F475434

General Info

Members Datasets Scaffolds Average Seq Length
690 298 683 90

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_102177956|Ga0068857_1021779561
Length 107
Sequence VDFTPESGISSQDLNCMILARVVGNVVATQKDLRYEGGRIMVVRPTNPDGSDGGDELLALDAVDSGVGDLVVVVREGWSASTTSTGSPGAAIDSAIIGIVDSVESDG

Samples

Sample ID Description Type Environment
1 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
2 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
294 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0.29
Rhizoplane 1.59
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10191579 3300005288 Unclassified 926
2 Ga0065712_10334447 3300005290 Unclassified 809
3 Ga0065712_10570827 3300005290 Bacteria 606
4 Ga0065715_10071658 3300005293 Unclassified 643
5 Ga0065715_10208831 3300005293 Bacteria 1316
6 Ga0065715_10822905 3300005293 Bacteria 602
7 Ga0065715_10899858 3300005293 Bacteria 575
8 Ga0065707_10156468 3300005295 Bacteria 1604
9 Ga0065707_10206834 3300005295 Unclassified 1284
10 Ga0070676_10050842 3300005328 Bacteria 2431
11 Ga0070676_10978615 3300005328 Bacteria 634
12 Ga0070676_11085377 3300005328 Bacteria 604
13 Ga0070683_100049491 3300005329 Bacteria 3888
14 Ga0070670_100040793 3300005331 Bacteria 3989
15 Ga0070670_100047682 3300005331 Bacteria 3686
16 Ga0070677_10341987 3300005333 Bacteria 773
17 Ga0070677_10610927 3300005333 Unclassified 605
18 Ga0070666_10032233 3300005335 Bacteria 3460
19 Ga0070666_10151881 3300005335 Bacteria 1616
20 Ga0070666_10193636 3300005335 Bacteria 1429
21 Ga0070680_100115126 3300005336 Bacteria 2240
22 Ga0070680_100313344 3300005336 Bacteria 1332
23 Ga0070680_100435681 3300005336 Bacteria 1119
24 Ga0070680_100638234 3300005336 Bacteria 915
25 Ga0070682_101559978 3300005337 Bacteria 570
26 Ga0068868_100132045 3300005338 Bacteria 2044
27 Ga0068868_100772186 3300005338 Bacteria 865
28 Ga0070660_100096787 3300005339 Bacteria 2335
29 Ga0070660_100661703 3300005339 Bacteria 875
30 Ga0070660_100678742 3300005339 Bacteria 863
31 Ga0070691_10833362 3300005341 Unclassified 564
32 Ga0070661_100555592 3300005344 Bacteria 924
33 Ga0070668_100136209 3300005347 Bacteria 1975
34 Ga0070669_100187620 3300005353 Bacteria 1621
35 Ga0070675_100120981 3300005354 Bacteria 2224
36 Ga0070675_100447906 3300005354 Bacteria 1158
37 Ga0070675_100843305 3300005354 Bacteria 838
38 Ga0070675_101788268 3300005354 Unclassified 567
39 Ga0070671_101636265 3300005355 Unclassified 571
40 Ga0070674_100097298 3300005356 Bacteria 2137
41 Ga0070674_100358939 3300005356 Bacteria 1179
42 Ga0070673_101400542 3300005364 Bacteria 658
43 Ga0070659_100168933 3300005366 Bacteria 1791
44 Ga0070659_100354644 3300005366 Bacteria 1231
45 Ga0070659_100852790 3300005366 Bacteria 794
46 Ga0070667_101631108 3300005367 Unclassified 606
47 Ga0070703_10000084 3300005406 Bacteria 47544
48 Ga0070703_10262313 3300005406 Bacteria 705
49 Ga0070709_10000030 3300005434 Bacteria 118031
50 Ga0070713_101953962 3300005436 Bacteria 569
51 Ga0070701_10562916 3300005438 Unclassified 749
52 Ga0070711_100635705 3300005439 Bacteria 893
53 Ga0070705_100001592 3300005440 Bacteria 11889
54 Ga0070700_101044495 3300005441 Unclassified 674
55 Ga0070700_101261217 3300005441 Unclassified 620
56 Ga0070700_101544079 3300005441 Bacteria 566
57 Ga0070694_100026651 3300005444 Bacteria 3748
58 Ga0070694_101289438 3300005444 Unclassified 614
59 Ga0070694_101452122 3300005444 Unclassified 580
60 Ga0070708_100026034 3300005445 Bacteria 5004
61 Ga0070708_100391122 3300005445 Bacteria 1311
62 Ga0070708_101076620 3300005445 Unclassified 753
63 Ga0070708_101740244 3300005445 Unclassified 579
64 Ga0070663_100390052 3300005455 Bacteria 1136
65 Ga0070662_100918047 3300005457 Bacteria 747
66 Ga0070662_101320005 3300005457 Bacteria 621
67 Ga0070681_10108734 3300005458 Bacteria 2713
68 Ga0070681_10283684 3300005458 Bacteria 1567
69 Ga0068867_100005839 3300005459 Bacteria 8731
70 Ga0068867_100284598 3300005459 Unclassified 1357
71 Ga0068867_100973207 3300005459 Unclassified 768
72 Ga0070706_100000409 3300005467 Bacteria 51687
73 Ga0070706_100794605 3300005467 Bacteria 876
74 Ga0070707_100042572 3300005468 Bacteria 4348
75 Ga0070707_100445459 3300005468 Unclassified 1255
76 Ga0070707_101771132 3300005468 Bacteria 585
77 Ga0070698_100969499 3300005471 Unclassified 797
78 Ga0070698_101119969 3300005471 Bacteria 736
79 Ga0070698_101403925 3300005471 Bacteria 649
80 Ga0070698_101589628 3300005471 Bacteria 606
81 Ga0070698_101925390 3300005471 Unclassified 544
82 Ga0070699_100000088 3300005518 Bacteria 88268
83 Ga0070699_100213951 3300005518 Bacteria 1717
84 Ga0070699_100414444 3300005518 Bacteria 1219
85 Ga0070699_100969841 3300005518 Bacteria 779
86 Ga0070699_101677239 3300005518 Unclassified 582
87 Ga0070679_100177486 3300005530 Bacteria 2103
88 Ga0070684_101087786 3300005535 Unclassified 751
89 Ga0070684_101177090 3300005535 Unclassified 721
90 Ga0070684_101238640 3300005535 Bacteria 702
91 Ga0070697_101164493 3300005536 Unclassified 687
92 Ga0070697_101350173 3300005536 Unclassified 636
93 Ga0068853_100893042 3300005539 Bacteria 853
94 Ga0070672_101052520 3300005543 Unclassified 722
95 Ga0070686_100306156 3300005544 Unclassified 1180
96 Ga0070686_101631728 3300005544 Unclassified 546
97 Ga0070686_101965881 3300005544 Bacteria 500
98 Ga0070695_100030293 3300005545 Bacteria 3368
99 Ga0070695_100183579 3300005545 Bacteria 1484
100 Ga0070696_100002481 3300005546 Bacteria 12226
101 Ga0070696_100043573 3300005546 Bacteria 3105
102 Ga0070696_100172267 3300005546 Bacteria 1601
103 Ga0070693_100002568 3300005547 Bacteria 8370
104 Ga0070693_100746227 3300005547 Bacteria 721
105 Ga0070665_100003124 3300005548 Bacteria 17837
106 Ga0070665_100006541 3300005548 Bacteria 11841
107 Ga0070665_100092857 3300005548 Unclassified 3023
108 Ga0070665_101085551 3300005548 Bacteria 812
109 Ga0070704_100026555 3300005549 Bacteria 3828
110 Ga0070704_100175306 3300005549 Bacteria 1710
111 Ga0070704_100454385 3300005549 Unclassified 1104
112 Ga0070704_100647550 3300005549 Unclassified 933
113 Ga0070704_100748560 3300005549 Bacteria 870
114 Ga0070704_101040332 3300005549 Bacteria 742
115 Ga0070704_101415269 3300005549 Bacteria 638
116 Ga0068855_100349814 3300005563 Bacteria 1628
117 Ga0068857_102177956 3300005577 Unclassified 544
118 Ga0068854_100436159 3300005578 Bacteria 1091
119 Ga0068852_100370472 3300005616 Bacteria 1403
120 Ga0068859_100003822 3300005617 Bacteria 15377
121 Ga0068859_101661398 3300005617 Bacteria 705
122 Ga0068864_100158793 3300005618 Bacteria 2054
123 Ga0068864_100472692 3300005618 Bacteria 1202
124 Ga0068864_100659786 3300005618 Unclassified 1019
125 Ga0068864_100732842 3300005618 Bacteria 968
126 Ga0068864_101462168 3300005618 Bacteria 686
127 Ga0068866_10044178 3300005718 Bacteria 2228
128 Ga0068866_10051426 3300005718 Bacteria 2097
129 Ga0068866_10275486 3300005718 Unclassified 1040
130 Ga0068861_100479695 3300005719 Bacteria 1120
131 Ga0068861_101350773 3300005719 Bacteria 695
132 Ga0068861_102520268 3300005719 Unclassified 518
133 Ga0068870_11205810 3300005840 Unclassified 548
134 Ga0068863_100120412 3300005841 Bacteria 2502
135 Ga0068863_100665493 3300005841 Unclassified 1033
136 Ga0068863_100694189 3300005841 Bacteria 1011
137 Ga0068858_100111150 3300005842 Bacteria 2559
138 Ga0068858_100198644 3300005842 Bacteria 1896
139 Ga0068858_100230961 3300005842 Bacteria 1754
140 Ga0068858_100567704 3300005842 Bacteria 1099
141 Ga0068858_101084490 3300005842 Bacteria 786
142 Ga0068858_102074291 3300005842 Bacteria 562
143 Ga0068860_100410375 3300005843 Bacteria 1341
144 Ga0068860_100776060 3300005843 Unclassified 971
145 Ga0068860_101007946 3300005843 Bacteria 851
146 Ga0068862_100435398 3300005844 Unclassified 1233
147 Ga0068862_100726479 3300005844 Unclassified 964
148 Ga0081539_10000025 3300005985 Bacteria 340255
149 Ga0075365_10000562 3300006038 Bacteria 14387
150 Ga0075368_10053538 3300006042 Bacteria 1607
151 Ga0075368_10203973 3300006042 Bacteria 837
152 Ga0075363_100398047 3300006048 Bacteria 809
153 Ga0075363_100734936 3300006048 Bacteria 597
154 Ga0075364_10004066 3300006051 Bacteria 8395
155 Ga0075364_10005645 3300006051 Bacteria 7292
156 Ga0075364_10252862 3300006051 Bacteria 1198
157 Ga0070715_10330220 3300006163 Unclassified 826
158 Ga0070716_100353031 3300006173 Unclassified 1042
159 Ga0070712_101254403 3300006175 Bacteria 645
160 Ga0075362_10105944 3300006177 Bacteria 1319
161 Ga0075367_10010080 3300006178 Bacteria 4954
162 Ga0075367_10033063 3300006178 Bacteria 2979
163 Ga0075367_10501167 3300006178 Bacteria 770
164 Ga0075367_10832755 3300006178 Unclassified 588
165 Ga0075366_10000965 3300006195 Bacteria 14034
166 Ga0075366_10470540 3300006195 Bacteria 776
167 Ga0097621_100001463 3300006237 Bacteria 16164
168 Ga0097621_100069168 3300006237 Bacteria 2914
169 Ga0097621_101178629 3300006237 Unclassified 721
170 Ga0097621_101511432 3300006237 Bacteria 637
171 Ga0068871_100012694 3300006358 Bacteria 6225
172 Ga0068871_100260003 3300006358 Unclassified 1514
173 Ga0068871_100406573 3300006358 Bacteria 1213
174 Ga0068871_100519413 3300006358 Bacteria 1075
175 Ga0075428_100016928 3300006844 Bacteria 8050
176 Ga0075428_100335992 3300006844 Bacteria 1623
177 Ga0075428_101100872 3300006844 Bacteria 839
178 Ga0075430_100292790 3300006846 Unclassified 1347
179 Ga0075431_100014795 3300006847 Bacteria 7898
180 Ga0075431_100542748 3300006847 Bacteria 1151
181 Ga0075431_100736104 3300006847 Bacteria 962
182 Ga0075431_101004696 3300006847 Bacteria 801
183 Ga0075431_102175835 3300006847 Bacteria 509
184 Ga0075431_102215036 3300006847 Unclassified 504
185 Ga0075433_10029945 3300006852 Unclassified 4641
