79 | 3300006881 | Ga0068865_100009117 | Ga0068865_1000091174 | 89 |
| 80 | 3300006881 | Ga0068865_100598161 | Ga0068865_1005981613 | 89 |
| 81 | 3300006881 | Ga0068865_101124220 | Ga0068865_1011242202 | 89 |
| 82 | 3300006931 | Ga0097620_100003822 | Ga0097620_1000038227 | 89 |
| 83 | 3300009093 | Ga0105240_11641437 | Ga0105240_116414371 | 89 |
| 84 | 3300009094 | Ga0111539_10002313 | Ga0111539_100023139 | 89 |
| 85 | 3300009094 | Ga0111539_11791798 | Ga0111539_117917982 | 89 |
| 86 | 3300009094 | Ga0111539_11912544 | Ga0111539_119125442 | 89 |
| 87 | 3300009098 | Ga0105245_10146471 | Ga0105245_101464712 | 89 |
| 88 | 3300009147 | Ga0114129_10015216 | Ga0114129_1001521611 | 89 |
| 89 | 3300009147 | Ga0114129_11936848 | Ga0114129_119368482 | 89 |
| 90 | 3300009148 | Ga0105243_11912600 | Ga0105243_119126002 | 89 |
| 91 | 3300009174 | Ga0105241_11576514 | Ga0105241_115765142 | 89 |
| 92 | 3300009176 | Ga0105242_10097363 | Ga0105242_100973633 | 89 |
| 93 | 3300009177 | Ga0105248_10708929 | Ga0105248_107089293 | 89 |
| 94 | 3300009551 | Ga0105238_11423263 | Ga0105238_114232632 | 89 |
| 95 | 3300009553 | Ga0105249_10738737 | Ga0105249_107387372 | 89 |
| 96 | 3300009553 | Ga0105249_11997950 | Ga0105249_119979502 | 89 |
| 97 | 3300009553 | Ga0105249_12314611 | Ga0105249_123146111 | 89 |
| 98 | 3300013297 | Ga0157378_13251137 | Ga0157378_132511372 | 89 |
| 99 | 3300014325 | Ga0163163_10182331 | Ga0163163_101823315 | 89 |
| 100 | 3300014325 | Ga0163163_11172677 | Ga0163163_111726772 | 89 |
| 101 | 3300014326 | Ga0157380_10010700 | Ga0157380_100107006 | 89 |
| 102 | 3300014326 | Ga0157380_13053528 | Ga0157380_130535282 | 89 |
| 103 | 3300014968 | Ga0157379_10367625 | Ga0157379_103676252 | 89 |
| 104 | 3300014969 | Ga0157376_10684452 | Ga0157376_106844522 | 89 |
| 105 | 3300014969 | Ga0157376_11373508 | Ga0157376_113735082 | 89 |
| 106 | 3300025899 | Ga0207642_10121656 | Ga0207642_101216561 | 89 |
| 107 | 3300025903 | Ga0207680_10287234 | Ga0207680_102872343 | 89 |
| 108 | 3300025907 | Ga0207645_10652480 | Ga0207645_106524802 | 89 |
| 109 | 3300025907 | Ga0207645_10937110 | Ga0207645_109371102 | 89 |
| 110 | 3300025910 | Ga0207684_10778491 | Ga0207684_107784913 | 89 |
| 111 | 3300025916 | Ga0207663_11192825 | Ga0207663_111928251 | 89 |
| 112 | 3300025922 | Ga0207646_11201641 | Ga0207646_112016412 | 89 |
| 113 | 3300025923 | Ga0207681_11064549 | Ga0207681_110645492 | 89 |
| 114 | 3300025925 | Ga0207650_10029687 | Ga0207650_100296875 | 89 |
| 115 | 3300025925 | Ga0207650_11451441 | Ga0207650_114514412 | 89 |
| 116 | 3300025926 | Ga0207659_10298747 | Ga0207659_102987473 | 89 |
| 117 | 3300025926 | Ga0207659_10384772 | Ga0207659_103847722 | 89 |
| 118 | 3300025927 | Ga0207687_10107302 | Ga0207687_101073022 | 89 |
| 119 | 3300025932 | Ga0207690_10271928 | Ga0207690_102719284 | 89 |
| 120 | 3300025934 | Ga0207686_10027009 | Ga0207686_100270093 | 89 |
| 121 | 3300025937 | Ga0207669_10109383 | Ga0207669_101093833 | 89 |
| 122 | 3300025938 | Ga0207704_10058201 | Ga0207704_100582015 | 89 |
| 123 | 3300025941 | Ga0207711_10621316 | Ga0207711_106213162 | 89 |
| 124 | 3300025960 | Ga0207651_11578682 | Ga0207651_115786822 | 89 |
| 125 | 3300025961 | Ga0207712_11212790 | Ga0207712_112127902 | 89 |
| 126 | 3300025961 | Ga0207712_11257449 | Ga0207712_112574492 | 89 |
| 127 | 3300026023 | Ga0207677_10129928 | Ga0207677_101299283 | 89 |
| 128 | 3300026023 | Ga0207677_10413697 | Ga0207677_104136972 | 89 |
| 129 | 3300026035 | Ga0207703_10421748 | Ga0207703_104217482 | 89 |
| 130 | 3300026035 | Ga0207703_12246352 | Ga0207703_122463522 | 89 |
| 131 | 3300026088 | Ga0207641_11068326 | Ga0207641_110683262 | 89 |
| 132 | 3300026089 | Ga0207648_10022113 | Ga0207648_100221135 | 89 |
| 133 | 3300026095 | Ga0207676_10104875 | Ga0207676_101048753 | 89 |
| 134 | 3300026095 | Ga0207676_11721762 | Ga0207676_117217621 | 89 |
| 135 | 3300026118 | Ga0207675_100564433 | Ga0207675_1005644333 | 89 |
| 136 | 3300026118 | Ga0207675_101576150 | Ga0207675_1015761501 | 89 |
| 137 | 3300026121 | Ga0207683_10570833 | Ga0207683_105708333 | 89 |
| 138 | 3300026121 | Ga0207683_10779952 | Ga0207683_107799522 | 89 |
| 139 | 3300027866 | Ga0209813_10134450 | Ga0209813_101344502 | 89 |
| 140 | 3300027907 | Ga0207428_10023711 | Ga0207428_100237116 | 89 |
| 141 | 3300028379 | Ga0268266_10008922 | Ga0268266_1000892210 | 89 |
| 142 | 3300028380 | Ga0268265_10341819 | Ga0268265_103418193 | 89 |
| 143 | 3300028380 | Ga0268265_10438571 | Ga0268265_104385712 | 89 |
| 144 | 3300028380 | Ga0268265_10642223 | Ga0268265_106422234 | 89 |
| 145 | 3300028381 | Ga0268264_10733703 | Ga0268264_107337032 | 89 |
| 146 | 3300031548 | Ga0307408_100887435 | Ga0307408_1008874352 | 89 |
| 147 | 3300031711 | Ga0265314_10010737 | Ga0265314_100107378 | 89 |
| 148 | 3300031911 | Ga0307412_11788100 | Ga0307412_117881002 | 89 |
| 149 | 3300032002 | Ga0307416_102778812 | Ga0307416_1027788122 | 89 |
| 150 | 3300032002 | Ga0307416_103481219 | Ga0307416_1034812192 | 89 |
| 151 | 3300032002 | Ga0307416_103896051 | Ga0307416_1038960512 | 89 |
| 152 | 3300035089 | Ga0373944_0016046 | Ga0373944_0016046_302_571 | 89 |
| 153 | 3300035118 | Ga0373954_0315421 | Ga0373954_0315421_87_356 | 89 |
| 154 | 3300035120 | Ga0373957_0191541 | Ga0373957_0191541_420_689 | 89 |
| 155 | 3300035120 | Ga0373957_0514641 | Ga0373957_0514641_23_292 | 89 |
| 156 | 3300035171 | Ga0373946_0589137 | Ga0373946_0589137_27_296 | 89 |
| 157 | 3300035172 | Ga0373955_0738026 | Ga0373955_0738026_298_567 | 89 |
| 158 | 3300035692 | Ga0373935_0285873 | Ga0373935_0285873_133_402 | 89 |
| 159 | 3300035725 | Ga0373947_0175222 | Ga0373947_0175222_813_1082 | 89 |
| 160 | 3300035725 | Ga0373947_0246251 | Ga0373947_0246251_310_579 | 89 |
| 161 | 3300035725 | Ga0373947_1163292 | Ga0373947_1163292_231_500 | 89 |
| 162 | 3300036401 | Ga0373937_1263842 | Ga0373937_1263842_231_500 | 89 |
| 163 | 3300037068 | Ga0373925_0659605 | Ga0373925_0659605_161_430 | 89 |
| 164 | 3300041512 | Ga0451853_2018823 | Ga0451853_2018823_838_1107 | 89 |
| 165 | 3300041997 | Ga0439431_0168300 | Ga0439431_0168300_88_357 | 89 |
| 166 | 3300042007 | Ga0439449_0033470 | Ga0439449_0033470_479_748 | 89 |
| 167 | 3300042435 | Ga0439434_0102015 | Ga0439434_0102015_159_428 | 89 |
| 168 | 3300042436 | Ga0439435_0232447 | Ga0439435_0232447_308_577 | 89 |
| 169 | 3300046454 | Ga0495592_0039536 | Ga0495592_0039536_2576_2845 | 89 |
| 170 | 3300046455 | Ga0495603_0045408 | Ga0495603_0045408_331_600 | 89 |
| 171 | 3300046462 | Ga0495651_0155161 | Ga0495651_0155161_468_737 | 89 |
| 172 | 3300046516 | Ga0495628_0155017 | Ga0495628_0155017_320_589 | 89 |
| 173 | 3300046517 | Ga0495630_0354016 | Ga0495630_0354016_666_935 | 89 |
| 174 | 3300046535 | Ga0495586_0282431 | Ga0495586_0282431_462_731 | 89 |
| 175 | 3300046535 | Ga0495586_0668261 | Ga0495586_0668261_64_333 | 89 |
| 176 | 3300046559 | Ga0495667_0114538 | Ga0495667_0114538_984_1253 | 89 |
| 177 | 3300046642 | Ga0495634_0579531 | Ga0495634_0579531_43_312 | 89 |
| 178 | 3300046663 | Ga0495635_0041962 | Ga0495635_0041962_365_634 | 89 |
| 179 | 3300046681 | Ga0495647_0011190 | Ga0495647_0011190_2518_2787 | 89 |
| 180 | 3300046683 | Ga0495658_0086966 | Ga0495658_0086966_810_1079 | 89 |
| 181 | 3300046683 | Ga0495658_0664263 | Ga0495658_0664263_157_426 | 89 |
| 182 | 3300046689 | Ga0495613_0047197 | Ga0495613_0047197_1090_1359 | 89 |
| 183 | 3300046690 | Ga0495624_0712003 | Ga0495624_0712003_202_471 | 89 |
| 184 | 3300047319 | Ga0495674_0320821 | Ga0495674_0320821_739_1008 | 89 |
| 185 | 3300047321 | Ga0495676_0645725 | Ga0495676_0645725_157_426 | 89 |
| 186 | 3300048905 | Ga0496102_1028148 | Ga0496102_1028148_465_734 | 89 |
| 187 | 3300048912 | Ga0496109_0394146 | Ga0496109_0394146_954_1223 | 89 |
| 188 | 3300048913 | Ga0496110_1383736 | Ga0496110_1383736_30_299 | 89 |
| 189 | 3300048915 | Ga0496112_0387939 | Ga0496112_0387939_848_1117 | 89 |
| 190 | 3300049572 | Ga0501036_0175496 | Ga0501036_0175496_643_912 | 89 |
| 191 | 3300049572 | Ga0501036_1551075 | Ga0501036_1551075_108_377 | 89 |
| 192 | 3300049574 | Ga0501038_0557184 | Ga0501038_0557184_136_405 | 89 |
| 193 | 3300049575 | Ga0501039_0485550 | Ga0501039_0485550_609_878 | 89 |
| 194 | 3300049575 | Ga0501039_0614514 | Ga0501039_0614514_363_632 | 89 |
| 195 | 3300049576 | Ga0501040_0810582 | Ga0501040_0810582_310_579 | 89 |
| 196 | 3300049577 | Ga0501041_0065209 | Ga0501041_0065209_1708_1977 | 89 |
| 197 | 3300049578 | Ga0501042_0488375 | Ga0501042_0488375_44_313 | 89 |
| 198 | 3300049582 | Ga0501048_0240791 | Ga0501048_0240791_253_522 | 89 |
| 199 | 3300049582 | Ga0501048_1256326 | Ga0501048_1256326_129_398 | 89 |
| 200 | 3300049585 | Ga0501069_0856767 | Ga0501069_0856767_55_324 | 89 |
| 201 | 3300049587 | Ga0501071_0055007 | Ga0501071_0055007_426_695 | 89 |
| 202 | 3300049587 | Ga0501071_0510590 | Ga0501071_0510590_275_544 | 89 |
| 203 | 3300049588 | Ga0501072_0129519 | Ga0501072_0129519_436_705 | 89 |
| 204 | 3300049589 | Ga0501073_0424115 | Ga0501073_0424115_599_868 | 89 |
| 205 | 3300049590 | Ga0501074_0673670 | Ga0501074_0673670_234_503 | 89 |
| 206 | 3300049590 | Ga0501074_0706996 | Ga0501074_0706996_334_603 | 89 |
| 207 | 3300049591 | Ga0501075_0192293 | Ga0501075_0192293_192_461 | 89 |
| 208 | 3300049592 | Ga0501076_0402508 | Ga0501076_0402508_166_435 | 89 |
| 209 | 3300049592 | Ga0501076_0775457 | Ga0501076_0775457_54_323 | 89 |
| 210 | 3300049741 | Ga0501079_0040600 | Ga0501079_0040600_2020_2289 | 89 |
| 211 | 3300049741 | Ga0501079_0881503 | Ga0501079_0881503_47_316 | 89 |
| 212 | 3300049742 | Ga0501080_0243446 | Ga0501080_0243446_830_1099 | 89 |
| 213 | 3300049743 | Ga0501081_0051492 | Ga0501081_0051492_418_687 | 89 |
| 214 | 3300049824 | Ga0501045_0084759 | Ga0501045_0084759_483_752 | 89 |
| 215 | 3300049824 | Ga0501045_0128366 | Ga0501045_0128366_643_912 | 89 |
| 216 | 3300050494 | nmdc:mga06z11_466321_c1 | nmdc:mga06z11_466321_c1_181_450 | 89 |
| 217 | 3300050495 | nmdc:mga04h51_87063_c1 | nmdc:mga04h51_87063_c1_278_547 | 89 |
| 218 | 3300050507 | nmdc:mga05p37_1068279_c1 | nmdc:mga05p37_1068279_c1_454_723 | 89 |
| 219 | 3300050507 | nmdc:mga05p37_120743_c1 | nmdc:mga05p37_120743_c1_1134_1403 | 89 |
| 220 | 3300050507 | nmdc:mga05p37_2169_c1 | nmdc:mga05p37_2169_c1_4634_4903 | 89 |
| 221 | 3300050508 | nmdc:mga09592_1412571_c1 | nmdc:mga09592_1412571_c1_115_384 | 89 |
| 222 | 3300050508 | nmdc:mga09592_77587_c1 | nmdc:mga09592_77587_c1_89_358 | 89 |
| 223 | 3300050509 | nmdc:mga0qj67_451238_c1 | nmdc:mga0qj67_451238_c1_379_648 | 89 |
| 224 | 3300050510 | nmdc:mga06r32_241870_c1 | nmdc:mga06r32_241870_c1_746_1015 | 89 |
| 225 | 3300050511 | nmdc:mga08y16_19188_c1 | nmdc:mga08y16_19188_c1_4501_4770 | 89 |
| 226 | 3300050512 | nmdc:mga0n895_127339_c1 | nmdc:mga0n895_127339_c1_404_673 | 89 |
| 227 | 3300050512 | nmdc:mga0n895_1843181_c1 | nmdc:mga0n895_1843181_c1_275_544 | 89 |
| 228 | 3300050515 | nmdc:mga0a205_65091_c1 | nmdc:mga0a205_65091_c1_440_709 | 89 |
| 229 | 3300053084 | Ga0495595_0400799 | Ga0495595_0400799_407_676 | 89 |
| 230 | 3300053094 | Ga0500566_0342628 | Ga0500566_0342628_27_296 | 89 |
| 231 | 3300053158 | Ga0500627_0353441 | Ga0500627_0353441_95_364 | 89 |
| 232 | 3300054114 | Ga0501084_0116139 | Ga0501084_0116139_1924_2193 | 89 |
| 233 | 3300060353 | Ga0501082_0270103 | Ga0501082_0270103_871_1140 | 89 |
| 234 | 3300060353 | Ga0501082_0430103 | Ga0501082_0430103_25_294 | 89 |
| 235 | 3300061734 | Ga0530510_0344118 | Ga0530510_0344118_386_655 | 89 |
| 236 | 3300061734 | Ga0530510_0728180 | Ga0530510_0728180_70_339 | 89 |