186 Ga0075433_10058944 3300006852 Bacteria 3359
187 Ga0075433_10252342 3300006852 Bacteria 1565
188 Ga0075433_10303106 3300006852 Bacteria 1415
189 Ga0075433_10316256 3300006852 Unclassified 1381
190 Ga0075433_10324656 3300006852 Bacteria 1361
191 Ga0075433_10914947 3300006852 Bacteria 765
192 Ga0075434_100000049 3300006871 Bacteria 57417
193 Ga0075434_100082014 3300006871 Bacteria 3222
194 Ga0075434_100119475 3300006871 Bacteria 2650
195 Ga0075434_100260498 3300006871 Bacteria 1753
196 Ga0075434_100321389 3300006871 Bacteria 1568
197 Ga0075429_100069156 3300006880 Bacteria 3074
198 Ga0068865_100009117 3300006881 Bacteria 6141
199 Ga0068865_100598161 3300006881 Unclassified 932
200 Ga0068865_100726241 3300006881 Unclassified 851
201 Ga0068865_101124220 3300006881 Bacteria 693
202 Ga0075436_100000420 3300006914 Bacteria 27162
203 Ga0075436_100018228 3300006914 Bacteria 4807
204 Ga0097620_100003822 3300006931 Bacteria 15377
205 Ga0097620_101661263 3300006931 Bacteria 705
206 Ga0079104_1000103 3300006946 Bacteria 124578
207 Ga0075435_100000059 3300007076 Bacteria 56189
208 Ga0075435_100005562 3300007076 Bacteria 8819
209 Ga0075435_100335604 3300007076 Bacteria 1295
210 Ga0075435_100655502 3300007076 Bacteria 911
211 Ga0099794_10289498 3300007265 Bacteria 847
212 Ga0105240_10059564 3300009093 Bacteria 4764
213 Ga0105240_11641437 3300009093 Bacteria 672
214 Ga0111539_10002313 3300009094 Bacteria 25348
215 Ga0111539_10007363 3300009094 Bacteria 14101
216 Ga0111539_10058785 3300009094 Bacteria 4560
217 Ga0111539_10269287 3300009094 Bacteria 1983
218 Ga0111539_10862413 3300009094 Bacteria 1053
219 Ga0111539_11791798 3300009094 Bacteria 712
220 Ga0111539_11912544 3300009094 Bacteria 688
221 Ga0105245_10130030 3300009098 Bacteria 2361
222 Ga0105245_10146471 3300009098 Unclassified 2228
223 Ga0105245_10794793 3300009098 Bacteria 984
224 Ga0105245_10831831 3300009098 Unclassified 962
225 Ga0105247_10301812 3300009101 Unclassified 1111
226 Ga0114129_10002862 3300009147 Bacteria 24132
227 Ga0114129_10004267 3300009147 Bacteria 20199
228 Ga0114129_10007233 3300009147 Bacteria 15803
229 Ga0114129_10015216 3300009147 Bacteria 10950
230 Ga0114129_10031782 3300009147 Bacteria 7463
231 Ga0114129_10042536 3300009147 Bacteria 6397
232 Ga0114129_10118287 3300009147 Bacteria 3650
233 Ga0114129_10339813 3300009147 Unclassified 1992
234 Ga0114129_10679701 3300009147 Unclassified 1325
235 Ga0114129_11259235 3300009147 Bacteria 918
236 Ga0114129_11936848 3300009147 Bacteria 714
237 Ga0105243_10714254 3300009148 Unclassified 979
238 Ga0105243_11912600 3300009148 Bacteria 626
239 Ga0105243_12907880 3300009148 Unclassified 519
240 Ga0105241_11413370 3300009174 Unclassified 667
241 Ga0105241_11576514 3300009174 Unclassified 634
242 Ga0105241_12676991 3300009174 Unclassified 502
243 Ga0105242_10027323 3300009176 Bacteria 4529
244 Ga0105242_10097363 3300009176 Bacteria 2487
245 Ga0105242_10690648 3300009176 Bacteria 997
246 Ga0105242_11465541 3300009176 Bacteria 712
247 Ga0105248_10074545 3300009177 Unclassified 3814
248 Ga0105248_10708929 3300009177 Bacteria 1135
249 Ga0105237_11495129 3300009545 Unclassified 682
250 Ga0105238_11125985 3300009551 Bacteria 808
251 Ga0105238_11423263 3300009551 Bacteria 721
252 Ga0105249_10352906 3300009553 Unclassified 1490
253 Ga0105249_10530356 3300009553 Bacteria 1226
254 Ga0105249_10738737 3300009553 Bacteria 1046
255 Ga0105249_11997950 3300009553 Bacteria 653
256 Ga0105249_12314611 3300009553 Unclassified 610
257 Ga0105249_12436284 3300009553 Bacteria 596
258 Ga0105239_10213422 3300010375 Bacteria 2164
259 Ga0157373_11476904 3300013100 Unclassified 518
260 Ga0157369_10085696 3300013105 Bacteria 3366
261 Ga0157369_10753118 3300013105 Bacteria 1002
262 Ga0157369_12014540 3300013105 Bacteria 586
263 Ga0157374_10217678 3300013296 Bacteria 1873
264 Ga0157378_10155036 3300013297 Unclassified 2137
265 Ga0157378_10728496 3300013297 Unclassified 1013
266 Ga0157378_13251137 3300013297 Unclassified 505
267 Ga0163162_10414620 3300013306 Bacteria 1479
268 Ga0163162_11465257 3300013306 Bacteria 777
269 Ga0163162_11622783 3300013306 Bacteria 738
270 Ga0157372_10225441 3300013307 Bacteria 2173
271 Ga0157372_11733313 3300013307 Bacteria 719
272 Ga0157372_11982882 3300013307 Bacteria 669
273 Ga0157375_10687700 3300013308 Unclassified 1177
274 Ga0157375_11710957 3300013308 Unclassified 745
275 Ga0163163_10182331 3300014325 Bacteria 2147
276 Ga0163163_11172677 3300014325 Bacteria 831
277 Ga0163163_11328506 3300014325 Unclassified 781
278 Ga0163163_11849043 3300014325 Unclassified 664
279 Ga0157380_10008213 3300014326 Bacteria 7438
280 Ga0157380_10010700 3300014326 Bacteria 6610
281 Ga0157380_10032772 3300014326 Bacteria 3998
282 Ga0157380_10379442 3300014326 Unclassified 1334
283 Ga0157380_13053528 3300014326 Bacteria 534
284 Ga0157379_10004956 3300014968 Bacteria 11421
285 Ga0157379_10367625 3300014968 Unclassified 1319
286 Ga0157379_11522138 3300014968 Unclassified 651
287 Ga0157376_10038389 3300014969 Bacteria 3896
288 Ga0157376_10497805 3300014969 Unclassified 1197
289 Ga0157376_10593640 3300014969 Bacteria 1101
290 Ga0157376_10684452 3300014969 Bacteria 1029
291 Ga0157376_11373508 3300014969 Unclassified 737
292 Ga0206356_11405878 3300020070 Bacteria 605
293 Ga0206354_11444070 3300020081 Bacteria 579
294 Ga0213876_10119947 3300021384 Bacteria 1396
295 Ga0213876_10430704 3300021384 Bacteria 701
296 Ga0213875_10000043 3300021388 Bacteria 152637
297 Ga0207697_10360959 3300025315 Unclassified 645
298 Ga0207653_10000271 3300025885 Bacteria 30910
299 Ga0207642_10121656 3300025899 Unclassified 1347
300 Ga0207642_10133257 3300025899 Unclassified 1300
301 Ga0207642_10167053 3300025899 Bacteria 1187
302 Ga0207710_10151819 3300025900 Unclassified 1124
303 Ga0207688_10175809 3300025901 Bacteria 1275
304 Ga0207680_10042035 3300025903 Bacteria 2671
305 Ga0207680_10287234 3300025903 Bacteria 1144
306 Ga0207699_10000001 3300025906 Bacteria 695560
307 Ga0207645_10652480 3300025907 Bacteria 715
308 Ga0207645_10937110 3300025907 Unclassified 588
309 Ga0207684_10000881 3300025910 Bacteria 34236
310 Ga0207684_10364960 3300025910 Bacteria 1243
311 Ga0207684_10778491 3300025910 Bacteria 810
312 Ga0207654_10543230 3300025911 Unclassified 825
313 Ga0207707_10332540 3300025912 Bacteria 1311
314 Ga0207707_10423828 3300025912 Bacteria 1141
315 Ga0207707_10561950 3300025912 Bacteria 969
316 Ga0207707_10859476 3300025912 Bacteria 752
317 Ga0207707_11113714 3300025912 Bacteria 643
318 Ga0207695_10223593 3300025913 Bacteria 1789
319 Ga0207671_10941099 3300025914 Unclassified 682
320 Ga0207663_11192825 3300025916 Bacteria 613
321 Ga0207660_10291109 3300025917 Bacteria 1298
322 Ga0207660_10531764 3300025917 Bacteria 955
323 Ga0207660_10638366 3300025917 Bacteria 868
324 Ga0207657_10201517 3300025919 Bacteria 1600
325 Ga0207657_10513034 3300025919 Bacteria 939
326 Ga0207649_10304409 3300025920 Unclassified 1166
327 Ga0207652_10183004 3300025921 Bacteria 1884
328 Ga0207652_11382740 3300025921 Bacteria 607
329 Ga0207646_10009032 3300025922 Bacteria 9905
330 Ga0207646_10606232 3300025922 Unclassified 983
331 Ga0207646_11201641 3300025922 Bacteria 665
332 Ga0207681_10242894 3300025923 Unclassified 1402
333 Ga0207681_11064549 3300025923 Bacteria 679
334 Ga0207650_10029687 3300025925 Bacteria 3933
335 Ga0207650_10363099 3300025925 Unclassified 1193
336 Ga0207650_11451441 3300025925 Bacteria 583
337 Ga0207659_10187372 3300025926 Bacteria 1644
338 Ga0207659_10298747 3300025926 Bacteria 1322
339 Ga0207659_10384772 3300025926 Bacteria 1170
340 Ga0207687_10101465 3300025927 Bacteria 2118
341 Ga0207687_10107302 3300025927 Unclassified 2066
342 Ga0207687_10534569 3300025927 Bacteria 982
343 Ga0207690_10254468 3300025932 Bacteria 1358
344 Ga0207690_10271928 3300025932 Bacteria 1317
345 Ga0207690_10736624 3300025932 Bacteria 812
346 Ga0207706_10266250 3300025933 Bacteria 1496
347 Ga0207706_10822047 3300025933 Bacteria 788
348 Ga0207686_10027009 3300025934 Bacteria 3356
349 Ga0207686_10093220 3300025934 Bacteria 1993
350 Ga0207686_11565148 3300025934 Unclassified 544
351 Ga0207709_10547611 3300025935 Bacteria 909
352 Ga0207669_10109383 3300025937 Bacteria 1848
353 Ga0207669_10319149 3300025937 Bacteria 1188
354 Ga0207669_10593369 3300025937 Bacteria 899
355 Ga0207704_10058201 3300025938 Bacteria 2378
356 Ga0207704_10197207 3300025938 Unclassified 1470
357 Ga0207665_10481108 3300025939 Bacteria 957
358 Ga0207665_11675220 3300025939 Unclassified 504
359 Ga0207691_11519876 3300025940 Bacteria 547
360 Ga0207691_11520435 3300025940 Unclassified 547
361 Ga0207711_10053178 3300025941 Unclassified 3473
362 Ga0207711_10621316 3300025941 Bacteria 1008
363 Ga0207711_11195400 3300025941 Unclassified 702
364 Ga0207689_10414082 3300025942 Bacteria 1124
365 Ga0207661_10012308 3300025944 Bacteria 6215
366 Ga0207651_11578682 3300025960 Bacteria 591
367 Ga0207651_11755637 3300025960 Bacteria 559
368 Ga0207712_11212790 3300025961 Unclassified 673
369 Ga0207712_11257449 3300025961 Unclassified 661
370 Ga0207712_11391467 3300025961 Unclassified 628
371 Ga0207712_11605380 3300025961 Unclassified 583
372 Ga0207640_11810564 3300025981 Bacteria 552
373 Ga0207640_11929341 3300025981 Bacteria 535
374 Ga0207658_10534881 3300025986 Unclassified 1047
375 Ga0207677_10100110 3300026023 Bacteria 2130
376 Ga0207677_10129928 3300026023 Bacteria 1911
377 Ga0207677_10413697 3300026023 Bacteria 1147
378 Ga0207703_10045825 3300026035 Bacteria 3519
379 Ga0207703_10421748 3300026035 Bacteria 1242
380 Ga0207703_11809146 3300026035 Bacteria 587
381 Ga0207703_12246352 3300026035 Unclassified 521
382 Ga0207678_10402467 3300026067 Bacteria 1185
383 Ga0207708_10449780 3300026075 Bacteria 1073
384 Ga0207702_10171726 3300026078 Bacteria 1988
385 Ga0207641_10246594 3300026088 Unclassified 1667
386 Ga0207641_10356163 3300026088 Bacteria 1396
387 Ga0207641_11068326 3300026088 Bacteria 805
388 Ga0207648_10022113 3300026089 Bacteria 5713
389 Ga0207648_10355543 3300026089 Unclassified 1321
390 Ga0207648_10878831 3300026089 Bacteria 837
391 Ga0207676_10104875 3300026095 Bacteria 2352
392 Ga0207676_10685769 3300026095 Unclassified 991
393 Ga0207676_11721762 3300026095 Bacteria 625
394 Ga0207674_11862237 3300026116 Bacteria 568
395 Ga0207675_100564433 3300026118 Bacteria 1138
396 Ga0207675_100811509 3300026118 Unclassified 949
397 Ga0207675_101576150 3300026118 Bacteria 677
398 Ga0207683_10570833 3300026121 Bacteria 1046
399 Ga0207683_10779952 3300026121 Bacteria 887
400 Ga0207698_10729039 3300026142 Bacteria 988
401 Ga0209281_1000512 3300027111 Bacteria 50723
402 Ga0209998_10071622 3300027717 Unclassified 829
403 Ga0209813_10085216 3300027866 Bacteria 1052
404 Ga0209813_10134450 3300027866 Bacteria 873
405 Ga0207428_10023711 3300027907 Bacteria 5155
406 Ga0207428_10190627 3300027907 Unclassified 1546
407 Ga0207428_10262616 3300027907 Bacteria 1285
408 Ga0207428_10574573 3300027907 Unclassified 814
409 Ga0207428_11119984 3300027907 Bacteria 550
410 Ga0268266_10008922 3300028379 Bacteria 8873
411 Ga0268266_10015800 3300028379 Bacteria 6463
412 Ga0268266_10165303 3300028379 Bacteria 2004
413 Ga0268266_10801061 3300028379 Bacteria 910
414 Ga0268265_10341819 3300028380 Bacteria 1363
415 Ga0268265_10438571 3300028380 Bacteria 1217
416 Ga0268265_10642223 3300028380 Unclassified 1019
417 Ga0268265_12449760 3300028380 Unclassified 528
418 Ga0268264_10387130 3300028381 Bacteria 1340
419 Ga0268264_10733703 3300028381 Bacteria 983
420 Ga0268264_11025379 3300028381 Unclassified 832
421 Ga0307513_10213788 3300031456 Bacteria 1757
422 Ga0307408_100789016 3300031548 Bacteria 861
423 Ga0307408_100887435 3300031548 Bacteria 815
424 Ga0265314_10010737 3300031711 Bacteria 7622
425 Ga0307410_10458030 3300031852 Bacteria 1042
426 Ga0307410_12101196 3300031852 Bacteria 505
427 Ga0307412_10111430 3300031911 Bacteria 1955
428 Ga0307412_11145685 3300031911 Bacteria 694
429 Ga0307412_11788100 3300031911 Bacteria 565
430 Ga0307409_100254717 3300031995 Bacteria 1607
431 Ga0307409_102975689 3300031995 Bacteria 500
432 Ga0307416_100445454 3300032002 Bacteria 1346
433 Ga0307416_100893111 3300032002 Bacteria 988
434 Ga0307416_101056563 3300032002 Bacteria 916
435 Ga0307416_101095319 3300032002 Bacteria 901
436 Ga0307416_101423735 3300032002 Bacteria 799
437 Ga0307416_101660332 3300032002 Bacteria 744
438 Ga0307416_101886309 3300032002 Bacteria 701
439 Ga0307416_102778812 3300032002 Bacteria 585
440 Ga0307416_103481219 3300032002 Unclassified 527
441 Ga0307416_103896051 3300032002 Bacteria 500
442 Ga0307411_10465514 3300032005 Bacteria 1061
443 Ga0373944_0016046 3300035089 Unclassified 2107
444 Ga0373954_0315421 3300035118 Bacteria 772
445 Ga0373957_0191541 3300035120 Bacteria 850
446 Ga0373957_0514641 3300035120 Bacteria 522
447 Ga0373946_0589137 3300035171 Bacteria 576
448 Ga0373955_0738026 3300035172 Bacteria 605
449 Ga0373942_0374266 3300035207 Bacteria 507
450 Ga0373961_0438960 3300035241 Bacteria 507
451 Ga0373924_0050038 3300035410 Bacteria 1731
452 Ga0373935_0285873 3300035692 Bacteria 1162
453 Ga0373935_0881194 3300035692 Bacteria 663
454 Ga0373947_0175222 3300035725 Bacteria 1394
455 Ga0373947_0246251 3300035725 Unclassified 1181
456 Ga0373947_1163292 3300035725 Bacteria 526
457 Ga0373937_1263842 3300036401 Unclassified 686
458 Ga0373925_0659605 3300037068 Bacteria 862
459 Ga0373925_1133548 3300037068 Unclassified 643
460 Ga0436364_0413139 3300037853 Bacteria 254582
461 Ga0436365_0113116 3300039437 Bacteria 1636
462 Ga0436365_1621027 3300039437 Unclassified 1230
463 Ga0451853_0056793 3300041512 Bacteria 841
464 Ga0451853_2018823 3300041512 Bacteria 1263
465 Ga0451853_3602046 3300041512 Bacteria 919
466 Ga0439431_0091320 3300041997 Bacteria 830
467 Ga0439431_0168300 3300041997 Bacteria 629
468 Ga0439449_0033470 3300042007 Bacteria 1914
469 Ga0439446_0245403 3300042156 Bacteria 616
470 Ga0439446_0279182 3300042156 Bacteria 582
471 Ga0439434_0102015 3300042435 Bacteria 925
472 Ga0439435_0232447 3300042436 Bacteria 616
473 Ga0439464_0208484 3300042439 Unclassified 625
474 Ga0439460_0028314 3300042461 Bacteria 1580
475 Ga0451577_0872012 3300042876 Bacteria 811
476 Ga0466964_0548184 3300044706 Bacteria 627
477 Ga0453684_1657409 3300044712 Unclassified 655
478 Ga0451576_0280843 3300045051 Bacteria 1741
479 Ga0451576_0548805 3300045051 Bacteria 1214
480 Ga0451576_1267853 3300045051 Unclassified 769
481 Ga0451576_2746805 3300045051 Unclassified 501
482 Ga0466967_0212063 3300045976 Bacteria 1837
483 Ga0495592_0039536 3300046454 Bacteria 3543
484 Ga0495603_0045408 3300046455 Bacteria 2620
485 Ga0495629_0165632 3300046459 Bacteria 1535
486 Ga0495638_0003582 3300046460 Bacteria 12162
487 Ga0495651_0155161 3300046462 Bacteria 1646
488 Ga0495639_0163388 3300046475 Bacteria 1079
489 Ga0495662_0644877 3300046476 Bacteria 517
490 Ga0495664_0869783 3300046477 Bacteria 528
491 Ga0495594_0235853 3300046499 Bacteria 1043
492 Ga0495607_0382971 3300046501 Bacteria 643
493 Ga0495628_0155017 3300046516 Bacteria 1743
494 Ga0495630_0354016 3300046517 Bacteria 1124
495 Ga0495640_0603174 3300046533 Bacteria 663
496 Ga0495586_0282431 3300046535 Bacteria 950
497 Ga0495586_0668261 3300046535 Bacteria 600
498 Ga0495621_0190859 3300046539 Bacteria 821
499 Ga0495633_0155189 3300046558 Bacteria 1057
500 Ga0495667_0114538 3300046559 Bacteria 1742
501 Ga0495667_0248713 3300046559 Bacteria 1132
502 Ga0495634_0579531 3300046642 Bacteria 652
503 Ga0495611_0418074 3300046648 Bacteria 612
504 Ga0495635_0041962 3300046663 Bacteria 3161
505 Ga0495635_0410209 3300046663 Bacteria 899
506 Ga0495599_0060880 3300046678 Bacteria 2360
507 Ga0495599_0133559 3300046678 Bacteria 1541
508 Ga0495647_0011190 3300046681 Bacteria 3070
509 Ga0495647_0097366 3300046681 Bacteria 1214
510 Ga0495658_0064656 3300046683 Bacteria 2108
511 Ga0495658_0086966 3300046683 Bacteria 1845
512 Ga0495658_0664263 3300046683 Bacteria 668
513 Ga0495613_0047197 3300046689 Bacteria 3182
514 Ga0495624_0712003 3300046690 Bacteria 596
515 Ga0495600_0701534 3300046809 Bacteria 609
516 Ga0495674_0320821 3300047319 Bacteria 1262
517 Ga0495676_0645725 3300047321 Bacteria 687
518 Ga0495680_0334340 3300047322 Bacteria 1058
519 Ga0496101_1261968 3300048904 Bacteria 578
520 Ga0496102_0702480 3300048905 Bacteria 934
521 Ga0496102_1028148 3300048905 Unclassified 744
522 Ga0496104_0146666 3300048907 Bacteria 2266
523 Ga0496109_0142700 3300048912 Bacteria 2240
524 Ga0496109_0394146 3300048912 Bacteria 1308
525 Ga0496110_1383736 3300048913 Bacteria 613
526 Ga0496112_0158836 3300048915 Bacteria 2227
527 Ga0496112_0387939 3300048915 Bacteria 1337
528 Ga0496114_0187739 3300048917 Bacteria 1807
529 Ga0496115_0028623 3300048918 Bacteria 4369
530 Ga0496121_0017161 3300048924 Bacteria 7415
531 Ga0496124_0017108 3300048927 Bacteria 6855
532 Ga0501031_0108509 3300049568 Bacteria 1812
533 Ga0501034_0006113 3300049571 Bacteria 12991
534 Ga0501036_0175496 3300049572 Bacteria 1804
535 Ga0501036_0395912 3300049572 Bacteria 1152
536 Ga0501036_1551075 3300049572 Bacteria 535
537 Ga0501038_0516592 3300049574 Bacteria 912
538 Ga0501038_0557184 3300049574 Bacteria 871
539 Ga0501039_0059409 3300049575 Bacteria 2962
540 Ga0501039_0485550 3300049575 Bacteria 970
541 Ga0501039_0614514 3300049575 Bacteria 852
542 Ga0501040_0348611 3300049576 Bacteria 1060
543 Ga0501040_0428012 3300049576 Bacteria 952
544 Ga0501040_0810582 3300049576 Bacteria 677
545 Ga0501040_0878674 3300049576 Bacteria 649
546 Ga0501040_0974943 3300049576 Bacteria 614
547 Ga0501041_0065209 3300049577 Bacteria 2231
548 Ga0501041_0602352 3300049577 Bacteria 701
549 Ga0501042_0488375 3300049578 Bacteria 894
550 Ga0501046_0187403 3300049580 Bacteria 1545
551 Ga0501046_0654524 3300049580 Unclassified 742
552 Ga0501048_0054902 3300049582 Bacteria 2830
553 Ga0501048_0110951 3300049582 Bacteria 1937
554 Ga0501048_0240791 3300049582 Bacteria 1284
555 Ga0501048_1256326 3300049582 Bacteria 532
556 Ga0501067_0379039 3300049583 Bacteria 789
557 Ga0501068_0437674 3300049584 Bacteria 845
558 Ga0501069_0856767 3300049585 Bacteria 552
559 Ga0501069_0895520 3300049585 Bacteria 540
560 Ga0501069_0957346 3300049585 Bacteria 522
561 Ga0501071_0035635 3300049587 Bacteria 3545
562 Ga0501071_0055007 3300049587 Bacteria 2872
563 Ga0501071_0510590 3300049587 Bacteria 922
564 Ga0501071_0823465 3300049587 Bacteria 716
565 Ga0501072_0129519 3300049588 Bacteria 2011
566 Ga0501072_0347587 3300049588 Bacteria 1177
567 Ga0501072_0529226 3300049588 Unclassified 932
568 Ga0501072_0611824 3300049588 Bacteria 859
569 Ga0501072_0850195 3300049588 Unclassified 713
570 Ga0501072_0915201 3300049588 Bacteria 685
571 Ga0501073_0424115 3300049589 Unclassified 919
572 Ga0501073_0548171 3300049589 Bacteria 799
573 Ga0501074_0162251 3300049590 Bacteria 1596
574 Ga0501074_0673670 3300049590 Bacteria 730
575 Ga0501074_0684422 3300049590 Bacteria 724
576 Ga0501074_0706996 3300049590 Bacteria 711
577 Ga0501075_0037021 3300049591 Bacteria 3643
578 Ga0501075_0104298 3300049591 Bacteria 2155
579 Ga0501075_0183380 3300049591 Bacteria 1597
580 Ga0501075_0192293 3300049591 Bacteria 1556
581 Ga0501076_0056689 3300049592 Bacteria 3110
582 Ga0501076_0306645 3300049592 Bacteria 1302
583 Ga0501076_0323568 3300049592 Bacteria 1265
584 Ga0501076_0402508 3300049592 Bacteria 1125