| 237 | 3300005293 | Ga0065715_10899858 | Ga0065715_108998581 | 90 |
| 238 | 3300005295 | Ga0065707_10156468 | Ga0065707_101564683 | 90 |
| 239 | 3300005295 | Ga0065707_10206834 | Ga0065707_102068342 | 90 |
| 240 | 3300005328 | Ga0070676_11085377 | Ga0070676_110853772 | 90 |
| 241 | 3300005329 | Ga0070683_100049491 | Ga0070683_1000494913 | 90 |
| 242 | 3300005335 | Ga0070666_10151881 | Ga0070666_101518812 | 90 |
| 243 | 3300005336 | Ga0070680_100115126 | Ga0070680_1001151262 | 90 |
| 244 | 3300005336 | Ga0070680_100313344 | Ga0070680_1003133443 | 90 |
| 245 | 3300005338 | Ga0068868_100132045 | Ga0068868_1001320453 | 90 |
| 246 | 3300005339 | Ga0070660_100096787 | Ga0070660_1000967875 | 90 |
| 247 | 3300005339 | Ga0070660_100678742 | Ga0070660_1006787423 | 90 |
| 248 | 3300005344 | Ga0070661_100555592 | Ga0070661_1005555923 | 90 |
| 249 | 3300005347 | Ga0070668_100136209 | Ga0070668_1001362094 | 90 |
| 250 | 3300005354 | Ga0070675_100120981 | Ga0070675_1001209815 | 90 |
| 251 | 3300005354 | Ga0070675_100447906 | Ga0070675_1004479062 | 90 |
| 252 | 3300005366 | Ga0070659_100354644 | Ga0070659_1003546442 | 90 |
| 253 | 3300005366 | Ga0070659_100852790 | Ga0070659_1008527902 | 90 |
| 254 | 3300005367 | Ga0070667_101631108 | Ga0070667_1016311082 | 90 |
| 255 | 3300005406 | Ga0070703_10262313 | Ga0070703_102623132 | 90 |
| 256 | 3300005434 | Ga0070709_10000030 | Ga0070709_1000003090 | 90 |
| 257 | 3300005436 | Ga0070713_101953962 | Ga0070713_1019539622 | 90 |
| 258 | 3300005438 | Ga0070701_10562916 | Ga0070701_105629162 | 90 |
| 259 | 3300005439 | Ga0070711_100635705 | Ga0070711_1006357053 | 90 |
| 260 | 3300005441 | Ga0070700_101261217 | Ga0070700_1012612172 | 90 |
| 261 | 3300005444 | Ga0070694_100026651 | Ga0070694_1000266518 | 90 |
| 262 | 3300005445 | Ga0070708_100391122 | Ga0070708_1003911222 | 90 |
| 263 | 3300005445 | Ga0070708_101076620 | Ga0070708_1010766203 | 90 |
| 264 | 3300005445 | Ga0070708_101740244 | Ga0070708_1017402442 | 90 |
| 265 | 3300005457 | Ga0070662_100918047 | Ga0070662_1009180472 | 90 |
| 266 | 3300005458 | Ga0070681_10108734 | Ga0070681_101087344 | 90 |
| 267 | 3300005459 | Ga0068867_100284598 | Ga0068867_1002845983 | 90 |
| 268 | 3300005467 | Ga0070706_100794605 | Ga0070706_1007946051 | 90 |
| 269 | 3300005468 | Ga0070707_100042572 | Ga0070707_1000425725 | 90 |
| 270 | 3300005468 | Ga0070707_100445459 | Ga0070707_1004454593 | 90 |
| 271 | 3300005471 | Ga0070698_100969499 | Ga0070698_1009694992 | 90 |
| 272 | 3300005471 | Ga0070698_101403925 | Ga0070698_1014039252 | 90 |
| 273 | 3300005471 | Ga0070698_101589628 | Ga0070698_1015896281 | 90 |
| 274 | 3300005471 | Ga0070698_101925390 | Ga0070698_1019253901 | 90 |
| 275 | 3300005518 | Ga0070699_100213951 | Ga0070699_1002139514 | 90 |
| 276 | 3300005518 | Ga0070699_100414444 | Ga0070699_1004144443 | 90 |
| 277 | 3300005535 | Ga0070684_101087786 | Ga0070684_1010877862 | 90 |
| 278 | 3300005539 | Ga0068853_100893042 | Ga0068853_1008930421 | 90 |
| 279 | 3300005543 | Ga0070672_101052520 | Ga0070672_1010525203 | 90 |
| 280 | 3300005544 | Ga0070686_100306156 | Ga0070686_1003061562 | 90 |
| 281 | 3300005545 | Ga0070695_100030293 | Ga0070695_1000302933 | 90 |
| 282 | 3300005548 | Ga0070665_100003124 | Ga0070665_10000312413 | 90 |
| 283 | 3300005549 | Ga0070704_100026555 | Ga0070704_1000265555 | 90 |
| 284 | 3300005549 | Ga0070704_100454385 | Ga0070704_1004543851 | 90 |
| 285 | 3300005549 | Ga0070704_100748560 | Ga0070704_1007485602 | 90 |
| 286 | 3300005549 | Ga0070704_101040332 | Ga0070704_1010403321 | 90 |
| 287 | 3300005549 | Ga0070704_101415269 | Ga0070704_1014152692 | 90 |
| 288 | 3300005563 | Ga0068855_100349814 | Ga0068855_1003498142 | 90 |
| 289 | 3300005577 | Ga0068857_102177956 | Ga0068857_1021779561 | 90 |
| 290 | 3300005578 | Ga0068854_100436159 | Ga0068854_1004361593 | 90 |
| 291 | 3300005616 | Ga0068852_100370472 | Ga0068852_1003704722 | 90 |
| 292 | 3300005617 | Ga0068859_101661398 | Ga0068859_1016613983 | 90 |
| 293 | 3300005618 | Ga0068864_100472692 | Ga0068864_1004726923 | 90 |
| 294 | 3300005718 | Ga0068866_10275486 | Ga0068866_102754863 | 90 |
| 295 | 3300005719 | Ga0068861_101350773 | Ga0068861_1013507732 | 90 |
| 296 | 3300005840 | Ga0068870_11205810 | Ga0068870_112058102 | 90 |
| 297 | 3300005841 | Ga0068863_100120412 | Ga0068863_1001204123 | 90 |
| 298 | 3300005841 | Ga0068863_100665493 | Ga0068863_1006654933 | 90 |
| 299 | 3300005842 | Ga0068858_100111150 | Ga0068858_1001111505 | 90 |
| 300 | 3300005842 | Ga0068858_100198644 | Ga0068858_1001986444 | 90 |
| 301 | 3300005842 | Ga0068858_102074291 | Ga0068858_1020742911 | 90 |
| 302 | 3300005843 | Ga0068860_100410375 | Ga0068860_1004103752 | 90 |
| 303 | 3300005843 | Ga0068860_100776060 | Ga0068860_1007760602 | 90 |
| 304 | 3300006042 | Ga0075368_10053538 | Ga0075368_100535383 | 90 |
| 305 | 3300006051 | Ga0075364_10004066 | Ga0075364_100040664 | 90 |
| 306 | 3300006051 | Ga0075364_10005645 | Ga0075364_100056453 | 90 |
| 307 | 3300006163 | Ga0070715_10330220 | Ga0070715_103302202 | 90 |
| 308 | 3300006173 | Ga0070716_100353031 | Ga0070716_1003530312 | 90 |
| 309 | 3300006175 | Ga0070712_101254403 | Ga0070712_1012544031 | 90 |
| 310 | 3300006177 | Ga0075362_10105944 | Ga0075362_101059444 | 90 |
| 311 | 3300006178 | Ga0075367_10033063 | Ga0075367_100330635 | 90 |
| 312 | 3300006178 | Ga0075367_10832755 | Ga0075367_108327552 | 90 |
| 313 | 3300006195 | Ga0075366_10000965 | Ga0075366_100009658 | 90 |
| 314 | 3300006195 | Ga0075366_10470540 | Ga0075366_104705402 | 90 |
| 315 | 3300006358 | Ga0068871_100260003 | Ga0068871_1002600033 | 90 |
| 316 | 3300006844 | Ga0075428_100016928 | Ga0075428_1000169288 | 90 |
| 317 | 3300006847 | Ga0075431_100542748 | Ga0075431_1005427483 | 90 |
| 318 | 3300006852 | Ga0075433_10029945 | Ga0075433_100299455 | 90 |
| 319 | 3300006852 | Ga0075433_10303106 | Ga0075433_103031062 | 90 |
| 320 | 3300006852 | Ga0075433_10316256 | Ga0075433_103162564 | 90 |
| 321 | 3300006852 | Ga0075433_10324656 | Ga0075433_103246563 | 90 |
| 322 | 3300006852 | Ga0075433_10914947 | Ga0075433_109149473 | 90 |
| 323 | 3300006871 | Ga0075434_100000049 | Ga0075434_10000004946 | 90 |
| 324 | 3300006871 | Ga0075434_100082014 | Ga0075434_1000820144 | 90 |
| 325 | 3300006871 | Ga0075434_100119475 | Ga0075434_1001194754 | 90 |
| 326 | 3300006871 | Ga0075434_100321389 | Ga0075434_1003213893 | 90 |
| 327 | 3300006881 | Ga0068865_100726241 | Ga0068865_1007262412 | 90 |
| 328 | 3300006914 | Ga0075436_100000420 | Ga0075436_10000042013 | 90 |
| 329 | 3300006914 | Ga0075436_100018228 | Ga0075436_1000182289 | 90 |
| 330 | 3300006931 | Ga0097620_101661263 | Ga0097620_1016612631 | 90 |
| 331 | 3300007076 | Ga0075435_100000059 | Ga0075435_10000005944 | 90 |
| 332 | 3300007076 | Ga0075435_100005562 | Ga0075435_1000055623 | 90 |
| 333 | 3300007076 | Ga0075435_100655502 | Ga0075435_1006555021 | 90 |
| 334 | 3300007265 | Ga0099794_10289498 | Ga0099794_102894983 | 90 |
| 335 | 3300009093 | Ga0105240_10059564 | Ga0105240_100595643 | 90 |
| 336 | 3300009094 | Ga0111539_10007363 | Ga0111539_100073638 | 90 |
| 337 | 3300009094 | Ga0111539_10058785 | Ga0111539_100587852 | 90 |
| 338 | 3300009094 | Ga0111539_10862413 | Ga0111539_108624131 | 90 |
| 339 | 3300009098 | Ga0105245_10130030 | Ga0105245_101300302 | 90 |
| 340 | 3300009098 | Ga0105245_10831831 | Ga0105245_108318312 | 90 |
| 341 | 3300009101 | Ga0105247_10301812 | Ga0105247_103018121 | 90 |
| 342 | 3300009147 | Ga0114129_10002862 | Ga0114129_1000286213 | 90 |
| 343 | 3300009147 | Ga0114129_10007233 | Ga0114129_1000723317 | 90 |
| 344 | 3300009147 | Ga0114129_10031782 | Ga0114129_100317829 | 90 |
| 345 | 3300009147 | Ga0114129_10042536 | Ga0114129_100425367 | 90 |
| 346 | 3300009147 | Ga0114129_10118287 | Ga0114129_101182874 | 90 |
| 347 | 3300009147 | Ga0114129_10679701 | Ga0114129_106797013 | 90 |
| 348 | 3300009147 | Ga0114129_11259235 | Ga0114129_112592352 | 90 |
| 349 | 3300009148 | Ga0105243_10714254 | Ga0105243_107142542 | 90 |
| 350 | 3300009148 | Ga0105243_12907880 | Ga0105243_129078802 | 90 |
| 351 | 3300009174 | Ga0105241_12676991 | Ga0105241_126769911 | 90 |
| 352 | 3300009176 | Ga0105242_10027323 | Ga0105242_100273234 | 90 |
| 353 | 3300009177 | Ga0105248_10074545 | Ga0105248_100745454 | 90 |
| 354 | 3300009545 | Ga0105237_11495129 | Ga0105237_114951292 | 90 |
| 355 | 3300009553 | Ga0105249_10352906 | Ga0105249_103529062 | 90 |
| 356 | 3300010375 | Ga0105239_10213422 | Ga0105239_102134225 | 90 |
| 357 | 3300013105 | Ga0157369_10085696 | Ga0157369_100856965 | 90 |
| 358 | 3300013105 | Ga0157369_10753118 | Ga0157369_107531183 | 90 |
| 359 | 3300013296 | Ga0157374_10217678 | Ga0157374_102176782 | 90 |
| 360 | 3300013306 | Ga0163162_10414620 | Ga0163162_104146201 | 90 |
| 361 | 3300013307 | Ga0157372_10225441 | Ga0157372_102254413 | 90 |
| 362 | 3300013307 | Ga0157372_11733313 | Ga0157372_117333132 | 90 |
| 363 | 3300013308 | Ga0157375_10687700 | Ga0157375_106877003 | 90 |
| 364 | 3300013308 | Ga0157375_11710957 | Ga0157375_117109573 | 90 |
| 365 | 3300014325 | Ga0163163_11328506 | Ga0163163_113285062 | 90 |
| 366 | 3300014325 | Ga0163163_11849043 | Ga0163163_118490431 | 90 |
| 367 | 3300014326 | Ga0157380_10008213 | Ga0157380_1000821310 | 90 |
| 368 | 3300014326 | Ga0157380_10379442 | Ga0157380_103794423 | 90 |
| 369 | 3300014968 | Ga0157379_10004956 | Ga0157379_100049569 | 90 |
| 370 | 3300014968 | Ga0157379_11522138 | Ga0157379_115221382 | 90 |
| 371 | 3300014969 | Ga0157376_10038389 | Ga0157376_100383892 | 90 |
| 372 | 3300014969 | Ga0157376_10497805 | Ga0157376_104978052 | 90 |
| 373 | 3300020070 | Ga0206356_11405878 | Ga0206356_114058782 | 90 |
| 374 | 3300020081 | Ga0206354_11444070 | Ga0206354_114440702 | 90 |
| 375 | 3300021384 | Ga0213876_10119947 | Ga0213876_101199474 | 90 |
| 376 | 3300025315 | Ga0207697_10360959 | Ga0207697_103609591 | 90 |
| 377 | 3300025899 | Ga0207642_10133257 | Ga0207642_101332572 | 90 |
| 378 | 3300025900 | Ga0207710_10151819 | Ga0207710_101518193 | 90 |
| 379 | 3300025901 | Ga0207688_10175809 | Ga0207688_101758092 | 90 |
| 380 | 3300025903 | Ga0207680_10042035 | Ga0207680_100420354 | 90 |
| 381 | 3300025906 | Ga0207699_10000001 | Ga0207699_10000001432 | 90 |
| 382 | 3300025910 | Ga0207684_10364960 | Ga0207684_103649603 | 90 |
| 383 | 3300025911 | Ga0207654_10543230 | Ga0207654_105432302 | 90 |
| 384 | 3300025912 | Ga0207707_10561950 | Ga0207707_105619503 | 90 |
| 385 | 3300025912 | Ga0207707_10859476 | Ga0207707_108594763 | 90 |
| 386 | 3300025912 | Ga0207707_11113714 | Ga0207707_111137141 | 90 |
| 387 | 3300025913 | Ga0207695_10223593 | Ga0207695_102235933 | 90 |
| 388 | 3300025914 | Ga0207671_10941099 | Ga0207671_109410992 | 90 |
| 389 | 3300025917 | Ga0207660_10291109 | Ga0207660_102911093 | 90 |
| 390 | 3300025917 | Ga0207660_10531764 | Ga0207660_105317642 | 90 |
| 391 | 3300025917 | Ga0207660_10638366 | Ga0207660_106383663 | 90 |
| 392 | 3300025919 | Ga0207657_10201517 | Ga0207657_102015174 | 90 |
| 393 | 3300025919 | Ga0207657_10513034 | Ga0207657_105130343 | 90 |
| 394 | 3300025920 | Ga0207649_10304409 | Ga0207649_103044092 | 90 |
| 395 | 3300025921 | Ga0207652_11382740 | Ga0207652_113827402 | 90 |
| 396 | 3300025922 | Ga0207646_10009032 | Ga0207646_100090326 | 90 |
| 397 | 3300025922 | Ga0207646_10606232 | Ga0207646_106062322 | 90 |
| 398 | 3300025923 | Ga0207681_10242894 | Ga0207681_102428943 | 90 |
| 399 | 3300025927 | Ga0207687_10101465 | Ga0207687_101014655 | 90 |
| 400 | 3300025927 | Ga0207687_10534569 | Ga0207687_105345692 | 90 |
| 401 | 3300025932 | Ga0207690_10254468 | Ga0207690_102544684 | 90 |