585 Ga0501076_0775457 3300049592 Unclassified 791
586 Ga0501076_1156952 3300049592 Bacteria 637
587 Ga0501077_0086806 3300049593 Bacteria 1983
588 Ga0501077_0184000 3300049593 Bacteria 1328
589 Ga0501079_0035909 3300049741 Bacteria 3817
590 Ga0501079_0040600 3300049741 Bacteria 3590
591 Ga0501079_0054982 3300049741 Bacteria 3071
592 Ga0501079_0881503 3300049741 Unclassified 705
593 Ga0501080_0243446 3300049742 Bacteria 1641
594 Ga0501080_0287010 3300049742 Bacteria 1495
595 Ga0501080_1440521 3300049742 Unclassified 587
596 Ga0501081_0051492 3300049743 Bacteria 2840
597 Ga0501081_0063454 3300049743 Bacteria 2564
598 Ga0501081_0341504 3300049743 Bacteria 1103
599 Ga0501081_0843868 3300049743 Unclassified 690
600 Ga0501035_0104196 3300049822 Bacteria 2488
601 Ga0501045_0037298 3300049824 Bacteria 3532
602 Ga0501045_0084759 3300049824 Bacteria 2338
603 Ga0501045_0128366 3300049824 Bacteria 1884
604 Ga0501045_0520873 3300049824 Bacteria 883
605 Ga0501045_1085318 3300049824 Bacteria 586
606 nmdc:mga03683_11941_c1 3300050489 Bacteria 3159
607 nmdc:mga03683_383738_c1 3300050489 Bacteria 669
608 nmdc:mga00v17_581074_c1 3300050491 Bacteria 723
609 nmdc:mga00v17_59698_c1 3300050491 Bacteria 2341
610 nmdc:mga00v17_791888_c1 3300050491 Bacteria 604
611 nmdc:mga0yw44_78290_c1 3300050492 Bacteria 2067
612 nmdc:mga0k408_290120_c1 3300050493 Bacteria 976
613 nmdc:mga0k408_6905_c1 3300050493 Bacteria 6057
614 nmdc:mga06z11_18241_c1 3300050494 Bacteria 3201
615 nmdc:mga06z11_294816_c1 3300050494 Unclassified 963
616 nmdc:mga06z11_466321_c1 3300050494 Bacteria 764
617 nmdc:mga06z11_88085_c1 3300050494 Bacteria 1680
618 nmdc:mga04h51_72200_c1 3300050495 Bacteria 1207
619 nmdc:mga04h51_87063_c1 3300050495 Bacteria 1118
620 nmdc:mga05p37_1068279_c1 3300050507 Bacteria 849
621 nmdc:mga05p37_120743_c1 3300050507 Bacteria 3219
622 nmdc:mga05p37_1678819_c1 3300050507 Unclassified 621
623 nmdc:mga05p37_2169_c1 3300050507 Bacteria 22888
624 nmdc:mga05p37_2454_c1 3300050507 Bacteria 21555
625 nmdc:mga05p37_30866_c1 3300050507 Bacteria 6541
626 nmdc:mga05p37_41627_c1 3300050507 Bacteria 5641
627 nmdc:mga05p37_494868_c1 3300050507 Bacteria 1405
628 nmdc:mga05p37_582884_c1 3300050507 Unclassified 1266
629 nmdc:mga05p37_6745_c1 3300050507 Bacteria 13538
630 nmdc:mga05p37_89734_c1 3300050507 Bacteria 3788
631 nmdc:mga09592_1412571_c1 3300050508 Bacteria 569
632 nmdc:mga09592_1525523_c1 3300050508 Bacteria 543
633 nmdc:mga09592_77587_c1 3300050508 Bacteria 2826
634 nmdc:mga0qj67_451238_c1 3300050509 Bacteria 1036
635 nmdc:mga06r32_1242647_c1 3300050510 Unclassified 690
636 nmdc:mga06r32_1384744_c1 3300050510 Bacteria 645
637 nmdc:mga06r32_241870_c1 3300050510 Bacteria 1792
638 nmdc:mga06r32_36771_c1 3300050510 Bacteria 4629
639 nmdc:mga06r32_521401_c1 3300050510 Bacteria 1164
640 nmdc:mga08y16_19188_c1 3300050511 Bacteria 7204
641 nmdc:mga08y16_1975598_c1 3300050511 Bacteria 533
642 nmdc:mga08y16_403451_c1 3300050511 Bacteria 1399
643 nmdc:mga08y16_533867_c1 3300050511 Bacteria 1189
644 nmdc:mga08y16_657189_c1 3300050511 Bacteria 1052
645 nmdc:mga0n895_127339_c1 3300050512 Bacteria 2570
646 nmdc:mga0n895_152513_c1 3300050512 Bacteria 2341
647 nmdc:mga0n895_1843181_c1 3300050512 Bacteria 565
648 nmdc:mga0n895_186941_c1 3300050512 Bacteria 2103
649 nmdc:mga0n895_805045_c1 3300050512 Bacteria 930
650 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
651 nmdc:mga0rr50_165429_c1 3300050513 Bacteria 1798
652 nmdc:mga0rr50_17771_c1 3300050513 Bacteria 4759
653 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
654 nmdc:mga0rr50_706771_c1 3300050513 Bacteria 860
655 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
656 nmdc:mga08x19_318640_c1 3300050514 Bacteria 1082
657 nmdc:mga0a205_111836_c1 3300050515 Bacteria 2630
658 nmdc:mga0a205_160653_c1 3300050515 Unclassified 2144
659 nmdc:mga0a205_275666_c1 3300050515 Bacteria 1558
660 nmdc:mga0a205_328334_c1 3300050515 Bacteria 1400
661 nmdc:mga0a205_65091_c1 3300050515 Bacteria 3521
662 nmdc:mga0a205_809171_c1 3300050515 Bacteria 785
663 Ga0495595_0300677 3300053084 Bacteria 807
664 Ga0495595_0400799 3300053084 Bacteria 695
665 Ga0500566_0342628 3300053094 Bacteria 688
666 Ga0500566_0492841 3300053094 Unclassified 529
667 Ga0500592_049854 3300053116 Bacteria 680
668 Ga0500618_000025 3300053125 Bacteria 150583
669 Ga0500627_0353441 3300053158 Unclassified 634
670 Ga0501084_0116139 3300054114 Bacteria 2250
671 Ga0501084_0855243 3300054114 Bacteria 765
672 Ga0501084_0926358 3300054114 Bacteria 733
673 Ga0501084_0980842 3300054114 Bacteria 710
674 Ga0501084_1429638 3300054114 Unclassified 579
675 Ga0501082_0047449 3300060353 Bacteria 3701
676 Ga0501082_0270103 3300060353 Bacteria 1480
677 Ga0501082_0430103 3300060353 Unclassified 1153
678 Ga0501082_1397468 3300060353 Bacteria 611
679 Ga0501082_1847788 3300060353 Bacteria 527
680 Ga0530510_0243740 3300061734 Bacteria 1338
681 Ga0530510_0344118 3300061734 Bacteria 1120
682 Ga0530510_0728180 3300061734 Bacteria 756
683 Ga0530510_0736926 3300061734 Unclassified 751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_11622783 Ga0163162_116227832 79
2 3300049742 Ga0501080_1440521 Ga0501080_1440521_103_372 79
3 3300060353 Ga0501082_1847788 Ga0501082_1847788_71_343 80
4 3300005535 Ga0070684_101238640 Ga0070684_1012386402 81
5 3300013100 Ga0157373_11476904 Ga0157373_114769041 81
6 3300013306 Ga0163162_11465257 Ga0163162_114652572 81
7 3300005406 Ga0070703_10000084 Ga0070703_1000008412 87
8 3300005445 Ga0070708_100026034 Ga0070708_1000260345 87
9 3300005467 Ga0070706_100000409 Ga0070706_10000040930 87
10 3300005518 Ga0070699_100000088 Ga0070699_10000008874 87
11 3300005545 Ga0070695_100183579 Ga0070695_1001835792 87
12 3300005546 Ga0070696_100002481 Ga0070696_10000248111 87
13 3300005546 Ga0070696_100172267 Ga0070696_1001722672 87
14 3300005547 Ga0070693_100002568 Ga0070693_1000025688 87
15 3300013297 Ga0157378_10728496 Ga0157378_107284962 87
16 3300025885 Ga0207653_10000271 Ga0207653_1000027114 87
17 3300025910 Ga0207684_10000881 Ga0207684_1000088111 87
18 iso_pu_bacteria 2821123053 2821128840 87
19 iso_pu_bacteria 2857531043 2857534007 87
20 3300005293 Ga0065715_10071658 Ga0065715_100716581 89
21 3300005293 Ga0065715_10208831 Ga0065715_102088313 89
22 3300005328 Ga0070676_10050842 Ga0070676_100508426 89
23 3300005328 Ga0070676_10978615 Ga0070676_109786152 89
24 3300005331 Ga0070670_100040793 Ga0070670_1000407935 89
25 3300005333 Ga0070677_10341987 Ga0070677_103419872 89
26 3300005335 Ga0070666_10193636 Ga0070666_101936364 89
27 3300005336 Ga0070680_100435681 Ga0070680_1004356812 89
28 3300005336 Ga0070680_100638234 Ga0070680_1006382342 89
29 3300005337 Ga0070682_101559978 Ga0070682_1015599782 89
30 3300005338 Ga0068868_100772186 Ga0068868_1007721862 89
31 3300005339 Ga0070660_100661703 Ga0070660_1006617032 89
32 3300005353 Ga0070669_100187620 Ga0070669_1001876203 89
33 3300005354 Ga0070675_100843305 Ga0070675_1008433051 89
34 3300005354 Ga0070675_101788268 Ga0070675_1017882682 89
35 3300005356 Ga0070674_100097298 Ga0070674_1000972983 89
36 3300005364 Ga0070673_101400542 Ga0070673_1014005422 89
37 3300005366 Ga0070659_100168933 Ga0070659_1001689335 89
38 3300005440 Ga0070705_100001592 Ga0070705_10000159211 89
39 3300005441 Ga0070700_101044495 Ga0070700_1010444952 89
40 3300005441 Ga0070700_101544079 Ga0070700_1015440792 89
41 3300005444 Ga0070694_101289438 Ga0070694_1012894382 89
42 3300005459 Ga0068867_100005839 Ga0068867_1000058399 89
43 3300005468 Ga0070707_101771132 Ga0070707_1017711321 89
44 3300005471 Ga0070698_101119969 Ga0070698_1011199691 89
45 3300005536 Ga0070697_101350173 Ga0070697_1013501732 89
46 3300005547 Ga0070693_100746227 Ga0070693_1007462272 89
47 3300005548 Ga0070665_100006541 Ga0070665_1000065416 89
48 3300005549 Ga0070704_100175306 Ga0070704_1001753062 89
49 3300005617 Ga0068859_100003822 Ga0068859_1000038227 89
50 3300005618 Ga0068864_100158793 Ga0068864_1001587932 89
51 3300005618 Ga0068864_100659786 Ga0068864_1006597862 89
52 3300005618 Ga0068864_101462168 Ga0068864_1014621682 89
53 3300005718 Ga0068866_10044178 Ga0068866_100441785 89
54 3300005719 Ga0068861_100479695 Ga0068861_1004796952 89
55 3300005719 Ga0068861_102520268 Ga0068861_1025202681 89
56 3300005841 Ga0068863_100694189 Ga0068863_1006941892 89
57 3300005842 Ga0068858_100230961 Ga0068858_1002309614 89
58 3300005842 Ga0068858_100567704 Ga0068858_1005677043 89
59 3300005842 Ga0068858_101084490 Ga0068858_1010844902 89
60 3300005843 Ga0068860_101007946 Ga0068860_1010079462 89
61 3300005844 Ga0068862_100435398 Ga0068862_1004353985 89
62 3300005844 Ga0068862_100726479 Ga0068862_1007264791 89
63 3300006038 Ga0075365_10000562 Ga0075365_1000056214 89
64 3300006042 Ga0075368_10203973 Ga0075368_102039732 89
65 3300006048 Ga0075363_100398047 Ga0075363_1003980472 89
66 3300006048 Ga0075363_100734936 Ga0075363_1007349362 89
67 3300006051 Ga0075364_10252862 Ga0075364_102528622 89
68 3300006178 Ga0075367_10010080 Ga0075367_100100803 89
69 3300006237 Ga0097621_100001463 Ga0097621_10000146316 89
70 3300006237 Ga0097621_101511432 Ga0097621_1015114322 89
71 3300006358 Ga0068871_100012694 Ga0068871_1000126945 89
72 3300006358 Ga0068871_100519413 Ga0068871_1005194133 89
73 3300006844 Ga0075428_101100872 Ga0075428_1011008723 89
74 3300006846 Ga0075430_100292790 Ga0075430_1002927903 89
75 3300006847 Ga0075431_100736104 Ga0075431_1007361043 89
76 3300006852 Ga0075433_10058944 Ga0075433_100589446 89
77 3300006871 Ga0075434_100260498 Ga0075434_1002604982 89
78 3300006880 Ga0075429_100069156 Ga0075429_1000691562 89
79 3300006881 Ga0068865_100009117 Ga0068865_1000091174 89
80 3300006881 Ga0068865_100598161 Ga0068865_1005981613 89