| 402 | 3300025932 | Ga0207690_10736624 | Ga0207690_107366241 | 90 |
| 403 | 3300025933 | Ga0207706_10266250 | Ga0207706_102662503 | 90 |
| 404 | 3300025934 | Ga0207686_10093220 | Ga0207686_100932204 | 90 |
| 405 | 3300025935 | Ga0207709_10547611 | Ga0207709_105476112 | 90 |
| 406 | 3300025938 | Ga0207704_10197207 | Ga0207704_101972074 | 90 |
| 407 | 3300025940 | Ga0207691_11519876 | Ga0207691_115198761 | 90 |
| 408 | 3300025940 | Ga0207691_11520435 | Ga0207691_115204352 | 90 |
| 409 | 3300025941 | Ga0207711_10053178 | Ga0207711_100531783 | 90 |
| 410 | 3300025941 | Ga0207711_11195400 | Ga0207711_111954002 | 90 |
| 411 | 3300025944 | Ga0207661_10012308 | Ga0207661_100123085 | 90 |
| 412 | 3300025961 | Ga0207712_11605380 | Ga0207712_116053802 | 90 |
| 413 | 3300025981 | Ga0207640_11929341 | Ga0207640_119293412 | 90 |
| 414 | 3300025986 | Ga0207658_10534881 | Ga0207658_105348812 | 90 |
| 415 | 3300026023 | Ga0207677_10100110 | Ga0207677_101001104 | 90 |
| 416 | 3300026035 | Ga0207703_10045825 | Ga0207703_100458256 | 90 |
| 417 | 3300026035 | Ga0207703_11809146 | Ga0207703_118091462 | 90 |
| 418 | 3300026075 | Ga0207708_10449780 | Ga0207708_104497802 | 90 |
| 419 | 3300026078 | Ga0207702_10171726 | Ga0207702_101717261 | 90 |
| 420 | 3300026088 | Ga0207641_10246594 | Ga0207641_102465943 | 90 |
| 421 | 3300026088 | Ga0207641_10356163 | Ga0207641_103561632 | 90 |
| 422 | 3300026089 | Ga0207648_10355543 | Ga0207648_103555432 | 90 |
| 423 | 3300026095 | Ga0207676_10685769 | Ga0207676_106857692 | 90 |
| 424 | 3300026118 | Ga0207675_100811509 | Ga0207675_1008115092 | 90 |
| 425 | 3300026142 | Ga0207698_10729039 | Ga0207698_107290392 | 90 |
| 426 | 3300027866 | Ga0209813_10085216 | Ga0209813_100852163 | 90 |
| 427 | 3300027907 | Ga0207428_10190627 | Ga0207428_101906271 | 90 |
| 428 | 3300027907 | Ga0207428_10574573 | Ga0207428_105745733 | 90 |
| 429 | 3300027907 | Ga0207428_11119984 | Ga0207428_111199842 | 90 |
| 430 | 3300028379 | Ga0268266_10015800 | Ga0268266_100158002 | 90 |
| 431 | 3300028380 | Ga0268265_12449760 | Ga0268265_124497601 | 90 |
| 432 | 3300028381 | Ga0268264_10387130 | Ga0268264_103871302 | 90 |
| 433 | 3300028381 | Ga0268264_11025379 | Ga0268264_110253792 | 90 |
| 434 | 3300032002 | Ga0307416_101660332 | Ga0307416_1016603322 | 90 |
| 435 | 3300035410 | Ga0373924_0050038 | Ga0373924_0050038_583_855 | 90 |
| 436 | 3300035692 | Ga0373935_0881194 | Ga0373935_0881194_154_426 | 90 |
| 437 | 3300037068 | Ga0373925_1133548 | Ga0373925_1133548_299_571 | 90 |
| 438 | 3300039437 | Ga0436365_0113116 | Ga0436365_0113116_1048_1320 | 90 |
| 439 | 3300041512 | Ga0451853_0056793 | Ga0451853_0056793_441_713 | 90 |
| 440 | 3300041512 | Ga0451853_3602046 | Ga0451853_3602046_215_487 | 90 |
| 441 | 3300042876 | Ga0451577_0872012 | Ga0451577_0872012_25_300 | 90 |
| 442 | 3300044706 | Ga0466964_0548184 | Ga0466964_0548184_163_435 | 90 |
| 443 | 3300044712 | Ga0453684_1657409 | Ga0453684_1657409_290_565 | 90 |
| 444 | 3300045051 | Ga0451576_1267853 | Ga0451576_1267853_456_728 | 90 |
| 445 | 3300045051 | Ga0451576_2746805 | Ga0451576_2746805_71_343 | 90 |
| 446 | 3300045976 | Ga0466967_0212063 | Ga0466967_0212063_56_328 | 90 |
| 447 | 3300046459 | Ga0495629_0165632 | Ga0495629_0165632_507_779 | 90 |
| 448 | 3300046460 | Ga0495638_0003582 | Ga0495638_0003582_1324_1596 | 90 |
| 449 | 3300046475 | Ga0495639_0163388 | Ga0495639_0163388_347_619 | 90 |
| 450 | 3300046476 | Ga0495662_0644877 | Ga0495662_0644877_205_477 | 90 |
| 451 | 3300046477 | Ga0495664_0869783 | Ga0495664_0869783_198_470 | 90 |
| 452 | 3300046499 | Ga0495594_0235853 | Ga0495594_0235853_333_605 | 90 |
| 453 | 3300046501 | Ga0495607_0382971 | Ga0495607_0382971_310_582 | 90 |
| 454 | 3300046533 | Ga0495640_0603174 | Ga0495640_0603174_296_568 | 90 |
| 455 | 3300046539 | Ga0495621_0190859 | Ga0495621_0190859_522_794 | 90 |
| 456 | 3300046559 | Ga0495667_0248713 | Ga0495667_0248713_624_896 | 90 |
| 457 | 3300046663 | Ga0495635_0410209 | Ga0495635_0410209_606_878 | 90 |
| 458 | 3300046678 | Ga0495599_0060880 | Ga0495599_0060880_1905_2177 | 90 |
| 459 | 3300046678 | Ga0495599_0133559 | Ga0495599_0133559_1114_1386 | 90 |
| 460 | 3300046681 | Ga0495647_0097366 | Ga0495647_0097366_654_926 | 90 |
| 461 | 3300046683 | Ga0495658_0064656 | Ga0495658_0064656_741_1013 | 90 |
| 462 | 3300046809 | Ga0495600_0701534 | Ga0495600_0701534_189_461 | 90 |
| 463 | 3300047322 | Ga0495680_0334340 | Ga0495680_0334340_532_804 | 90 |
| 464 | 3300048907 | Ga0496104_0146666 | Ga0496104_0146666_1831_2103 | 90 |
| 465 | 3300048917 | Ga0496114_0187739 | Ga0496114_0187739_55_327 | 90 |
| 466 | 3300048918 | Ga0496115_0028623 | Ga0496115_0028623_1562_1834 | 90 |
| 467 | 3300049571 | Ga0501034_0006113 | Ga0501034_0006113_1938_2210 | 90 |
| 468 | 3300049574 | Ga0501038_0516592 | Ga0501038_0516592_570_842 | 90 |
| 469 | 3300049576 | Ga0501040_0428012 | Ga0501040_0428012_574_846 | 90 |
| 470 | 3300049576 | Ga0501040_0974943 | Ga0501040_0974943_77_349 | 90 |
| 471 | 3300049583 | Ga0501067_0379039 | Ga0501067_0379039_458_730 | 90 |
| 472 | 3300049585 | Ga0501069_0895520 | Ga0501069_0895520_116_388 | 90 |
| 473 | 3300049585 | Ga0501069_0957346 | Ga0501069_0957346_14_286 | 90 |
| 474 | 3300049587 | Ga0501071_0823465 | Ga0501071_0823465_410_682 | 90 |
| 475 | 3300049588 | Ga0501072_0850195 | Ga0501072_0850195_64_336 | 90 |
| 476 | 3300049590 | Ga0501074_0162251 | Ga0501074_0162251_886_1158 | 90 |
| 477 | 3300049590 | Ga0501074_0684422 | Ga0501074_0684422_50_322 | 90 |
| 478 | 3300049591 | Ga0501075_0104298 | Ga0501075_0104298_906_1178 | 90 |
| 479 | 3300049592 | Ga0501076_0306645 | Ga0501076_0306645_991_1263 | 90 |
| 480 | 3300049592 | Ga0501076_0323568 | Ga0501076_0323568_974_1246 | 90 |
| 481 | 3300049593 | Ga0501077_0184000 | Ga0501077_0184000_571_843 | 90 |
| 482 | 3300049741 | Ga0501079_0035909 | Ga0501079_0035909_2627_2899 | 90 |
| 483 | 3300049742 | Ga0501080_0287010 | Ga0501080_0287010_710_982 | 90 |
| 484 | 3300049743 | Ga0501081_0843868 | Ga0501081_0843868_377_649 | 90 |
| 485 | 3300049824 | Ga0501045_1085318 | Ga0501045_1085318_95_367 | 90 |
| 486 | 3300050489 | nmdc:mga03683_11941_c1 | nmdc:mga03683_11941_c1_410_682 | 90 |
| 487 | 3300050489 | nmdc:mga03683_383738_c1 | nmdc:mga03683_383738_c1_44_316 | 90 |
| 488 | 3300050491 | nmdc:mga00v17_581074_c1 | nmdc:mga00v17_581074_c1_364_636 | 90 |
| 489 | 3300050491 | nmdc:mga00v17_59698_c1 | nmdc:mga00v17_59698_c1_1195_1467 | 90 |
| 490 | 3300050492 | nmdc:mga0yw44_78290_c1 | nmdc:mga0yw44_78290_c1_1559_1831 | 90 |
| 491 | 3300050493 | nmdc:mga0k408_290120_c1 | nmdc:mga0k408_290120_c1_615_887 | 90 |
| 492 | 3300050493 | nmdc:mga0k408_6905_c1 | nmdc:mga0k408_6905_c1_3973_4245 | 90 |
| 493 | 3300050494 | nmdc:mga06z11_18241_c1 | nmdc:mga06z11_18241_c1_69_341 | 90 |
| 494 | 3300050494 | nmdc:mga06z11_294816_c1 | nmdc:mga06z11_294816_c1_584_856 | 90 |
| 495 | 3300050494 | nmdc:mga06z11_88085_c1 | nmdc:mga06z11_88085_c1_519_791 | 90 |
| 496 | 3300050495 | nmdc:mga04h51_72200_c1 | nmdc:mga04h51_72200_c1_664_936 | 90 |
| 497 | 3300050507 | nmdc:mga05p37_1678819_c1 | nmdc:mga05p37_1678819_c1_78_350 | 90 |
| 498 | 3300050507 | nmdc:mga05p37_30866_c1 | nmdc:mga05p37_30866_c1_960_1232 | 90 |
| 499 | 3300050507 | nmdc:mga05p37_41627_c1 | nmdc:mga05p37_41627_c1_4153_4425 | 90 |
| 500 | 3300050507 | nmdc:mga05p37_494868_c1 | nmdc:mga05p37_494868_c1_1116_1388 | 90 |
| 501 | 3300050507 | nmdc:mga05p37_582884_c1 | nmdc:mga05p37_582884_c1_284_559 | 90 |
| 502 | 3300050507 | nmdc:mga05p37_6745_c1 | nmdc:mga05p37_6745_c1_7697_7969 | 90 |
| 503 | 3300050507 | nmdc:mga05p37_89734_c1 | nmdc:mga05p37_89734_c1_315_587 | 90 |
| 504 | 3300050508 | nmdc:mga09592_1525523_c1 | nmdc:mga09592_1525523_c1_169_441 | 90 |
| 505 | 3300050510 | nmdc:mga06r32_521401_c1 | nmdc:mga06r32_521401_c1_147_419 | 90 |
| 506 | 3300050511 | nmdc:mga08y16_403451_c1 | nmdc:mga08y16_403451_c1_290_562 | 90 |
| 507 | 3300050511 | nmdc:mga08y16_533867_c1 | nmdc:mga08y16_533867_c1_576_851 | 90 |
| 508 | 3300050511 | nmdc:mga08y16_657189_c1 | nmdc:mga08y16_657189_c1_723_995 | 90 |
| 509 | 3300050512 | nmdc:mga0n895_152513_c1 | nmdc:mga0n895_152513_c1_915_1190 | 90 |
| 510 | 3300050512 | nmdc:mga0n895_186941_c1 | nmdc:mga0n895_186941_c1_1508_1780 | 90 |
| 511 | 3300050512 | nmdc:mga0n895_805045_c1 | nmdc:mga0n895_805045_c1_173_445 | 90 |
| 512 | 3300050512 | nmdc:mga0n895_95_c1 | nmdc:mga0n895_95_c1_9659_9931 | 90 |
| 513 | 3300050513 | nmdc:mga0rr50_165429_c1 | nmdc:mga0rr50_165429_c1_1393_1665 | 90 |
| 514 | 3300050513 | nmdc:mga0rr50_17771_c1 | nmdc:mga0rr50_17771_c1_4110_4382 | 90 |
| 515 | 3300050513 | nmdc:mga0rr50_28_c1 | nmdc:mga0rr50_28_c1_50409_50681 | 90 |
| 516 | 3300050513 | nmdc:mga0rr50_706771_c1 | nmdc:mga0rr50_706771_c1_52_327 | 90 |
| 517 | 3300050514 | nmdc:mga08x19_121_c1 | nmdc:mga08x19_121_c1_30197_30469 | 90 |
| 518 | 3300050514 | nmdc:mga08x19_318640_c1 | nmdc:mga08x19_318640_c1_711_983 | 90 |
| 519 | 3300050515 | nmdc:mga0a205_160653_c1 | nmdc:mga0a205_160653_c1_1217_1492 | 90 |
| 520 | 3300050515 | nmdc:mga0a205_275666_c1 | nmdc:mga0a205_275666_c1_885_1157 | 90 |
| 521 | 3300050515 | nmdc:mga0a205_328334_c1 | nmdc:mga0a205_328334_c1_883_1155 | 90 |
| 522 | 3300050515 | nmdc:mga0a205_809171_c1 | nmdc:mga0a205_809171_c1_29_301 | 90 |
| 523 | 3300053084 | Ga0495595_0300677 | Ga0495595_0300677_344_616 | 90 |
| 524 | 3300054114 | Ga0501084_0980842 | Ga0501084_0980842_49_321 | 90 |
| 525 | 3300005290 | Ga0065712_10570827 | Ga0065712_105708272 | 91 |
| 526 | 3300005333 | Ga0070677_10610927 | Ga0070677_106109271 | 91 |
| 527 | 3300005335 | Ga0070666_10032233 | Ga0070666_100322335 | 91 |
| 528 | 3300005355 | Ga0070671_101636265 | Ga0070671_1016362651 | 91 |
| 529 | 3300005356 | Ga0070674_100358939 | Ga0070674_1003589393 | 91 |
| 530 | 3300005455 | Ga0070663_100390052 | Ga0070663_1003900523 | 91 |
| 531 | 3300005457 | Ga0070662_101320005 | Ga0070662_1013200052 | 91 |
| 532 | 3300005459 | Ga0068867_100973207 | Ga0068867_1009732071 | 91 |
| 533 | 3300005535 | Ga0070684_101177090 | Ga0070684_1011770901 | 91 |
| 534 | 3300005544 | Ga0070686_101965881 | Ga0070686_1019658811 | 91 |
| 535 | 3300005546 | Ga0070696_100043573 | Ga0070696_1000435734 | 91 |
| 536 | 3300005548 | Ga0070665_100092857 | Ga0070665_1000928573 | 91 |
| 537 | 3300005548 | Ga0070665_101085551 | Ga0070665_1010855512 | 91 |
| 538 | 3300005718 | Ga0068866_10051426 | Ga0068866_100514264 | 91 |
| 539 | 3300005985 | Ga0081539_10000025 | Ga0081539_1000002534 | 91 |
| 540 | 3300006178 | Ga0075367_10501167 | Ga0075367_105011673 | 91 |
| 541 | 3300006237 | Ga0097621_101178629 | Ga0097621_1011786291 | 91 |
| 542 | 3300006844 | Ga0075428_100335992 | Ga0075428_1003359923 | 91 |
| 543 | 3300006847 | Ga0075431_100014795 | Ga0075431_1000147953 | 91 |
| 544 | 3300006847 | Ga0075431_102175835 | Ga0075431_1021758351 | 91 |
| 545 | 3300006847 | Ga0075431_102215036 | Ga0075431_1022150362 | 91 |
| 546 | 3300006946 | Ga0079104_1000103 | Ga0079104_100010394 | 91 |
| 547 | 3300007076 | Ga0075435_100335604 | Ga0075435_1003356042 | 91 |
| 548 | 3300009098 | Ga0105245_10794793 | Ga0105245_107947933 | 91 |
| 549 | 3300009147 | Ga0114129_10007233 | Ga0114129_1000723315 | 91 |
| 550 | 3300009147 | Ga0114129_10339813 | Ga0114129_103398132 | 91 |
| 551 | 3300009174 | Ga0105241_11413370 | Ga0105241_114133701 | 91 |
| 552 | 3300009176 | Ga0105242_10690648 | Ga0105242_106906482 | 91 |
| 553 | 3300009176 | Ga0105242_11465541 | Ga0105242_114655412 | 91 |
| 554 | 3300009553 | Ga0105249_12436284 | Ga0105249_124362842 | 91 |