81 3300006881 Ga0068865_101124220 Ga0068865_1011242202 89
82 3300006931 Ga0097620_100003822 Ga0097620_1000038227 89
83 3300009093 Ga0105240_11641437 Ga0105240_116414371 89
84 3300009094 Ga0111539_10002313 Ga0111539_100023139 89
85 3300009094 Ga0111539_11791798 Ga0111539_117917982 89
86 3300009094 Ga0111539_11912544 Ga0111539_119125442 89
87 3300009098 Ga0105245_10146471 Ga0105245_101464712 89
88 3300009147 Ga0114129_10015216 Ga0114129_1001521611 89
89 3300009147 Ga0114129_11936848 Ga0114129_119368482 89
90 3300009148 Ga0105243_11912600 Ga0105243_119126002 89
91 3300009174 Ga0105241_11576514 Ga0105241_115765142 89
92 3300009176 Ga0105242_10097363 Ga0105242_100973633 89
93 3300009177 Ga0105248_10708929 Ga0105248_107089293 89
94 3300009551 Ga0105238_11423263 Ga0105238_114232632 89
95 3300009553 Ga0105249_10738737 Ga0105249_107387372 89
96 3300009553 Ga0105249_11997950 Ga0105249_119979502 89
97 3300009553 Ga0105249_12314611 Ga0105249_123146111 89
98 3300013297 Ga0157378_13251137 Ga0157378_132511372 89
99 3300014325 Ga0163163_10182331 Ga0163163_101823315 89
100 3300014325 Ga0163163_11172677 Ga0163163_111726772 89
101 3300014326 Ga0157380_10010700 Ga0157380_100107006 89
102 3300014326 Ga0157380_13053528 Ga0157380_130535282 89
103 3300014968 Ga0157379_10367625 Ga0157379_103676252 89
104 3300014969 Ga0157376_10684452 Ga0157376_106844522 89
105 3300014969 Ga0157376_11373508 Ga0157376_113735082 89
106 3300025899 Ga0207642_10121656 Ga0207642_101216561 89
107 3300025903 Ga0207680_10287234 Ga0207680_102872343 89
108 3300025907 Ga0207645_10652480 Ga0207645_106524802 89
109 3300025907 Ga0207645_10937110 Ga0207645_109371102 89
110 3300025910 Ga0207684_10778491 Ga0207684_107784913 89
111 3300025916 Ga0207663_11192825 Ga0207663_111928251 89
112 3300025922 Ga0207646_11201641 Ga0207646_112016412 89
113 3300025923 Ga0207681_11064549 Ga0207681_110645492 89
114 3300025925 Ga0207650_10029687 Ga0207650_100296875 89
115 3300025925 Ga0207650_11451441 Ga0207650_114514412 89
116 3300025926 Ga0207659_10298747 Ga0207659_102987473 89
117 3300025926 Ga0207659_10384772 Ga0207659_103847722 89
118 3300025927 Ga0207687_10107302 Ga0207687_101073022 89
119 3300025932 Ga0207690_10271928 Ga0207690_102719284 89
120 3300025934 Ga0207686_10027009 Ga0207686_100270093 89
121 3300025937 Ga0207669_10109383 Ga0207669_101093833 89
122 3300025938 Ga0207704_10058201 Ga0207704_100582015 89
123 3300025941 Ga0207711_10621316 Ga0207711_106213162 89
124 3300025960 Ga0207651_11578682 Ga0207651_115786822 89
125 3300025961 Ga0207712_11212790 Ga0207712_112127902 89
126 3300025961 Ga0207712_11257449 Ga0207712_112574492 89
127 3300026023 Ga0207677_10129928 Ga0207677_101299283 89
128 3300026023 Ga0207677_10413697 Ga0207677_104136972 89
129 3300026035 Ga0207703_10421748 Ga0207703_104217482 89
130 3300026035 Ga0207703_12246352 Ga0207703_122463522 89
131 3300026088 Ga0207641_11068326 Ga0207641_110683262 89
132 3300026089 Ga0207648_10022113 Ga0207648_100221135 89
133 3300026095 Ga0207676_10104875 Ga0207676_101048753 89
134 3300026095 Ga0207676_11721762 Ga0207676_117217621 89
135 3300026118 Ga0207675_100564433 Ga0207675_1005644333 89
136 3300026118 Ga0207675_101576150 Ga0207675_1015761501 89
137 3300026121 Ga0207683_10570833 Ga0207683_105708333 89
138 3300026121 Ga0207683_10779952 Ga0207683_107799522 89
139 3300027866 Ga0209813_10134450 Ga0209813_101344502 89
140 3300027907 Ga0207428_10023711 Ga0207428_100237116 89
141 3300028379 Ga0268266_10008922 Ga0268266_1000892210 89
142 3300028380 Ga0268265_10341819 Ga0268265_103418193 89
143 3300028380 Ga0268265_10438571 Ga0268265_104385712 89
144 3300028380 Ga0268265_10642223 Ga0268265_106422234 89
145 3300028381 Ga0268264_10733703 Ga0268264_107337032 89
146 3300031548 Ga0307408_100887435 Ga0307408_1008874352 89
147 3300031711 Ga0265314_10010737 Ga0265314_100107378 89
148 3300031911 Ga0307412_11788100 Ga0307412_117881002 89
149 3300032002 Ga0307416_102778812 Ga0307416_1027788122 89
150 3300032002 Ga0307416_103481219 Ga0307416_1034812192 89
151 3300032002 Ga0307416_103896051 Ga0307416_1038960512 89
152 3300035089 Ga0373944_0016046 Ga0373944_0016046_302_571 89
153 3300035118 Ga0373954_0315421 Ga0373954_0315421_87_356 89
154 3300035120 Ga0373957_0191541 Ga0373957_0191541_420_689 89
155 3300035120 Ga0373957_0514641 Ga0373957_0514641_23_292 89
156 3300035171 Ga0373946_0589137 Ga0373946_0589137_27_296 89
157 3300035172 Ga0373955_0738026 Ga0373955_0738026_298_567 89
158 3300035692 Ga0373935_0285873 Ga0373935_0285873_133_402 89
159 3300035725 Ga0373947_0175222 Ga0373947_0175222_813_1082 89
160 3300035725 Ga0373947_0246251 Ga0373947_0246251_310_579 89
161 3300035725 Ga0373947_1163292 Ga0373947_1163292_231_500 89
162 3300036401 Ga0373937_1263842 Ga0373937_1263842_231_500 89
163 3300037068 Ga0373925_0659605 Ga0373925_0659605_161_430 89
164 3300041512 Ga0451853_2018823 Ga0451853_2018823_838_1107 89
165 3300041997 Ga0439431_0168300 Ga0439431_0168300_88_357 89
166 3300042007 Ga0439449_0033470 Ga0439449_0033470_479_748 89
167 3300042435 Ga0439434_0102015 Ga0439434_0102015_159_428 89
168 3300042436 Ga0439435_0232447 Ga0439435_0232447_308_577 89
169 3300046454 Ga0495592_0039536 Ga0495592_0039536_2576_2845 89
170 3300046455 Ga0495603_0045408 Ga0495603_0045408_331_600 89
171 3300046462 Ga0495651_0155161 Ga0495651_0155161_468_737 89
172 3300046516 Ga0495628_0155017 Ga0495628_0155017_320_589 89
173 3300046517 Ga0495630_0354016 Ga0495630_0354016_666_935 89
174 3300046535 Ga0495586_0282431 Ga0495586_0282431_462_731 89
175 3300046535 Ga0495586_0668261 Ga0495586_0668261_64_333 89
176 3300046559 Ga0495667_0114538 Ga0495667_0114538_984_1253 89
177 3300046642 Ga0495634_0579531 Ga0495634_0579531_43_312 89
178 3300046663 Ga0495635_0041962 Ga0495635_0041962_365_634 89
179 3300046681 Ga0495647_0011190 Ga0495647_0011190_2518_2787 89
180 3300046683 Ga0495658_0086966 Ga0495658_0086966_810_1079 89
181 3300046683 Ga0495658_0664263 Ga0495658_0664263_157_426 89
182 3300046689 Ga0495613_0047197 Ga0495613_0047197_1090_1359 89
183 3300046690 Ga0495624_0712003 Ga0495624_0712003_202_471 89
184 3300047319 Ga0495674_0320821 Ga0495674_0320821_739_1008 89
185 3300047321 Ga0495676_0645725 Ga0495676_0645725_157_426 89
186 3300048905 Ga0496102_1028148 Ga0496102_1028148_465_734 89
187 3300048912 Ga0496109_0394146 Ga0496109_0394146_954_1223 89
188 3300048913 Ga0496110_1383736 Ga0496110_1383736_30_299 89
189 3300048915 Ga0496112_0387939 Ga0496112_0387939_848_1117 89
190 3300049572 Ga0501036_0175496 Ga0501036_0175496_643_912 89
191 3300049572 Ga0501036_1551075 Ga0501036_1551075_108_377 89
192 3300049574 Ga0501038_0557184 Ga0501038_0557184_136_405 89
193 3300049575 Ga0501039_0485550 Ga0501039_0485550_609_878 89
194 3300049575 Ga0501039_0614514 Ga0501039_0614514_363_632 89
195 3300049576 Ga0501040_0810582 Ga0501040_0810582_310_579 89
196 3300049577 Ga0501041_0065209 Ga0501041_0065209_1708_1977 89
197 3300049578 Ga0501042_0488375 Ga0501042_0488375_44_313 89
198 3300049582 Ga0501048_0240791 Ga0501048_0240791_253_522 89
199 3300049582 Ga0501048_1256326 Ga0501048_1256326_129_398 89
200 3300049585 Ga0501069_0856767 Ga0501069_0856767_55_324 89
201 3300049587 Ga0501071_0055007 Ga0501071_0055007_426_695 89
202 3300049587 Ga0501071_0510590 Ga0501071_0510590_275_544 89
203 3300049588 Ga0501072_0129519 Ga0501072_0129519_436_705 89
204 3300049589 Ga0501073_0424115 Ga0501073_0424115_599_868 89
205 3300049590 Ga0501074_0673670 Ga0501074_0673670_234_503 89
206 3300049590 Ga0501074_0706996 Ga0501074_0706996_334_603 89
207 3300049591 Ga0501075_0192293 Ga0501075_0192293_192_461 89
208 3300049592 Ga0501076_0402508 Ga0501076_0402508_166_435 89
209 3300049592 Ga0501076_0775457 Ga0501076_0775457_54_323 89
210 3300049741 Ga0501079_0040600 Ga0501079_0040600_2020_2289 89
211 3300049741 Ga0501079_0881503 Ga0501079_0881503_47_316 89
212 3300049742 Ga0501080_0243446 Ga0501080_0243446_830_1099 89
213 3300049743 Ga0501081_0051492 Ga0501081_0051492_418_687 89
214 3300049824 Ga0501045_0084759 Ga0501045_0084759_483_752 89
215 3300049824 Ga0501045_0128366 Ga0501045_0128366_643_912 89
216 3300050494 nmdc:mga06z11_466321_c1 nmdc:mga06z11_466321_c1_181_450 89
217 3300050495 nmdc:mga04h51_87063_c1 nmdc:mga04h51_87063_c1_278_547 89
218 3300050507 nmdc:mga05p37_1068279_c1 nmdc:mga05p37_1068279_c1_454_723 89
219 3300050507 nmdc:mga05p37_120743_c1 nmdc:mga05p37_120743_c1_1134_1403 89
220 3300050507 nmdc:mga05p37_2169_c1 nmdc:mga05p37_2169_c1_4634_4903 89
221 3300050508 nmdc:mga09592_1412571_c1 nmdc:mga09592_1412571_c1_115_384 89
222 3300050508 nmdc:mga09592_77587_c1 nmdc:mga09592_77587_c1_89_358 89
223 3300050509 nmdc:mga0qj67_451238_c1 nmdc:mga0qj67_451238_c1_379_648 89
224 3300050510 nmdc:mga06r32_241870_c1 nmdc:mga06r32_241870_c1_746_1015 89
225 3300050511 nmdc:mga08y16_19188_c1 nmdc:mga08y16_19188_c1_4501_4770 89
226 3300050512 nmdc:mga0n895_127339_c1 nmdc:mga0n895_127339_c1_404_673 89
227 3300050512 nmdc:mga0n895_1843181_c1 nmdc:mga0n895_1843181_c1_275_544 89
228 3300050515 nmdc:mga0a205_65091_c1 nmdc:mga0a205_65091_c1_440_709 89
229 3300053084 Ga0495595_0400799 Ga0495595_0400799_407_676 89
230 3300053094 Ga0500566_0342628 Ga0500566_0342628_27_296 89
231 3300053158 Ga0500627_0353441 Ga0500627_0353441_95_364 89
232 3300054114 Ga0501084_0116139 Ga0501084_0116139_1924_2193 89
233 3300060353 Ga0501082_0270103 Ga0501082_0270103_871_1140 89
234 3300060353 Ga0501082_0430103 Ga0501082_0430103_25_294 89
235 3300061734 Ga0530510_0344118 Ga0530510_0344118_386_655 89
236 3300061734 Ga0530510_0728180 Ga0530510_0728180_70_339 89
237 3300005293 Ga0065715_10899858 Ga0065715_108998581 90
238 3300005295 Ga0065707_10156468 Ga0065707_101564683 90
239 3300005295 Ga0065707_10206834 Ga0065707_102068342 90
240 3300005328 Ga0070676_11085377 Ga0070676_110853772 90
241 3300005329 Ga0070683_100049491 Ga0070683_1000494913 90
242 3300005335 Ga0070666_10151881 Ga0070666_101518812 90
243 3300005336 Ga0070680_100115126 Ga0070680_1001151262 90
244 3300005336 Ga0070680_100313344 Ga0070680_1003133443 90
245 3300005338 Ga0068868_100132045 Ga0068868_1001320453 90
246 3300005339 Ga0070660_100096787 Ga0070660_1000967875 90
247 3300005339 Ga0070660_100678742 Ga0070660_1006787423 90
248 3300005344 Ga0070661_100555592 Ga0070661_1005555923 90
249 3300005347 Ga0070668_100136209 Ga0070668_1001362094 90
250 3300005354 Ga0070675_100120981 Ga0070675_1001209815 90
251 3300005354 Ga0070675_100447906 Ga0070675_1004479062 90
252 3300005366 Ga0070659_100354644 Ga0070659_1003546442 90
253 3300005366 Ga0070659_100852790 Ga0070659_1008527902 90
254 3300005367 Ga0070667_101631108 Ga0070667_1016311082 90
255 3300005406 Ga0070703_10262313 Ga0070703_102623132 90
256 3300005434 Ga0070709_10000030 Ga0070709_1000003090 90
257 3300005436 Ga0070713_101953962 Ga0070713_1019539622 90
258 3300005438 Ga0070701_10562916 Ga0070701_105629162 90
259 3300005439 Ga0070711_100635705 Ga0070711_1006357053 90
260 3300005441 Ga0070700_101261217 Ga0070700_1012612172 90
261 3300005444 Ga0070694_100026651 Ga0070694_1000266518 90
262 3300005445 Ga0070708_100391122 Ga0070708_1003911222 90
263 3300005445 Ga0070708_101076620 Ga0070708_1010766203 90
264 3300005445 Ga0070708_101740244 Ga0070708_1017402442 90
265 3300005457 Ga0070662_100918047 Ga0070662_1009180472 90
266 3300005458 Ga0070681_10108734 Ga0070681_101087344 90
267 3300005459 Ga0068867_100284598 Ga0068867_1002845983 90
268 3300005467 Ga0070706_100794605 Ga0070706_1007946051 90
269 3300005468 Ga0070707_100042572 Ga0070707_1000425725 90
270 3300005468 Ga0070707_100445459 Ga0070707_1004454593 90
271 3300005471 Ga0070698_100969499 Ga0070698_1009694992 90
272 3300005471 Ga0070698_101403925 Ga0070698_1014039252 90
273 3300005471 Ga0070698_101589628 Ga0070698_1015896281 90
274 3300005471 Ga0070698_101925390 Ga0070698_1019253901 90
275 3300005518 Ga0070699_100213951 Ga0070699_1002139514 90
276 3300005518 Ga0070699_100414444 Ga0070699_1004144443 90
277 3300005535 Ga0070684_101087786 Ga0070684_1010877862 90
278 3300005539 Ga0068853_100893042 Ga0068853_1008930421 90
279 3300005543 Ga0070672_101052520 Ga0070672_1010525203 90
280 3300005544 Ga0070686_100306156 Ga0070686_1003061562 90
281 3300005545 Ga0070695_100030293 Ga0070695_1000302933 90
282 3300005548 Ga0070665_100003124 Ga0070665_10000312413 90
283 3300005549 Ga0070704_100026555 Ga0070704_1000265555 90
284 3300005549 Ga0070704_100454385 Ga0070704_1004543851 90
285 3300005549 Ga0070704_100748560 Ga0070704_1007485602 90
286 3300005549 Ga0070704_101040332 Ga0070704_1010403321 90
287 3300005549 Ga0070704_101415269 Ga0070704_1014152692 90
288 3300005563 Ga0068855_100349814 Ga0068855_1003498142 90
289 3300005577 Ga0068857_102177956 Ga0068857_1021779561 90
290 3300005578 Ga0068854_100436159 Ga0068854_1004361593 90
291 3300005616 Ga0068852_100370472 Ga0068852_1003704722 90
292 3300005617 Ga0068859_101661398 Ga0068859_1016613983 90
293 3300005618 Ga0068864_100472692 Ga0068864_1004726923 90
294 3300005718 Ga0068866_10275486 Ga0068866_102754863 90
295 3300005719 Ga0068861_101350773 Ga0068861_1013507732 90
296 3300005840 Ga0068870_11205810 Ga0068870_112058102 90
297 3300005841 Ga0068863_100120412 Ga0068863_1001204123 90
298 3300005841 Ga0068863_100665493 Ga0068863_1006654933 90
299 3300005842 Ga0068858_100111150 Ga0068858_1001111505 90
300 3300005842 Ga0068858_100198644 Ga0068858_1001986444 90
301 3300005842 Ga0068858_102074291 Ga0068858_1020742911 90
302 3300005843 Ga0068860_100410375 Ga0068860_1004103752 90
303 3300005843 Ga0068860_100776060 Ga0068860_1007760602 90
304 3300006042 Ga0075368_10053538 Ga0075368_100535383 90
305 3300006051 Ga0075364_10004066 Ga0075364_100040664 90
306 3300006051 Ga0075364_10005645 Ga0075364_100056453 90
307 3300006163 Ga0070715_10330220 Ga0070715_103302202 90
308 3300006173 Ga0070716_100353031 Ga0070716_1003530312 90
309 3300006175 Ga0070712_101254403 Ga0070712_1012544031 90
310 3300006177 Ga0075362_10105944 Ga0075362_101059444 90
311 3300006178 Ga0075367_10033063 Ga0075367_100330635 90
312 3300006178 Ga0075367_10832755 Ga0075367_108327552 90
313 3300006195 Ga0075366_10000965 Ga0075366_100009658 90
314 3300006195 Ga0075366_10470540 Ga0075366_104705402 90
315 3300006358 Ga0068871_100260003 Ga0068871_1002600033 90
316 3300006844 Ga0075428_100016928 Ga0075428_1000169288 90
317 3300006847 Ga0075431_100542748 Ga0075431_1005427483 90
318 3300006852 Ga0075433_10029945 Ga0075433_100299455 90
319 3300006852 Ga0075433_10303106 Ga0075433_103031062 90
320 3300006852 Ga0075433_10316256 Ga0075433_103162564 90
321 3300006852 Ga0075433_10324656 Ga0075433_103246563 90
322 3300006852 Ga0075433_10914947 Ga0075433_109149473 90
323 3300006871 Ga0075434_100000049 Ga0075434_10000004946 90
324 3300006871 Ga0075434_100082014 Ga0075434_1000820144 90
325 3300006871 Ga0075434_100119475 Ga0075434_1001194754 90
326 3300006871 Ga0075434_100321389 Ga0075434_1003213893 90
327 3300006881 Ga0068865_100726241 Ga0068865_1007262412 90
328 3300006914 Ga0075436_100000420 Ga0075436_10000042013 90
329 3300006914 Ga0075436_100018228 Ga0075436_1000182289 90
330 3300006931 Ga0097620_101661263 Ga0097620_1016612631 90
331 3300007076 Ga0075435_100000059 Ga0075435_10000005944 90
332 3300007076 Ga0075435_100005562 Ga0075435_1000055623 90
333 3300007076 Ga0075435_100655502 Ga0075435_1006555021 90
334 3300007265 Ga0099794_10289498 Ga0099794_102894983 90
335 3300009093 Ga0105240_10059564 Ga0105240_100595643 90
336 3300009094 Ga0111539_10007363 Ga0111539_100073638 90
337 3300009094 Ga0111539_10058785 Ga0111539_100587852 90
338 3300009094 Ga0111539_10862413 Ga0111539_108624131 90
339 3300009098 Ga0105245_10130030 Ga0105245_101300302 90
340 3300009098 Ga0105245_10831831 Ga0105245_108318312 90
341 3300009101 Ga0105247_10301812 Ga0105247_103018121 90
342 3300009147 Ga0114129_10002862 Ga0114129_1000286213 90
343 3300009147 Ga0114129_10007233 Ga0114129_1000723317 90
344 3300009147 Ga0114129_10031782 Ga0114129_100317829 90
345 3300009147 Ga0114129_10042536 Ga0114129_100425367 90
346 3300009147 Ga0114129_10118287 Ga0114129_101182874 90
347 3300009147 Ga0114129_10679701 Ga0114129_106797013 90
348 3300009147 Ga0114129_11259235 Ga0114129_112592352 90
349 3300009148 Ga0105243_10714254 Ga0105243_107142542 90
350 3300009148 Ga0105243_12907880 Ga0105243_129078802 90
351 3300009174 Ga0105241_12676991 Ga0105241_126769911 90
352 3300009176 Ga0105242_10027323 Ga0105242_100273234 90
353 3300009177 Ga0105248_10074545 Ga0105248_100745454 90
354 3300009545 Ga0105237_11495129 Ga0105237_114951292 90
355 3300009553 Ga0105249_10352906 Ga0105249_103529062 90
356 3300010375 Ga0105239_10213422 Ga0105239_102134225 90
357 3300013105 Ga0157369_10085696 Ga0157369_100856965 90
358 3300013105 Ga0157369_10753118 Ga0157369_107531183 90
359 3300013296 Ga0157374_10217678 Ga0157374_102176782 90
360 3300013306 Ga0163162_10414620 Ga0163162_104146201 90
361 3300013307 Ga0157372_10225441 Ga0157372_102254413 90
362 3300013307 Ga0157372_11733313 Ga0157372_117333132 90
363 3300013308 Ga0157375_10687700 Ga0157375_106877003 90
364 3300013308 Ga0157375_11710957 Ga0157375_117109573 90
365 3300014325 Ga0163163_11328506 Ga0163163_113285062 90
366 3300014325 Ga0163163_11849043 Ga0163163_118490431 90
367 3300014326 Ga0157380_10008213 Ga0157380_1000821310 90
368 3300014326 Ga0157380_10379442 Ga0157380_103794423 90
369 3300014968 Ga0157379_10004956 Ga0157379_100049569 90
370 3300014968 Ga0157379_11522138 Ga0157379_115221382 90
371 3300014969 Ga0157376_10038389 Ga0157376_100383892 90
372 3300014969 Ga0157376_10497805 Ga0157376_104978052 90
373 3300020070 Ga0206356_11405878 Ga0206356_114058782 90
374 3300020081 Ga0206354_11444070 Ga0206354_114440702 90
375 3300021384 Ga0213876_10119947 Ga0213876_101199474 90
376 3300025315 Ga0207697_10360959 Ga0207697_103609591 90
377 3300025899 Ga0207642_10133257 Ga0207642_101332572 90
378 3300025900 Ga0207710_10151819 Ga0207710_101518193 90
379 3300025901 Ga0207688_10175809 Ga0207688_101758092 90
380 3300025903 Ga0207680_10042035 Ga0207680_100420354 90
381 3300025906 Ga0207699_10000001 Ga0207699_10000001432 90
382 3300025910 Ga0207684_10364960 Ga0207684_103649603 90
383 3300025911 Ga0207654_10543230 Ga0207654_105432302 90
384 3300025912 Ga0207707_10561950 Ga0207707_105619503 90
385 3300025912 Ga0207707_10859476 Ga0207707_108594763 90
386 3300025912 Ga0207707_11113714 Ga0207707_111137141 90
387 3300025913 Ga0207695_10223593 Ga0207695_102235933 90
388 3300025914 Ga0207671_10941099 Ga0207671_109410992 90
389 3300025917 Ga0207660_10291109 Ga0207660_102911093 90
390 3300025917 Ga0207660_10531764 Ga0207660_105317642 90
391 3300025917 Ga0207660_10638366 Ga0207660_106383663 90
392 3300025919 Ga0207657_10201517 Ga0207657_102015174 90
393 3300025919 Ga0207657_10513034 Ga0207657_105130343 90
394 3300025920 Ga0207649_10304409 Ga0207649_103044092 90
395 3300025921 Ga0207652_11382740 Ga0207652_113827402 90
396 3300025922 Ga0207646_10009032 Ga0207646_100090326 90
397 3300025922 Ga0207646_10606232 Ga0207646_106062322 90
398 3300025923 Ga0207681_10242894 Ga0207681_102428943 90
399 3300025927 Ga0207687_10101465 Ga0207687_101014655 90
400 3300025927 Ga0207687_10534569 Ga0207687_105345692 90
401 3300025932 Ga0207690_10254468 Ga0207690_102544684 90
402 3300025932 Ga0207690_10736624 Ga0207690_107366241 90
403 3300025933 Ga0207706_10266250 Ga0207706_102662503 90
404 3300025934 Ga0207686_10093220 Ga0207686_100932204 90