| 555 | 3300013297 | Ga0157378_10155036 | Ga0157378_101550363 | 91 |
| 556 | 3300021388 | Ga0213875_10000043 | Ga0213875_1000004323 | 91 |
| 557 | 3300025899 | Ga0207642_10167053 | Ga0207642_101670532 | 91 |
| 558 | 3300025925 | Ga0207650_10363099 | Ga0207650_103630994 | 91 |
| 559 | 3300025933 | Ga0207706_10822047 | Ga0207706_108220472 | 91 |
| 560 | 3300025934 | Ga0207686_11565148 | Ga0207686_115651482 | 91 |
| 561 | 3300025937 | Ga0207669_10319149 | Ga0207669_103191493 | 91 |
| 562 | 3300025939 | Ga0207665_11675220 | Ga0207665_116752201 | 91 |
| 563 | 3300025981 | Ga0207640_11810564 | Ga0207640_118105642 | 91 |
| 564 | 3300026067 | Ga0207678_10402467 | Ga0207678_104024673 | 91 |
| 565 | 3300026089 | Ga0207648_10878831 | Ga0207648_108788313 | 91 |
| 566 | 3300027111 | Ga0209281_1000512 | Ga0209281_100051216 | 91 |
| 567 | 3300027717 | Ga0209998_10071622 | Ga0209998_100716223 | 91 |
| 568 | 3300028379 | Ga0268266_10165303 | Ga0268266_101653032 | 91 |
| 569 | 3300028379 | Ga0268266_10801061 | Ga0268266_108010612 | 91 |
| 570 | 3300031456 | Ga0307513_10213788 | Ga0307513_102137883 | 91 |
| 571 | 3300031852 | Ga0307410_10458030 | Ga0307410_104580303 | 91 |
| 572 | 3300031852 | Ga0307410_12101196 | Ga0307410_121011962 | 91 |
| 573 | 3300031911 | Ga0307412_10111430 | Ga0307412_101114302 | 91 |
| 574 | 3300031911 | Ga0307412_11145685 | Ga0307412_111456852 | 91 |
| 575 | 3300031995 | Ga0307409_100254717 | Ga0307409_1002547175 | 91 |
| 576 | 3300032002 | Ga0307416_100445454 | Ga0307416_1004454543 | 91 |
| 577 | 3300032002 | Ga0307416_101056563 | Ga0307416_1010565631 | 91 |
| 578 | 3300032002 | Ga0307416_101423735 | Ga0307416_1014237352 | 91 |
| 579 | 3300032002 | Ga0307416_101886309 | Ga0307416_1018863093 | 91 |
| 580 | 3300032005 | Ga0307411_10465514 | Ga0307411_104655142 | 91 |
| 581 | 3300035241 | Ga0373961_0438960 | Ga0373961_0438960_37_315 | 91 |
| 582 | 3300037853 | Ga0436364_0413139 | Ga0436364_0413139_230621_230905 | 91 |
| 583 | 3300041997 | Ga0439431_0091320 | Ga0439431_0091320_523_798 | 91 |
| 584 | 3300042156 | Ga0439446_0245403 | Ga0439446_0245403_69_347 | 91 |
| 585 | 3300045051 | Ga0451576_0280843 | Ga0451576_0280843_484_759 | 91 |
| 586 | 3300045051 | Ga0451576_0548805 | Ga0451576_0548805_637_927 | 91 |
| 587 | 3300046558 | Ga0495633_0155189 | Ga0495633_0155189_126_401 | 91 |
| 588 | 3300046648 | Ga0495611_0418074 | Ga0495611_0418074_312_587 | 91 |
| 589 | 3300048904 | Ga0496101_1261968 | Ga0496101_1261968_229_504 | 91 |
| 590 | 3300048905 | Ga0496102_0702480 | Ga0496102_0702480_89_364 | 91 |
| 591 | 3300048912 | Ga0496109_0142700 | Ga0496109_0142700_1181_1456 | 91 |
| 592 | 3300048915 | Ga0496112_0158836 | Ga0496112_0158836_1239_1514 | 91 |
| 593 | 3300048924 | Ga0496121_0017161 | Ga0496121_0017161_5048_5341 | 91 |
| 594 | 3300048927 | Ga0496124_0017108 | Ga0496124_0017108_2156_2449 | 91 |
| 595 | 3300049568 | Ga0501031_0108509 | Ga0501031_0108509_350_628 | 91 |
| 596 | 3300049572 | Ga0501036_0395912 | Ga0501036_0395912_390_668 | 91 |
| 597 | 3300049575 | Ga0501039_0059409 | Ga0501039_0059409_459_737 | 91 |
| 598 | 3300049576 | Ga0501040_0348611 | Ga0501040_0348611_466_744 | 91 |
| 599 | 3300049576 | Ga0501040_0878674 | Ga0501040_0878674_116_394 | 91 |
| 600 | 3300049577 | Ga0501041_0602352 | Ga0501041_0602352_371_649 | 91 |
| 601 | 3300049580 | Ga0501046_0187403 | Ga0501046_0187403_46_324 | 91 |
| 602 | 3300049580 | Ga0501046_0654524 | Ga0501046_0654524_335_610 | 91 |
| 603 | 3300049582 | Ga0501048_0054902 | Ga0501048_0054902_2431_2709 | 91 |
| 604 | 3300049582 | Ga0501048_0110951 | Ga0501048_0110951_166_447 | 91 |
| 605 | 3300049584 | Ga0501068_0437674 | Ga0501068_0437674_200_478 | 91 |
| 606 | 3300049587 | Ga0501071_0035635 | Ga0501071_0035635_740_1018 | 91 |
| 607 | 3300049588 | Ga0501072_0347587 | Ga0501072_0347587_392_670 | 91 |
| 608 | 3300049588 | Ga0501072_0529226 | Ga0501072_0529226_542_817 | 91 |
| 609 | 3300049588 | Ga0501072_0611824 | Ga0501072_0611824_489_767 | 91 |
| 610 | 3300049588 | Ga0501072_0915201 | Ga0501072_0915201_18_296 | 91 |
| 611 | 3300049589 | Ga0501073_0548171 | Ga0501073_0548171_437_715 | 91 |
| 612 | 3300049591 | Ga0501075_0037021 | Ga0501075_0037021_2762_3040 | 91 |
| 613 | 3300049591 | Ga0501075_0183380 | Ga0501075_0183380_498_776 | 91 |
| 614 | 3300049592 | Ga0501076_0056689 | Ga0501076_0056689_2499_2777 | 91 |
| 615 | 3300049592 | Ga0501076_1156952 | Ga0501076_1156952_172_447 | 91 |
| 616 | 3300049593 | Ga0501077_0086806 | Ga0501077_0086806_1402_1680 | 91 |
| 617 | 3300049741 | Ga0501079_0054982 | Ga0501079_0054982_223_501 | 91 |
| 618 | 3300049743 | Ga0501081_0063454 | Ga0501081_0063454_1036_1314 | 91 |
| 619 | 3300049743 | Ga0501081_0341504 | Ga0501081_0341504_95_373 | 91 |
| 620 | 3300049822 | Ga0501035_0104196 | Ga0501035_0104196_647_925 | 91 |
| 621 | 3300049824 | Ga0501045_0037298 | Ga0501045_0037298_573_851 | 91 |
| 622 | 3300049824 | Ga0501045_0520873 | Ga0501045_0520873_205_483 | 91 |
| 623 | 3300050491 | nmdc:mga00v17_791888_c1 | nmdc:mga00v17_791888_c1_260_550 | 91 |
| 624 | 3300050507 | nmdc:mga05p37_41627_c1 | nmdc:mga05p37_41627_c1_3605_3880 | 91 |
| 625 | 3300050510 | nmdc:mga06r32_1242647_c1 | nmdc:mga06r32_1242647_c1_169_447 | 91 |
| 626 | 3300050510 | nmdc:mga06r32_1384744_c1 | nmdc:mga06r32_1384744_c1_228_518 | 91 |
| 627 | 3300050510 | nmdc:mga06r32_36771_c1 | nmdc:mga06r32_36771_c1_4340_4615 | 91 |
| 628 | 3300050513 | nmdc:mga0rr50_165429_c1 | nmdc:mga0rr50_165429_c1_845_1120 | 91 |
| 629 | 3300050515 | nmdc:mga0a205_111836_c1 | nmdc:mga0a205_111836_c1_1821_2102 | 91 |
| 630 | 3300053116 | Ga0500592_049854 | Ga0500592_049854_262_543 | 91 |
| 631 | 3300053125 | Ga0500618_000025 | Ga0500618_000025_24912_25205 | 91 |
| 632 | 3300054114 | Ga0501084_0855243 | Ga0501084_0855243_376_654 | 91 |