405 3300025935 Ga0207709_10547611 Ga0207709_105476112 90
406 3300025938 Ga0207704_10197207 Ga0207704_101972074 90
407 3300025940 Ga0207691_11519876 Ga0207691_115198761 90
408 3300025940 Ga0207691_11520435 Ga0207691_115204352 90
409 3300025941 Ga0207711_10053178 Ga0207711_100531783 90
410 3300025941 Ga0207711_11195400 Ga0207711_111954002 90
411 3300025944 Ga0207661_10012308 Ga0207661_100123085 90
412 3300025961 Ga0207712_11605380 Ga0207712_116053802 90
413 3300025981 Ga0207640_11929341 Ga0207640_119293412 90
414 3300025986 Ga0207658_10534881 Ga0207658_105348812 90
415 3300026023 Ga0207677_10100110 Ga0207677_101001104 90
416 3300026035 Ga0207703_10045825 Ga0207703_100458256 90
417 3300026035 Ga0207703_11809146 Ga0207703_118091462 90
418 3300026075 Ga0207708_10449780 Ga0207708_104497802 90
419 3300026078 Ga0207702_10171726 Ga0207702_101717261 90
420 3300026088 Ga0207641_10246594 Ga0207641_102465943 90
421 3300026088 Ga0207641_10356163 Ga0207641_103561632 90
422 3300026089 Ga0207648_10355543 Ga0207648_103555432 90
423 3300026095 Ga0207676_10685769 Ga0207676_106857692 90
424 3300026118 Ga0207675_100811509 Ga0207675_1008115092 90
425 3300026142 Ga0207698_10729039 Ga0207698_107290392 90
426 3300027866 Ga0209813_10085216 Ga0209813_100852163 90
427 3300027907 Ga0207428_10190627 Ga0207428_101906271 90
428 3300027907 Ga0207428_10574573 Ga0207428_105745733 90
429 3300027907 Ga0207428_11119984 Ga0207428_111199842 90
430 3300028379 Ga0268266_10015800 Ga0268266_100158002 90
431 3300028380 Ga0268265_12449760 Ga0268265_124497601 90
432 3300028381 Ga0268264_10387130 Ga0268264_103871302 90
433 3300028381 Ga0268264_11025379 Ga0268264_110253792 90
434 3300032002 Ga0307416_101660332 Ga0307416_1016603322 90
435 3300035410 Ga0373924_0050038 Ga0373924_0050038_583_855 90
436 3300035692 Ga0373935_0881194 Ga0373935_0881194_154_426 90
437 3300037068 Ga0373925_1133548 Ga0373925_1133548_299_571 90
438 3300039437 Ga0436365_0113116 Ga0436365_0113116_1048_1320 90
439 3300041512 Ga0451853_0056793 Ga0451853_0056793_441_713 90
440 3300041512 Ga0451853_3602046 Ga0451853_3602046_215_487 90
441 3300042876 Ga0451577_0872012 Ga0451577_0872012_25_300 90
442 3300044706 Ga0466964_0548184 Ga0466964_0548184_163_435 90
443 3300044712 Ga0453684_1657409 Ga0453684_1657409_290_565 90
444 3300045051 Ga0451576_1267853 Ga0451576_1267853_456_728 90
445 3300045051 Ga0451576_2746805 Ga0451576_2746805_71_343 90
446 3300045976 Ga0466967_0212063 Ga0466967_0212063_56_328 90
447 3300046459 Ga0495629_0165632 Ga0495629_0165632_507_779 90
448 3300046460 Ga0495638_0003582 Ga0495638_0003582_1324_1596 90
449 3300046475 Ga0495639_0163388 Ga0495639_0163388_347_619 90
450 3300046476 Ga0495662_0644877 Ga0495662_0644877_205_477 90
451 3300046477 Ga0495664_0869783 Ga0495664_0869783_198_470 90
452 3300046499 Ga0495594_0235853 Ga0495594_0235853_333_605 90
453 3300046501 Ga0495607_0382971 Ga0495607_0382971_310_582 90
454 3300046533 Ga0495640_0603174 Ga0495640_0603174_296_568 90
455 3300046539 Ga0495621_0190859 Ga0495621_0190859_522_794 90
456 3300046559 Ga0495667_0248713 Ga0495667_0248713_624_896 90
457 3300046663 Ga0495635_0410209 Ga0495635_0410209_606_878 90
458 3300046678 Ga0495599_0060880 Ga0495599_0060880_1905_2177 90
459 3300046678 Ga0495599_0133559 Ga0495599_0133559_1114_1386 90
460 3300046681 Ga0495647_0097366 Ga0495647_0097366_654_926 90
461 3300046683 Ga0495658_0064656 Ga0495658_0064656_741_1013 90
462 3300046809 Ga0495600_0701534 Ga0495600_0701534_189_461 90
463 3300047322 Ga0495680_0334340 Ga0495680_0334340_532_804 90
464 3300048907 Ga0496104_0146666 Ga0496104_0146666_1831_2103 90
465 3300048917 Ga0496114_0187739 Ga0496114_0187739_55_327 90
466 3300048918 Ga0496115_0028623 Ga0496115_0028623_1562_1834 90
467 3300049571 Ga0501034_0006113 Ga0501034_0006113_1938_2210 90
468 3300049574 Ga0501038_0516592 Ga0501038_0516592_570_842 90
469 3300049576 Ga0501040_0428012 Ga0501040_0428012_574_846 90
470 3300049576 Ga0501040_0974943 Ga0501040_0974943_77_349 90
471 3300049583 Ga0501067_0379039 Ga0501067_0379039_458_730 90
472 3300049585 Ga0501069_0895520 Ga0501069_0895520_116_388 90
473 3300049585 Ga0501069_0957346 Ga0501069_0957346_14_286 90
474 3300049587 Ga0501071_0823465 Ga0501071_0823465_410_682 90
475 3300049588 Ga0501072_0850195 Ga0501072_0850195_64_336 90
476 3300049590 Ga0501074_0162251 Ga0501074_0162251_886_1158 90
477 3300049590 Ga0501074_0684422 Ga0501074_0684422_50_322 90
478 3300049591 Ga0501075_0104298 Ga0501075_0104298_906_1178 90
479 3300049592 Ga0501076_0306645 Ga0501076_0306645_991_1263 90
480 3300049592 Ga0501076_0323568 Ga0501076_0323568_974_1246 90
481 3300049593 Ga0501077_0184000 Ga0501077_0184000_571_843 90
482 3300049741 Ga0501079_0035909 Ga0501079_0035909_2627_2899 90
483 3300049742 Ga0501080_0287010 Ga0501080_0287010_710_982 90
484 3300049743 Ga0501081_0843868 Ga0501081_0843868_377_649 90
485 3300049824 Ga0501045_1085318 Ga0501045_1085318_95_367 90
486 3300050489 nmdc:mga03683_11941_c1 nmdc:mga03683_11941_c1_410_682 90
487 3300050489 nmdc:mga03683_383738_c1 nmdc:mga03683_383738_c1_44_316 90
488 3300050491 nmdc:mga00v17_581074_c1 nmdc:mga00v17_581074_c1_364_636 90
489 3300050491 nmdc:mga00v17_59698_c1 nmdc:mga00v17_59698_c1_1195_1467 90
490 3300050492 nmdc:mga0yw44_78290_c1 nmdc:mga0yw44_78290_c1_1559_1831 90
491 3300050493 nmdc:mga0k408_290120_c1 nmdc:mga0k408_290120_c1_615_887 90
492 3300050493 nmdc:mga0k408_6905_c1 nmdc:mga0k408_6905_c1_3973_4245 90
493 3300050494 nmdc:mga06z11_18241_c1 nmdc:mga06z11_18241_c1_69_341 90
494 3300050494 nmdc:mga06z11_294816_c1 nmdc:mga06z11_294816_c1_584_856 90
495 3300050494 nmdc:mga06z11_88085_c1 nmdc:mga06z11_88085_c1_519_791 90
496 3300050495 nmdc:mga04h51_72200_c1 nmdc:mga04h51_72200_c1_664_936 90
497 3300050507 nmdc:mga05p37_1678819_c1 nmdc:mga05p37_1678819_c1_78_350 90
498 3300050507 nmdc:mga05p37_30866_c1 nmdc:mga05p37_30866_c1_960_1232 90
499 3300050507 nmdc:mga05p37_41627_c1 nmdc:mga05p37_41627_c1_4153_4425 90
500 3300050507 nmdc:mga05p37_494868_c1 nmdc:mga05p37_494868_c1_1116_1388 90
501 3300050507 nmdc:mga05p37_582884_c1 nmdc:mga05p37_582884_c1_284_559 90
502 3300050507 nmdc:mga05p37_6745_c1 nmdc:mga05p37_6745_c1_7697_7969 90
503 3300050507 nmdc:mga05p37_89734_c1 nmdc:mga05p37_89734_c1_315_587 90
504 3300050508 nmdc:mga09592_1525523_c1 nmdc:mga09592_1525523_c1_169_441 90
505 3300050510 nmdc:mga06r32_521401_c1 nmdc:mga06r32_521401_c1_147_419 90
506 3300050511 nmdc:mga08y16_403451_c1 nmdc:mga08y16_403451_c1_290_562 90
507 3300050511 nmdc:mga08y16_533867_c1 nmdc:mga08y16_533867_c1_576_851 90
508 3300050511 nmdc:mga08y16_657189_c1 nmdc:mga08y16_657189_c1_723_995 90
509 3300050512 nmdc:mga0n895_152513_c1 nmdc:mga0n895_152513_c1_915_1190 90
510 3300050512 nmdc:mga0n895_186941_c1 nmdc:mga0n895_186941_c1_1508_1780 90
511 3300050512 nmdc:mga0n895_805045_c1 nmdc:mga0n895_805045_c1_173_445 90
512 3300050512 nmdc:mga0n895_95_c1 nmdc:mga0n895_95_c1_9659_9931 90
513 3300050513 nmdc:mga0rr50_165429_c1 nmdc:mga0rr50_165429_c1_1393_1665 90
514 3300050513 nmdc:mga0rr50_17771_c1 nmdc:mga0rr50_17771_c1_4110_4382 90
515 3300050513 nmdc:mga0rr50_28_c1 nmdc:mga0rr50_28_c1_50409_50681 90
516 3300050513 nmdc:mga0rr50_706771_c1 nmdc:mga0rr50_706771_c1_52_327 90
517 3300050514 nmdc:mga08x19_121_c1 nmdc:mga08x19_121_c1_30197_30469 90
518 3300050514 nmdc:mga08x19_318640_c1 nmdc:mga08x19_318640_c1_711_983 90
519 3300050515 nmdc:mga0a205_160653_c1 nmdc:mga0a205_160653_c1_1217_1492 90
520 3300050515 nmdc:mga0a205_275666_c1 nmdc:mga0a205_275666_c1_885_1157 90
521 3300050515 nmdc:mga0a205_328334_c1 nmdc:mga0a205_328334_c1_883_1155 90
522 3300050515 nmdc:mga0a205_809171_c1 nmdc:mga0a205_809171_c1_29_301 90
523 3300053084 Ga0495595_0300677 Ga0495595_0300677_344_616 90
524 3300054114 Ga0501084_0980842 Ga0501084_0980842_49_321 90
525 3300005290 Ga0065712_10570827 Ga0065712_105708272 91
526 3300005333 Ga0070677_10610927 Ga0070677_106109271 91
527 3300005335 Ga0070666_10032233 Ga0070666_100322335 91
528 3300005355 Ga0070671_101636265 Ga0070671_1016362651 91
529 3300005356 Ga0070674_100358939 Ga0070674_1003589393 91
530 3300005455 Ga0070663_100390052 Ga0070663_1003900523 91
531 3300005457 Ga0070662_101320005 Ga0070662_1013200052 91
532 3300005459 Ga0068867_100973207 Ga0068867_1009732071 91
533 3300005535 Ga0070684_101177090 Ga0070684_1011770901 91
534 3300005544 Ga0070686_101965881 Ga0070686_1019658811 91
535 3300005546 Ga0070696_100043573 Ga0070696_1000435734 91
536 3300005548 Ga0070665_100092857 Ga0070665_1000928573 91
537 3300005548 Ga0070665_101085551 Ga0070665_1010855512 91
538 3300005718 Ga0068866_10051426 Ga0068866_100514264 91
539 3300005985 Ga0081539_10000025 Ga0081539_1000002534 91
540 3300006178 Ga0075367_10501167 Ga0075367_105011673 91
541 3300006237 Ga0097621_101178629 Ga0097621_1011786291 91
542 3300006844 Ga0075428_100335992 Ga0075428_1003359923 91
543 3300006847 Ga0075431_100014795 Ga0075431_1000147953 91
544 3300006847 Ga0075431_102175835 Ga0075431_1021758351 91
545 3300006847 Ga0075431_102215036 Ga0075431_1022150362 91
546 3300006946 Ga0079104_1000103 Ga0079104_100010394 91
547 3300007076 Ga0075435_100335604 Ga0075435_1003356042 91
548 3300009098 Ga0105245_10794793 Ga0105245_107947933 91
549 3300009147 Ga0114129_10007233 Ga0114129_1000723315 91
550 3300009147 Ga0114129_10339813 Ga0114129_103398132 91
551 3300009174 Ga0105241_11413370 Ga0105241_114133701 91
552 3300009176 Ga0105242_10690648 Ga0105242_106906482 91
553 3300009176 Ga0105242_11465541 Ga0105242_114655412 91
554 3300009553 Ga0105249_12436284 Ga0105249_124362842 91
555 3300013297 Ga0157378_10155036 Ga0157378_101550363 91
556 3300021388 Ga0213875_10000043 Ga0213875_1000004323 91
557 3300025899 Ga0207642_10167053 Ga0207642_101670532 91
558 3300025925 Ga0207650_10363099 Ga0207650_103630994 91
559 3300025933 Ga0207706_10822047 Ga0207706_108220472 91
560 3300025934 Ga0207686_11565148 Ga0207686_115651482 91
561 3300025937 Ga0207669_10319149 Ga0207669_103191493 91
562 3300025939 Ga0207665_11675220 Ga0207665_116752201 91
563 3300025981 Ga0207640_11810564 Ga0207640_118105642 91
564 3300026067 Ga0207678_10402467 Ga0207678_104024673 91
565 3300026089 Ga0207648_10878831 Ga0207648_108788313 91
566 3300027111 Ga0209281_1000512 Ga0209281_100051216 91
567 3300027717 Ga0209998_10071622 Ga0209998_100716223 91
568 3300028379 Ga0268266_10165303 Ga0268266_101653032 91
569 3300028379 Ga0268266_10801061 Ga0268266_108010612 91
570 3300031456 Ga0307513_10213788 Ga0307513_102137883 91
571 3300031852 Ga0307410_10458030 Ga0307410_104580303 91
572 3300031852 Ga0307410_12101196 Ga0307410_121011962 91
573 3300031911 Ga0307412_10111430 Ga0307412_101114302 91
574 3300031911 Ga0307412_11145685 Ga0307412_111456852 91
575 3300031995 Ga0307409_100254717 Ga0307409_1002547175 91
576 3300032002 Ga0307416_100445454 Ga0307416_1004454543 91
577 3300032002 Ga0307416_101056563 Ga0307416_1010565631 91
578 3300032002 Ga0307416_101423735 Ga0307416_1014237352 91
579 3300032002 Ga0307416_101886309 Ga0307416_1018863093 91
580 3300032005 Ga0307411_10465514 Ga0307411_104655142 91
581 3300035241 Ga0373961_0438960 Ga0373961_0438960_37_315 91
582 3300037853 Ga0436364_0413139 Ga0436364_0413139_230621_230905 91
583 3300041997 Ga0439431_0091320 Ga0439431_0091320_523_798 91
584 3300042156 Ga0439446_0245403 Ga0439446_0245403_69_347 91
585 3300045051 Ga0451576_0280843 Ga0451576_0280843_484_759 91
586 3300045051 Ga0451576_0548805 Ga0451576_0548805_637_927 91
587 3300046558 Ga0495633_0155189 Ga0495633_0155189_126_401 91
588 3300046648 Ga0495611_0418074 Ga0495611_0418074_312_587 91
589 3300048904 Ga0496101_1261968 Ga0496101_1261968_229_504 91
590 3300048905 Ga0496102_0702480 Ga0496102_0702480_89_364 91
591 3300048912 Ga0496109_0142700 Ga0496109_0142700_1181_1456 91
592 3300048915 Ga0496112_0158836 Ga0496112_0158836_1239_1514 91
593 3300048924 Ga0496121_0017161 Ga0496121_0017161_5048_5341 91
594 3300048927 Ga0496124_0017108 Ga0496124_0017108_2156_2449 91
595 3300049568 Ga0501031_0108509 Ga0501031_0108509_350_628 91
596 3300049572 Ga0501036_0395912 Ga0501036_0395912_390_668 91
597 3300049575 Ga0501039_0059409 Ga0501039_0059409_459_737 91
598 3300049576 Ga0501040_0348611 Ga0501040_0348611_466_744 91
599 3300049576 Ga0501040_0878674 Ga0501040_0878674_116_394 91
600 3300049577 Ga0501041_0602352 Ga0501041_0602352_371_649 91
601 3300049580 Ga0501046_0187403 Ga0501046_0187403_46_324 91
602 3300049580 Ga0501046_0654524 Ga0501046_0654524_335_610 91
603 3300049582 Ga0501048_0054902 Ga0501048_0054902_2431_2709 91
604 3300049582 Ga0501048_0110951 Ga0501048_0110951_166_447 91
605 3300049584 Ga0501068_0437674 Ga0501068_0437674_200_478 91
606 3300049587 Ga0501071_0035635 Ga0501071_0035635_740_1018 91
607 3300049588 Ga0501072_0347587 Ga0501072_0347587_392_670 91
608 3300049588 Ga0501072_0529226 Ga0501072_0529226_542_817 91
609 3300049588 Ga0501072_0611824 Ga0501072_0611824_489_767 91
610 3300049588 Ga0501072_0915201 Ga0501072_0915201_18_296 91
611 3300049589 Ga0501073_0548171 Ga0501073_0548171_437_715 91
612 3300049591 Ga0501075_0037021 Ga0501075_0037021_2762_3040 91
613 3300049591 Ga0501075_0183380 Ga0501075_0183380_498_776 91
614 3300049592 Ga0501076_0056689 Ga0501076_0056689_2499_2777 91
615 3300049592 Ga0501076_1156952 Ga0501076_1156952_172_447 91
616 3300049593 Ga0501077_0086806 Ga0501077_0086806_1402_1680 91
617 3300049741 Ga0501079_0054982 Ga0501079_0054982_223_501 91
618 3300049743 Ga0501081_0063454 Ga0501081_0063454_1036_1314 91
619 3300049743 Ga0501081_0341504 Ga0501081_0341504_95_373 91
620 3300049822 Ga0501035_0104196 Ga0501035_0104196_647_925 91
621 3300049824 Ga0501045_0037298 Ga0501045_0037298_573_851 91
622 3300049824 Ga0501045_0520873 Ga0501045_0520873_205_483 91
623 3300050491 nmdc:mga00v17_791888_c1 nmdc:mga00v17_791888_c1_260_550 91
624 3300050507 nmdc:mga05p37_41627_c1 nmdc:mga05p37_41627_c1_3605_3880 91
625 3300050510 nmdc:mga06r32_1242647_c1 nmdc:mga06r32_1242647_c1_169_447 91
626 3300050510 nmdc:mga06r32_1384744_c1 nmdc:mga06r32_1384744_c1_228_518 91
627 3300050510 nmdc:mga06r32_36771_c1 nmdc:mga06r32_36771_c1_4340_4615 91
628 3300050513 nmdc:mga0rr50_165429_c1 nmdc:mga0rr50_165429_c1_845_1120 91
629 3300050515 nmdc:mga0a205_111836_c1 nmdc:mga0a205_111836_c1_1821_2102 91
630 3300053116 Ga0500592_049854 Ga0500592_049854_262_543 91
631 3300053125 Ga0500618_000025 Ga0500618_000025_24912_25205 91
632 3300054114 Ga0501084_0855243 Ga0501084_0855243_376_654 91
633 3300054114 Ga0501084_1429638 Ga0501084_1429638_89_364 91
634 3300060353 Ga0501082_0047449 Ga0501082_0047449_729_1007 91
635 3300061734 Ga0530510_0243740 Ga0530510_0243740_497_775 91
636 3300061734 Ga0530510_0736926 Ga0530510_0736926_303_578 91
637 3300005288 Ga0065714_10191579 Ga0065714_101915792 92
638 3300005290 Ga0065712_10334447 Ga0065712_103344472 92
639 3300005293 Ga0065715_10822905 Ga0065715_108229051 92
640 3300005331 Ga0070670_100047682 Ga0070670_1000476825 92
641 3300005341 Ga0070691_10833362 Ga0070691_108333621 92
642 3300005356 Ga0070674_100097298 Ga0070674_1000972985 92
643 3300005444 Ga0070694_101452122 Ga0070694_1014521221 92
644 3300005458 Ga0070681_10283684 Ga0070681_102836843 92
645 3300005518 Ga0070699_100969841 Ga0070699_1009698412 92
646 3300005518 Ga0070699_101677239 Ga0070699_1016772391 92
647 3300005530 Ga0070679_100177486 Ga0070679_1001774862 92
648 3300005536 Ga0070697_101164493 Ga0070697_1011644932 92
649 3300005544 Ga0070686_101631728 Ga0070686_1016317281 92
650 3300005549 Ga0070704_100647550 Ga0070704_1006475503 92
651 3300005618 Ga0068864_100732842 Ga0068864_1007328421 92
652 3300006237 Ga0097621_100069168 Ga0097621_1000691684 92
653 3300006358 Ga0068871_100406573 Ga0068871_1004065734 92
654 3300006847 Ga0075431_101004696 Ga0075431_1010046962 92
655 3300006852 Ga0075433_10252342 Ga0075433_102523423 92
656 3300009094 Ga0111539_10269287 Ga0111539_102692874 92
657 3300009147 Ga0114129_10004267 Ga0114129_1000426714 92
658 3300009551 Ga0105238_11125985 Ga0105238_111259853 92
659 3300009553 Ga0105249_10530356 Ga0105249_105303563 92
660 3300013105 Ga0157369_12014540 Ga0157369_120145402 92
661 3300013307 Ga0157372_11982882 Ga0157372_119828821 92
662 3300014326 Ga0157380_10032772 Ga0157380_100327725 92
663 3300014969 Ga0157376_10593640 Ga0157376_105936402 92
664 3300021384 Ga0213876_10430704 Ga0213876_104307042 92
665 3300025912 Ga0207707_10332540 Ga0207707_103325402 92
666 3300025912 Ga0207707_10423828 Ga0207707_104238284 92
667 3300025921 Ga0207652_10183004 Ga0207652_101830043 92
668 3300025926 Ga0207659_10187372 Ga0207659_101873723 92
669 3300025937 Ga0207669_10593369 Ga0207669_105933691 92
670 3300025939 Ga0207665_10481108 Ga0207665_104811081 92
671 3300025942 Ga0207689_10414082 Ga0207689_104140821 92
672 3300025960 Ga0207651_11755637 Ga0207651_117556372 92
673 3300025961 Ga0207712_11391467 Ga0207712_113914672 92
674 3300026116 Ga0207674_11862237 Ga0207674_118622372 92
675 3300027907 Ga0207428_10262616 Ga0207428_102626162 92
676 3300031548 Ga0307408_100789016 Ga0307408_1007890161 92
677 3300031995 Ga0307409_102975689 Ga0307409_1029756892 92
678 3300032002 Ga0307416_100893111 Ga0307416_1008931113 92
679 3300032002 Ga0307416_101095319 Ga0307416_1010953193 92
680 3300035207 Ga0373942_0374266 Ga0373942_0374266_125_403 92
681 3300039437 Ga0436365_1621027 Ga0436365_1621027_527_805 92
682 3300042156 Ga0439446_0279182 Ga0439446_0279182_33_311 92
683 3300042439 Ga0439464_0208484 Ga0439464_0208484_161_439 92
684 3300042461 Ga0439460_0028314 Ga0439460_0028314_693_971 92
685 3300049589 Ga0501073_0424115 Ga0501073_0424115_15_329 92
686 3300050507 nmdc:mga05p37_2454_c1 nmdc:mga05p37_2454_c1_12338_12616 92
687 3300050511 nmdc:mga08y16_1975598_c1 nmdc:mga08y16_1975598_c1_222_500 92
688 3300053094 Ga0500566_0492841 Ga0500566_0492841_37_324 92
689 3300054114 Ga0501084_0926358 Ga0501084_0926358_258_614 92
690 3300060353 Ga0501082_1397468 Ga0501082_1397468_18_323 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

17

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hd3-assembly2.cif.gz_J crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316 0.8919 1 88
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8817 1 88
6jy5-assembly1.cif.gz_A structure of csos4b from halothiobacillus neapolitanus 0.8793 1 84
2qw7-assembly1.cif.gz_D carboxysome subunit, ccml 0.8754 1 88
6owg-assembly1.cif.gz_DR structure of a synthetic beta-carboxysome shell, t=4 0.8729 1 88
ID Description Score Start End Superfamily
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8817 1 88 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8721 1 88 2.40.50.220
2rcfD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.86 1 84 2.40.50.220
5l37D00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8529 1 83 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8506 1 88 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A355SU97-F1-model_v4 Ethanolamine utilization protein EutN 0.9366 1 84 GO:0031469
AF-A0A2N2H2F5-F1-model_v4 Ethanolamine utilization protein EutN 0.9354 1 88 GO:0031469
AF-A0A356KDP8-F1-model_v4 Ethanolamine utilization protein EutN 0.9342 1 90 GO:0031469
AF-A0A3N5X188-F1-model_v4 Ethanolamine utilization protein EutN 0.9329 2 55 GO:0031469
AF-A0A2V2C1Z3-F1-model_v4 Ethanolamine utilization protein EutN 0.9307 1 85 GO:0031469

Feature Viewer

pLDDT pTM Quality
90.3 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map