| 633 | 3300054114 | Ga0501084_1429638 | Ga0501084_1429638_89_364 | 91 |
| 634 | 3300060353 | Ga0501082_0047449 | Ga0501082_0047449_729_1007 | 91 |
| 635 | 3300061734 | Ga0530510_0243740 | Ga0530510_0243740_497_775 | 91 |
| 636 | 3300061734 | Ga0530510_0736926 | Ga0530510_0736926_303_578 | 91 |
| 637 | 3300005288 | Ga0065714_10191579 | Ga0065714_101915792 | 92 |
| 638 | 3300005290 | Ga0065712_10334447 | Ga0065712_103344472 | 92 |
| 639 | 3300005293 | Ga0065715_10822905 | Ga0065715_108229051 | 92 |
| 640 | 3300005331 | Ga0070670_100047682 | Ga0070670_1000476825 | 92 |
| 641 | 3300005341 | Ga0070691_10833362 | Ga0070691_108333621 | 92 |
| 642 | 3300005356 | Ga0070674_100097298 | Ga0070674_1000972985 | 92 |
| 643 | 3300005444 | Ga0070694_101452122 | Ga0070694_1014521221 | 92 |
| 644 | 3300005458 | Ga0070681_10283684 | Ga0070681_102836843 | 92 |
| 645 | 3300005518 | Ga0070699_100969841 | Ga0070699_1009698412 | 92 |
| 646 | 3300005518 | Ga0070699_101677239 | Ga0070699_1016772391 | 92 |
| 647 | 3300005530 | Ga0070679_100177486 | Ga0070679_1001774862 | 92 |
| 648 | 3300005536 | Ga0070697_101164493 | Ga0070697_1011644932 | 92 |
| 649 | 3300005544 | Ga0070686_101631728 | Ga0070686_1016317281 | 92 |
| 650 | 3300005549 | Ga0070704_100647550 | Ga0070704_1006475503 | 92 |
| 651 | 3300005618 | Ga0068864_100732842 | Ga0068864_1007328421 | 92 |
| 652 | 3300006237 | Ga0097621_100069168 | Ga0097621_1000691684 | 92 |
| 653 | 3300006358 | Ga0068871_100406573 | Ga0068871_1004065734 | 92 |
| 654 | 3300006847 | Ga0075431_101004696 | Ga0075431_1010046962 | 92 |
| 655 | 3300006852 | Ga0075433_10252342 | Ga0075433_102523423 | 92 |
| 656 | 3300009094 | Ga0111539_10269287 | Ga0111539_102692874 | 92 |
| 657 | 3300009147 | Ga0114129_10004267 | Ga0114129_1000426714 | 92 |
| 658 | 3300009551 | Ga0105238_11125985 | Ga0105238_111259853 | 92 |
| 659 | 3300009553 | Ga0105249_10530356 | Ga0105249_105303563 | 92 |
| 660 | 3300013105 | Ga0157369_12014540 | Ga0157369_120145402 | 92 |
| 661 | 3300013307 | Ga0157372_11982882 | Ga0157372_119828821 | 92 |
| 662 | 3300014326 | Ga0157380_10032772 | Ga0157380_100327725 | 92 |
| 663 | 3300014969 | Ga0157376_10593640 | Ga0157376_105936402 | 92 |
| 664 | 3300021384 | Ga0213876_10430704 | Ga0213876_104307042 | 92 |
| 665 | 3300025912 | Ga0207707_10332540 | Ga0207707_103325402 | 92 |
| 666 | 3300025912 | Ga0207707_10423828 | Ga0207707_104238284 | 92 |
| 667 | 3300025921 | Ga0207652_10183004 | Ga0207652_101830043 | 92 |
| 668 | 3300025926 | Ga0207659_10187372 | Ga0207659_101873723 | 92 |
| 669 | 3300025937 | Ga0207669_10593369 | Ga0207669_105933691 | 92 |
| 670 | 3300025939 | Ga0207665_10481108 | Ga0207665_104811081 | 92 |
| 671 | 3300025942 | Ga0207689_10414082 | Ga0207689_104140821 | 92 |
| 672 | 3300025960 | Ga0207651_11755637 | Ga0207651_117556372 | 92 |
| 673 | 3300025961 | Ga0207712_11391467 | Ga0207712_113914672 | 92 |
| 674 | 3300026116 | Ga0207674_11862237 | Ga0207674_118622372 | 92 |
| 675 | 3300027907 | Ga0207428_10262616 | Ga0207428_102626162 | 92 |
| 676 | 3300031548 | Ga0307408_100789016 | Ga0307408_1007890161 | 92 |
| 677 | 3300031995 | Ga0307409_102975689 | Ga0307409_1029756892 | 92 |
| 678 | 3300032002 | Ga0307416_100893111 | Ga0307416_1008931113 | 92 |
| 679 | 3300032002 | Ga0307416_101095319 | Ga0307416_1010953193 | 92 |
| 680 | 3300035207 | Ga0373942_0374266 | Ga0373942_0374266_125_403 | 92 |
| 681 | 3300039437 | Ga0436365_1621027 | Ga0436365_1621027_527_805 | 92 |
| 682 | 3300042156 | Ga0439446_0279182 | Ga0439446_0279182_33_311 | 92 |
| 683 | 3300042439 | Ga0439464_0208484 | Ga0439464_0208484_161_439 | 92 |
| 684 | 3300042461 | Ga0439460_0028314 | Ga0439460_0028314_693_971 | 92 |
| 685 | 3300049589 | Ga0501073_0424115 | Ga0501073_0424115_15_329 | 92 |
| 686 | 3300050507 | nmdc:mga05p37_2454_c1 | nmdc:mga05p37_2454_c1_12338_12616 | 92 |
| 687 | 3300050511 | nmdc:mga08y16_1975598_c1 | nmdc:mga08y16_1975598_c1_222_500 | 92 |
| 688 | 3300053094 | Ga0500566_0492841 | Ga0500566_0492841_37_324 | 92 |
| 689 | 3300054114 | Ga0501084_0926358 | Ga0501084_0926358_258_614 | 92 |
| 690 | 3300060353 | Ga0501082_1397468 | Ga0501082_1397468_18_323 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hd3-assembly2.cif.gz_J | crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316 | 0.8919 | 1 | 88 |
| 4i7a-assembly1.cif.gz_B | grpn pentameric microcompartment shell protein from rhodospirillum rubrum | 0.8817 | 1 | 88 |
| 6jy5-assembly1.cif.gz_A | structure of csos4b from halothiobacillus neapolitanus | 0.8793 | 1 | 84 |
| 2qw7-assembly1.cif.gz_D | carboxysome subunit, ccml | 0.8754 | 1 | 88 |
| 6owg-assembly1.cif.gz_DR | structure of a synthetic beta-carboxysome shell, t=4 | 0.8729 | 1 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4i7aB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8817 | 1 | 88 | 2.40.50.220 |
| 4i7aB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8721 | 1 | 88 | 2.40.50.220 |
| 2rcfD00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.86 | 1 | 84 | 2.40.50.220 |
| 5l37D00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8529 | 1 | 83 | 2.40.50.220 |
| 4n8x100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml | 0.8506 | 1 | 88 | 2.40.50.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355SU97-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9366 | 1 | 84 |
GO:0031469
|
| AF-A0A2N2H2F5-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9354 | 1 | 88 |
GO:0031469
|
| AF-A0A356KDP8-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9342 | 1 | 90 |
GO:0031469
|
| AF-A0A3N5X188-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9329 | 2 | 55 |
GO:0031469
|
| AF-A0A2V2C1Z3-F1-model_v4 | Ethanolamine utilization protein EutN | 0.9307 | 1 | 85 |
GO:0031469
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar