F475423

General Info

Members Datasets Scaffolds Average Seq Length
690 324 1380 140

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10292143|Ga0070666_102921432
Length 160
Sequence VAGGRSYECWRNLHTGDPHEKRVLFVATVAAVALASFGFANRAPQPYRVVFDLTSRDSLDQKAVVRWIKEVTTSSPTADIEVVMYAKGFELVMPDKSTVLADVQNAIKNPKVSFKVCAIAMKNNNIEKTQLLPGVQVVPDGIHELVMKQQENWGYIKAVH

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
109 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
110 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
111 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
280 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
281 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
282 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
283 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
286 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
287 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
288 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
292 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
293 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
294 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
295 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
296 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
297 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
298 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
299 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
300 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
301 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
302 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
305 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
306 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
307 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
308 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
309 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
310 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
311 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
312 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
313 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 2.75
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 26.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10292143 3300005335 Unclassified 1160
2 MBSR1b_contig_11558287 2162886012 Bacteria 952
3 JGI24737J22298_10172342 3300001990 Bacteria 639
4 Ga0065704_10215893 3300005289 Bacteria 1091
5 Ga0065712_10023321 3300005290 Bacteria 1358
6 Ga0065712_10052932 3300005290 Bacteria 651
7 Ga0065715_10140548 3300005293 Bacteria 1861
8 Ga0065715_10243080 3300005293 Bacteria 1192
9 Ga0065707_10088979 3300005295 Bacteria 4499
10 Ga0065707_10424919 3300005295 Bacteria 814
11 Ga0070658_11704657 3300005327 Unclassified 545
12 Ga0070676_10006221 3300005328 Bacteria 6377
13 Ga0070676_10026274 3300005328 Bacteria 3296
14 Ga0070676_10457461 3300005328 Bacteria 899
15 Ga0070683_100003180 3300005329 Bacteria 13247
16 Ga0070683_100012221 3300005329 Bacteria 7454
17 Ga0070683_100048411 3300005329 Unclassified 3930
18 Ga0070683_100098017 3300005329 Bacteria 2758
19 Ga0070683_100254174 3300005329 Bacteria 1671
20 Ga0070683_101584291 3300005329 Unclassified 630
21 Ga0070690_100144937 3300005330 Bacteria 1615
22 Ga0070690_100376651 3300005330 Bacteria 1037
23 Ga0070670_100013920 3300005331 Bacteria 6898
24 Ga0070670_100257356 3300005331 Bacteria 1521
25 Ga0070677_10272953 3300005333 Bacteria 849
26 Ga0070677_10538734 3300005333 Bacteria 638
27 Ga0068869_100022412 3300005334 Bacteria 4353
28 Ga0068869_100122714 3300005334 Unclassified 1989
29 Ga0070666_10285243 3300005335 Bacteria 1174
30 Ga0070666_10421843 3300005335 Bacteria 961
31 Ga0070666_10902427 3300005335 Unclassified 653
32 Ga0070680_100005405 3300005336 Bacteria 9671
33 Ga0070680_100021970 3300005336 Bacteria 5075
34 Ga0070680_100959833 3300005336 Unclassified 738
35 Ga0070682_100880320 3300005337 Unclassified 734
36 Ga0070682_101881582 3300005337 Unclassified 524
37 Ga0068868_100006383 3300005338 Bacteria 8342
38 Ga0068868_100056712 3300005338 Bacteria 3093
39 Ga0068868_100078813 3300005338 Bacteria 2638
40 Ga0068868_100312003 3300005338 Unclassified 1338
41 Ga0068868_100485986 3300005338 Bacteria 1079
42 Ga0070660_100516148 3300005339 Bacteria 995
43 Ga0070660_101914899 3300005339 Unclassified 505
44 Ga0070689_100051789 3300005340 Unclassified 3173
45 Ga0070689_100135731 3300005340 Bacteria 1975
46 Ga0070691_10235371 3300005341 Unclassified 976
47 Ga0070687_100003780 3300005343 Bacteria 5934
48 Ga0070687_100045253 3300005343 Bacteria 2246
49 Ga0070661_100016249 3300005344 Bacteria 5259
50 Ga0070692_10018235 3300005345 Bacteria 3371
51 Ga0070692_10040765 3300005345 Bacteria 2376
52 Ga0070668_100006976 3300005347 Bacteria 8367
53 Ga0070668_100068006 3300005347 Bacteria 2768
54 Ga0070668_100120917 3300005347 Unclassified 2093
55 Ga0070668_100612487 3300005347 Bacteria 954
56 Ga0070668_100974316 3300005347 Unclassified 761
57 Ga0070669_100011129 3300005353 Bacteria 6385
58 Ga0070669_100847637 3300005353 Unclassified 779
59 Ga0070669_101039253 3300005353 Unclassified 704
60 Ga0070669_101244397 3300005353 Bacteria 644
61 Ga0070675_100156240 3300005354 Bacteria 1958
62 Ga0070671_100630139 3300005355 Bacteria 928
63 Ga0070671_101151412 3300005355 Bacteria 682
64 Ga0070674_100069380 3300005356 Bacteria 2487
65 Ga0070674_100079117 3300005356 Bacteria 2344
66 Ga0070674_100087262 3300005356 Bacteria 2243
67 Ga0070673_100265615 3300005364 Bacteria 1500
68 Ga0070673_100570313 3300005364 Bacteria 1030
69 Ga0070673_100855398 3300005364 Bacteria 842
70 Ga0070688_100031201 3300005365 Bacteria 3205
71 Ga0070688_100230237 3300005365 Bacteria 1310
72 Ga0070688_100836664 3300005365 Bacteria 722
73 Ga0070659_100062749 3300005366 Bacteria 2938
74 Ga0070667_100038819 3300005367 Bacteria 3991
75 Ga0070667_100099004 3300005367 Unclassified 2516
76 Ga0070667_100387965 3300005367 Bacteria 1269
77 Ga0070667_100551840 3300005367 Bacteria 1059
78 Ga0070667_101172926 3300005367 Unclassified 719
79 Ga0070667_101259925 3300005367 Unclassified 692
80 Ga0070667_101713615 3300005367 Bacteria 591
81 Ga0070667_101765514 3300005367 Bacteria 582
82 Ga0070703_10253352 3300005406 Unclassified 715
83 Ga0070709_10004134 3300005434 Bacteria 7829
84 Ga0070709_10055247 3300005434 Bacteria 2506
85 Ga0070713_100381759 3300005436 Bacteria 1313
86 Ga0070710_10210050 3300005437 Bacteria 1233
87 Ga0070710_10358529 3300005437 Unclassified 967
88 Ga0070701_10090668 3300005438 Unclassified 1674
89 Ga0070711_100059443 3300005439 Bacteria 2654
90 Ga0070711_100159615 3300005439 Unclassified 1708
91 Ga0070711_100318690 3300005439 Bacteria 1241
92 Ga0070705_100258727 3300005440 Unclassified 1226
93 Ga0070700_100004441 3300005441 Bacteria 7328
94 Ga0070700_100010421 3300005441 Bacteria 5132
95 Ga0070700_100229241 3300005441 Bacteria 1321
96 Ga0070700_100350729 3300005441 Bacteria 1094
97 Ga0070700_100394427 3300005441 Bacteria 1039
98 Ga0070700_100809162 3300005441 Unclassified 755
99 Ga0070694_100105385 3300005444 Bacteria 2001
100 Ga0070694_100106875 3300005444 Bacteria 1988
101 Ga0070694_101803712 3300005444 Unclassified 521
102 Ga0070708_101558637 3300005445 Bacteria 615
103 Ga0070663_100121231 3300005455 Bacteria 1975
104 Ga0070663_100579190 3300005455 Unclassified 941
105 Ga0070663_100887673 3300005455 Unclassified 769
106 Ga0070678_101308036 3300005456 Bacteria 675
107 Ga0070662_100010096 3300005457 Bacteria 6185
108 Ga0070662_100417211 3300005457 Bacteria 1110
109 Ga0070662_101357551 3300005457 Bacteria 612
110 Ga0070681_10008403 3300005458 Bacteria 10109
111 Ga0070681_10147486 3300005458 Bacteria 2281
112 Ga0070681_10230400 3300005458 Bacteria 1767
113 Ga0068867_100029095 3300005459 Bacteria 3981
114 Ga0068867_100036452 3300005459 Bacteria 3570
115 Ga0070685_10003180 3300005466 Bacteria 8354
116 Ga0070685_10059432 3300005466 Bacteria 2232
117 Ga0070706_100426074 3300005467 Bacteria 1235
118 Ga0070706_100773009 3300005467 Unclassified 889
119 Ga0070707_100698791 3300005468 Unclassified 977
120 Ga0070698_100035165 3300005471 Bacteria 5181
121 Ga0070698_100281756 3300005471 Bacteria 1594
122 Ga0070698_100319254 3300005471 Bacteria 1484
123 Ga0070698_100469821 3300005471 Unclassified 1194
124 Ga0070698_100972641 3300005471 Unclassified 795
125 Ga0070698_101460708 3300005471 Unclassified 635
126 Ga0070699_100946630 3300005518 Unclassified 789
127 Ga0070699_101555533 3300005518 Unclassified 606
128 Ga0070679_100000310 3300005530 Bacteria 41296
129 Ga0070679_100998038 3300005530 Bacteria 781
130 Ga0070684_100018401 3300005535 Bacteria 5756
131 Ga0070684_100054608 3300005535 Bacteria 3480
132 Ga0070684_100114787 3300005535 Bacteria 2418
133 Ga0070684_100170744 3300005535 Bacteria 1975
134 Ga0070697_101050321 3300005536 Bacteria 724
135 Ga0070697_101139722 3300005536 Unclassified 694
136 Ga0068853_100498314 3300005539 Bacteria 1150
137 Ga0068853_101131642 3300005539 Unclassified 755
138 Ga0070672_100010502 3300005543 Bacteria 6425
139 Ga0070672_100121604 3300005543 Bacteria 2137
140 Ga0070672_100209071 3300005543 Bacteria 1634
141 Ga0070672_100500493 3300005543 Bacteria 1051
142 Ga0070672_101088865 3300005543 Unclassified 710
143 Ga0070686_100011045 3300005544 Bacteria 5112
144 Ga0070686_100538984 3300005544 Bacteria 911
145 Ga0070695_100003879 3300005545 Bacteria 8723
146 Ga0070695_100155277 3300005545 Bacteria 1601
147 Ga0070695_100210989 3300005545 Bacteria 1394
148 Ga0070695_100389084 3300005545 Bacteria 1054
149 Ga0070695_100653536 3300005545 Unclassified 830
150 Ga0070696_100213010 3300005546 Bacteria 1447
151 Ga0070693_100013238 3300005547 Bacteria 4198
152 Ga0070665_100433215 3300005548 Bacteria 1324
153 Ga0070665_101079155 3300005548 Bacteria 814
154 Ga0070704_100406148 3300005549 Unclassified 1163
155 Ga0068855_100088454 3300005563 Bacteria 3578
156 Ga0068855_100094285 3300005563 Bacteria 3451
157 Ga0068855_100413269 3300005563 Bacteria 1477
158 Ga0068855_100474722 3300005563 Bacteria 1362
159 Ga0068855_102353830 3300005563 Unclassified 532
160 Ga0070664_100037994 3300005564 Bacteria 4050
161 Ga0070664_100090892 3300005564 Bacteria 2642
162 Ga0070664_101146457 3300005564 Bacteria 733
163 Ga0070664_101290591 3300005564 Bacteria 689
164 Ga0068857_100204834 3300005577 Unclassified 1799
165 Ga0068857_100240206 3300005577 Bacteria 1658
166 Ga0068854_100810545 3300005578 Bacteria 817
167 Ga0068854_100854228 3300005578 Unclassified 797
168 Ga0070702_100134186 3300005615 Bacteria 1568
169 Ga0068852_100005474 3300005616 Bacteria 9086
170 Ga0068852_100052548 3300005616 Bacteria 3502
171 Ga0068852_100977814 3300005616 Bacteria 865
172 Ga0068859_100026255 3300005617 Bacteria 5840
173 Ga0068859_100479449 3300005617 Bacteria 1339
174 Ga0068859_100877279 3300005617 Bacteria 983
175 Ga0068864_100711173 3300005618 Unclassified 982
176 Ga0068866_10004837 3300005718 Bacteria 5530
177 Ga0068866_10106670 3300005718 Unclassified 1555
178 Ga0068866_10434386 3300005718 Bacteria 855
179 Ga0068866_10602724 3300005718 Bacteria 742
180 Ga0068861_100001264 3300005719 Bacteria 15777
181 Ga0068861_101905806 3300005719 Unclassified 591
182 Ga0068851_10044965 3300005834 Bacteria 2230
183 Ga0068870_10185235 3300005840 Bacteria 1253
184 Ga0068870_10447757 3300005840 Unclassified 851
185 Ga0068863_100008070 3300005841 Bacteria 10280
186 Ga0068863_100034335 3300005841 Bacteria 4832
187 Ga0068863_100448842 3300005841 Unclassified 1266
188 Ga0068858_100038234 3300005842 Bacteria 4451
189 Ga0068862_100007690 3300005844 Bacteria 8916
190 Ga0068862_100020681 3300005844 Bacteria 5498
191 Ga0068862_100202481 3300005844 Bacteria 1790
192 Ga0068862_100433162 3300005844 Bacteria 1236
193 Ga0068862_101655097 3300005844 Unclassified 648
194 Ga0081455_10083228 3300005937 Unclassified 2615
195 Ga0075432_10085769 3300006058 Bacteria 1147
196 Ga0070716_100003376 3300006173 Bacteria 7508
197 Ga0070716_100204857 3300006173 Bacteria 1314
198 Ga0070716_100280313 3300006173 Bacteria 1150
199 Ga0070712_100086408 3300006175 Bacteria 2286
200 Ga0070712_100114696 3300006175 Bacteria 2017
201 Ga0097621_100033917 3300006237 Bacteria 4068
202 Ga0097621_100197137 3300006237 Unclassified 1746
203 Ga0097621_100511036 3300006237 Bacteria 1089
204 Ga0068871_100052294 3300006358 Bacteria 3308
205 Ga0075428_100097315 3300006844 Unclassified 3208
206 Ga0075428_100709510 3300006844 Unclassified 1071
207 Ga0075428_100759943 3300006844 Bacteria 1031
208 Ga0075428_102420697 3300006844 Unclassified 539
209 Ga0075431_100037873 3300006847 Bacteria 4966
210 Ga0075431_100738176 3300006847 Bacteria 960
211 Ga0075433_10007765 3300006852 Bacteria 8522
212 Ga0075433_10036465 3300006852 Bacteria 4237
213 Ga0075434_100026132 3300006871 Bacteria 5718
214 Ga0075434_100033246 3300006871 Bacteria 5089
215 Ga0075434_100038757 3300006871 Bacteria 4721
216 Ga0075434_100056780 3300006871 Bacteria 3891
217 Ga0075434_100127831 3300006871 Unclassified 2558
218 Ga0075434_101554516 3300006871 Bacteria 670
219 Ga0075429_100032646 3300006880 Bacteria 4525
220 Ga0068865_100003354 3300006881 Bacteria 9593
221 Ga0068865_100071451 3300006881 Bacteria 2462
222 Ga0068865_100191794 3300006881 Bacteria 1581
223 Ga0075436_100010139 3300006914 Bacteria 6451
224 Ga0075436_100420627 3300006914 Bacteria 970
225 Ga0097620_100026256 3300006931 Bacteria 5840
226 Ga0097620_100479464 3300006931 Bacteria 1339
227 Ga0097620_100877260 3300006931 Bacteria 983
228 Ga0075435_100081850 3300007076 Bacteria 2653
229 Ga0075435_100189649 3300007076 Bacteria 1740
230 Ga0075435_100641794 3300007076 Bacteria 921
231 Ga0075435_101370727 3300007076 Unclassified 620
232 Ga0105240_10000646 3300009093 Bacteria 64342
233 Ga0105240_10036046 3300009093 Bacteria 6369
234 Ga0105240_10185831 3300009093 Bacteria 2448
235 Ga0105240_11123713 3300009093 Bacteria 835
236 Ga0105240_11848521 3300009093 Unclassified 629
237 Ga0111539_10020900 3300009094 Bacteria 8060
238 Ga0111539_10113853 3300009094 Unclassified 3173
239 Ga0111539_12494284 3300009094 Unclassified 600
240 Ga0105245_10079515 3300009098 Bacteria 2994
241 Ga0105245_10531609 3300009098 Unclassified 1196
242 Ga0105245_10593159 3300009098 Bacteria 1134
243 Ga0105245_12002687 3300009098 Bacteria 633
244 Ga0105245_12527858 3300009098 Unclassified 567
245 Ga0105247_10448112 3300009101 Unclassified 930
246 Ga0114129_10018598 3300009147 Bacteria 9893
247 Ga0114129_10025654 3300009147 Bacteria 8349
248 Ga0114129_10244370 3300009147 Bacteria 2412
249 Ga0114129_11275464 3300009147 Unclassified 912
250 Ga0105243_10200897 3300009148 Bacteria 1748
251 Ga0105243_11189655 3300009148 Unclassified 775
252 Ga0105243_12940030 3300009148 Bacteria 517
253 Ga0105241_10036726 3300009174 Bacteria 3688
254 Ga0105241_11053882 3300009174 Unclassified 763
255 Ga0105241_11087153 3300009174 Bacteria 752
256 Ga0105242_10033266 3300009176 Bacteria 4127
257 Ga0105242_10167516 3300009176 Bacteria 1928
258 Ga0105242_10525748 3300009176 Bacteria 1130
259 Ga0105248_10028015 3300009177 Bacteria 6275
260 Ga0105248_10161765 3300009177 Bacteria 2525
261 Ga0105248_10375980 3300009177 Unclassified 1599
262 Ga0105248_10536495 3300009177 Bacteria 1320
263 Ga0105248_11509465 3300009177 Bacteria 761
264 Ga0105248_12345339 3300009177 Unclassified 608
265 Ga0105237_10035985 3300009545 Bacteria 5008
266 Ga0105237_10325962 3300009545 Bacteria 1540
267 Ga0105238_10051163 3300009551 Unclassified 4155
268 Ga0105249_10006103 3300009553 Bacteria 10447
269 Ga0105249_10377479 3300009553 Unclassified 1443
270 Ga0105239_10001040 3300010375 Bacteria 38650
271 Ga0105239_10043940 3300010375 Bacteria 4900
272 Ga0105246_10657473 3300011119 Bacteria 913
273 Ga0157319_1012382 3300012497 Bacteria 719
274 Ga0157345_1009276 3300012498 Unclassified 837
275 Ga0157324_1044722 3300012506 Unclassified 555
276 Ga0157327_1045130 3300012512 Bacteria 607
277 Ga0157373_10097066 3300013100 Bacteria 2075
278 Ga0157373_10944779 3300013100 Unclassified 641
279 Ga0157371_10012827 3300013102 Bacteria 6387
280 Ga0157370_10421229 3300013104 Bacteria 1228
281 Ga0157369_10076637 3300013105 Bacteria 3585
282 Ga0157369_10133998 3300013105 Bacteria 2624
283 Ga0157369_10866838 3300013105 Bacteria 927
284 Ga0157374_10352623 3300013296 Bacteria 1462
285 Ga0157378_10001096 3300013297 Bacteria 24704
286 Ga0157378_10018413 3300013297 Bacteria 6133
287 Ga0157378_10326600 3300013297 Bacteria 1492
288 Ga0157378_10326667 3300013297 Unclassified 1492
289 Ga0157378_10355999 3300013297 Bacteria 1431
290 Ga0157378_11136949 3300013297 Bacteria 819
291 Ga0157378_11166859 3300013297 Unclassified 809
292 Ga0163162_10084310 3300013306 Bacteria 3253
293 Ga0163162_10989006 3300013306 Bacteria 951
294 Ga0157372_10054604 3300013307 Bacteria 4457
295 Ga0157372_10121770 3300013307 Bacteria 2997
296 Ga0157372_10424601 3300013307 Bacteria 1549
297 Ga0157372_10438773 3300013307 Bacteria 1522
298 Ga0157372_11035257 3300013307 Bacteria 950
299 Ga0157375_10127130 3300013308 Bacteria 2665
300 Ga0157375_10231096 3300013308 Bacteria 2008
301 Ga0157375_10264158 3300013308 Bacteria 1883
302 Ga0157375_10489007 3300013308 Unclassified 1395
303 Ga0157375_10783708 3300013308 Unclassified 1103
304 Ga0163163_10148492 3300014325 Bacteria 2388
305 Ga0163163_10196567 3300014325 Unclassified 2065
306 Ga0163163_12312706 3300014325 Unclassified 596
307 Ga0157380_10231548 3300014326 Bacteria 1660
308 Ga0157380_10552951 3300014326 Bacteria 1129
309 Ga0157377_10136008 3300014745 Bacteria 1506
310 Ga0157377_10805944 3300014745 Bacteria 693
311 Ga0157377_10892454 3300014745 Unclassified 664
312 Ga0157379_10238752 3300014968 Bacteria 1648
313 Ga0157376_10284377 3300014969 Bacteria 1559
314 Ga0157376_12788586 3300014969 Bacteria 528
315 Ga0163161_10061628 3300017792 Bacteria 2731
316 Ga0163161_11141718 3300017792 Unclassified 671
317 Ga0207697_10361862 3300025315 Bacteria 644
318 Ga0207656_10195154 3300025321 Bacteria 976
319 Ga0207682_10170731 3300025893 Bacteria 989
320 Ga0207692_10063743 3300025898 Bacteria 1916
321 Ga0207692_11101407 3300025898 Unclassified 526
322 Ga0207642_10280588 3300025899 Bacteria 958
323 Ga0207688_10546812 3300025901 Unclassified 727
324 Ga0207680_10063602 3300025903 Bacteria 2259
325 Ga0207680_10399759 3300025903 Bacteria 971
326 Ga0207680_10535495 3300025903 Unclassified 836
327 Ga0207680_10900367 3300025903 Bacteria 634
328 Ga0207647_10273853 3300025904 Bacteria 964
329 Ga0207699_10025347 3300025906 Unclassified 3254
330 Ga0207699_10069606 3300025906 Bacteria 2146
331 Ga0207699_10097334 3300025906 Bacteria 1860
332 Ga0207645_10002412 3300025907 Bacteria 14717
333 Ga0207645_10006775 3300025907 Bacteria 8181
334 Ga0207645_10051684 3300025907 Bacteria 2626
335 Ga0207645_10113941 3300025907 Unclassified 1752
336 Ga0207643_10016260 3300025908 Bacteria 4058
337 Ga0207684_10139711 3300025910 Bacteria 2082
338 Ga0207684_10629155 3300025910 Unclassified 915
339 Ga0207707_10022174 3300025912 Bacteria 5551
340 Ga0207707_10205245 3300025912 Bacteria 1718
341 Ga0207707_10402877 3300025912 Bacteria 1174
342 Ga0207695_10000682 3300025913 Bacteria 66574
343 Ga0207695_10086536 3300025913 Bacteria 3161
344 Ga0207695_10327804 3300025913 Unclassified 1420
345 Ga0207695_10816782 3300025913 Bacteria 812
346 Ga0207671_10212400 3300025914 Bacteria 1514
347 Ga0207693_10062964 3300025915 Bacteria 2906
348 Ga0207663_10035700 3300025916 Bacteria 2985
349 Ga0207663_10232165 3300025916 Unclassified 1349
350 Ga0207660_10089568 3300025917 Bacteria 2277
351 Ga0207660_10347823 3300025917 Unclassified 1188
352 Ga0207660_10567320 3300025917 Unclassified 924
353 Ga0207662_10009121 3300025918 Bacteria 5452
354 Ga0207662_10032845 3300025918 Bacteria 3022
355 Ga0207662_10064280 3300025918 Unclassified 2208
356 Ga0207657_10214807 3300025919 Unclassified 1542
357 Ga0207649_10008301 3300025920 Bacteria 5660
358 Ga0207649_10625271 3300025920 Bacteria 830
359 Ga0207652_10007225 3300025921 Bacteria 8957
360 Ga0207652_10201130 3300025921 Bacteria 1793
361 Ga0207646_10138777 3300025922 Unclassified 2189
362 Ga0207646_10733937 3300025922 Unclassified 882
363 Ga0207646_11367987 3300025922 Unclassified 617
364 Ga0207681_10008029 3300025923 Bacteria 6459
365 Ga0207681_10010295 3300025923 Bacteria 5719
366 Ga0207681_10655931 3300025923 Unclassified 870
367 Ga0207681_10990821 3300025923 Unclassified 705
368 Ga0207681_11270179 3300025923 Unclassified 618
369 Ga0207694_10043263 3300025924 Unclassified 3476
370 Ga0207650_10137437 3300025925 Bacteria 1918
371 Ga0207650_10571336 3300025925 Bacteria 949
372 Ga0207650_10815504 3300025925 Bacteria 791
373 Ga0207659_10116353 3300025926 Bacteria 2041
374 Ga0207687_10018902 3300025927 Bacteria 4557
375 Ga0207687_10356381 3300025927 Bacteria 1193
376 Ga0207687_10435750 3300025927 Unclassified 1084
377 Ga0207687_11615379 3300025927 Unclassified 556
378 Ga0207700_10504441 3300025928 Bacteria 1071
379 Ga0207664_11486702 3300025929 Unclassified 599
380 Ga0207644_10149279 3300025931 Bacteria 1808
381 Ga0207690_10055294 3300025932 Bacteria 2672
382 Ga0207690_11101006 3300025932 Bacteria 662
383 Ga0207706_10000748 3300025933 Bacteria 33862
384 Ga0207706_10002730 3300025933 Bacteria 17203
385 Ga0207706_10168343 3300025933 Unclassified 1926
386 Ga0207686_10123309 3300025934 Bacteria 1767
387 Ga0207686_10142375 3300025934 Bacteria 1659
388 Ga0207670_10058200 3300025936 Bacteria 2624
389 Ga0207670_10414872 3300025936 Bacteria 1079
390 Ga0207669_10084646 3300025937 Bacteria 2044
391 Ga0207669_10094767 3300025937 Unclassified 1955
392 Ga0207669_10129786 3300025937 Unclassified 1729
393 Ga0207669_10382374 3300025937 Bacteria 1097
394 Ga0207669_11091627 3300025937 Bacteria 673
395 Ga0207704_10010016 3300025938 Bacteria 4601
396 Ga0207704_10180264 3300025938 Bacteria 1526
397 Ga0207704_10597166 3300025938 Unclassified 903
398 Ga0207704_11278317 3300025938 Unclassified 627
399 Ga0207665_10000973 3300025939 Bacteria 19387
400 Ga0207665_10100716 3300025939 Bacteria 2016
401 Ga0207691_10003034 3300025940 Bacteria 16380
402 Ga0207691_10044015 3300025940 Bacteria 4111
403 Ga0207691_10133559 3300025940 Bacteria 2191
404 Ga0207691_10583452 3300025940 Bacteria 947
405 Ga0207691_10676457 3300025940 Bacteria 871
406 Ga0207691_11349811 3300025940 Unclassified 587
407 Ga0207711_10067956 3300025941 Bacteria 3086
408 Ga0207711_10836901 3300025941 Bacteria 857
409 Ga0207711_11566850 3300025941 Bacteria 602
410 Ga0207689_10004715 3300025942 Bacteria 12303
411 Ga0207689_10346791 3300025942 Bacteria 1234
412 Ga0207661_10017256 3300025944 Bacteria 5338
413 Ga0207661_10079612 3300025944 Unclassified 2701
414 Ga0207661_10134595 3300025944 Bacteria 2121
415 Ga0207661_10272252 3300025944 Unclassified 1511
416 Ga0207679_10226329 3300025945 Bacteria 1576
417 Ga0207679_10302817 3300025945 Unclassified 1378
418 Ga0207679_10303962 3300025945 Unclassified 1376
419 Ga0207679_10319274 3300025945 Unclassified 1344
420 Ga0207679_10984646 3300025945 Bacteria 773
421 Ga0207679_11454263 3300025945 Unclassified 629
422 Ga0207679_11727688 3300025945 Unclassified 572
423 Ga0207667_10543991 3300025949 Bacteria 1175
424 Ga0207667_10880299 3300025949 Unclassified 888
425 Ga0207667_11473826 3300025949 Unclassified 652
426 Ga0207651_10629401 3300025960 Bacteria 940
427 Ga0207651_11499684 3300025960 Unclassified 607
428 Ga0207712_10002773 3300025961 Bacteria 11202
429 Ga0207668_10020312 3300025972 Bacteria 4217
430 Ga0207668_10077586 3300025972 Bacteria 2396
431 Ga0207668_10542362 3300025972 Bacteria 1006
432 Ga0207668_10838100 3300025972 Bacteria 816
433 Ga0207658_10022774 3300025986 Bacteria 4364
434 Ga0207658_10215676 3300025986 Bacteria 1611
435 Ga0207658_10302121 3300025986 Bacteria 1379
436 Ga0207658_11246172 3300025986 Unclassified 680
437 Ga0207677_10078419 3300026023 Bacteria 2359
438 Ga0207677_10097393 3300026023 Bacteria 2155
439 Ga0207677_10116182 3300026023 Bacteria 2003
440 Ga0207677_10191775 3300026023 Bacteria 1617
441 Ga0207677_10623297 3300026023 Unclassified 949
442 Ga0207677_10801385 3300026023 Bacteria 843
443 Ga0207703_10056596 3300026035 Bacteria 3194
444 Ga0207703_10176665 3300026035 Unclassified 1882
445 Ga0207639_11097803 3300026041 Bacteria 746
446 Ga0207678_10058412 3300026067 Bacteria 3319
447 Ga0207678_10602454 3300026067 Unclassified 963
448 Ga0207678_11024702 3300026067 Bacteria 731
449 Ga0207708_10005360 3300026075 Bacteria 9450
450 Ga0207708_10047878 3300026075 Bacteria 3254
451 Ga0207708_10167349 3300026075 Unclassified 1739
452 Ga0207708_10246288 3300026075 Bacteria 1439
453 Ga0207708_10547636 3300026075 Unclassified 975
454 Ga0207641_10000259 3300026088 Bacteria 67298
455 Ga0207641_10635271 3300026088 Bacteria 1048
456 Ga0207648_10012271 3300026089 Bacteria 8021
457 Ga0207648_10142958 3300026089 Bacteria 2109
458 Ga0207648_10166798 3300026089 Bacteria 1946
459 Ga0207676_10134004 3300026095 Bacteria 2111
460 Ga0207674_10418122 3300026116 Bacteria 1295
461 Ga0207674_10624747 3300026116 Bacteria 1040
462 Ga0207675_100000638 3300026118 Bacteria 34400
463 Ga0207675_100093960 3300026118 Bacteria 2821
464 Ga0207675_100276121 3300026118 Bacteria 1632
465 Ga0207683_10006951 3300026121 Bacteria 9696
466 Ga0207683_11101376 3300026121 Bacteria 737
467 Ga0207698_10127517 3300026142 Bacteria 2167
468 Ga0207698_10186694 3300026142 Unclassified 1842
469 Ga0207698_11581654 3300026142 Bacteria 671
470 Ga0207428_10021466 3300027907 Bacteria 5467
471 Ga0268266_10138985 3300028379 Unclassified 2179
472 Ga0268265_10183813 3300028380 Bacteria 1798
473 Ga0268265_10191099 3300028380 Bacteria 1768
474 Ga0268265_10393720 3300028380 Bacteria 1278
475 Ga0268265_11000825 3300028380 Bacteria 826
476 Ga0268265_11755640 3300028380 Bacteria 627
477 Ga0268264_10170576 3300028381 Bacteria 1967
478 Ga0268264_10633995 3300028381 Bacteria 1056
479 Ga0307413_10319283 3300031824 Unclassified 1186
480 Ga0307410_11066705 3300031852 Bacteria 699
481 Ga0307406_10368694 3300031901 Unclassified 1128
482 Ga0307407_10442596 3300031903 Unclassified 941
483 Ga0307407_10930861 3300031903 Bacteria 668
484 Ga0307412_10347673 3300031911 Bacteria 1189
485 Ga0307412_10391007 3300031911 Bacteria 1129
486 Ga0307409_100030741 3300031995 Bacteria 3864
487 Ga0307409_100162613 3300031995 Bacteria 1954
488 Ga0307409_101168460 3300031995 Bacteria 792
489 Ga0307416_101086012 3300032002 Unclassified 904
490 Ga0307414_10414094 3300032004 Bacteria 1174
491 Ga0307411_12144684 3300032005 Unclassified 523
492 Ga0373926_0030159 3300035083 Bacteria 1908
493 Ga0373926_0083399 3300035083 Bacteria 1184
494 Ga0373934_0001660 3300035086 Bacteria 8162
495 Ga0373940_0297466 3300035088 Bacteria 555
496 Ga0373936_0008943 3300035113 Bacteria 3776
497 Ga0373936_0319884 3300035113 Unclassified 703
498 Ga0373939_0037650 3300035114 Unclassified 1438
499 Ga0373953_0011442 3300035117 Bacteria 3114
500 Ga0373954_0090742 3300035118 Unclassified 1467
501 Ga0373956_0001837 3300035119 Bacteria 8753
502 Ga0373957_0014546 3300035120 Bacteria 2692
503 Ga0373960_0347852 3300035121 Bacteria 561
504 Ga0373943_0009850 3300035170 Bacteria 4279
505 Ga0373943_0589611 3300035170 Unclassified 654
506 Ga0373946_0023310 3300035171 Bacteria 2417
507 Ga0373955_0003368 3300035172 Bacteria 7025
508 Ga0373955_0738233 3300035172 Unclassified 605
509 Ga0373961_0057002 3300035241 Bacteria 1175
510 Ga0373924_0007624 3300035410 Bacteria 3911
511 Ga0373935_0001703 3300035692 Bacteria 12294
512 Ga0373935_0036917 3300035692 Unclassified 3057
513 Ga0373935_1148755 3300035692 Unclassified 578
514 Ga0373927_0001843 3300035695 Bacteria 15733
515 Ga0373927_0009125 3300035695 Bacteria 6656
516 Ga0373927_0044284 3300035695 Bacteria 2880
517 Ga0373927_0243492 3300035695 Unclassified 1182
518 Ga0373927_0489692 3300035695 Bacteria 813
519 Ga0373927_0982324 3300035695 Unclassified 557
520 Ga0373933_0002775 3300035724 Bacteria 9773
521 Ga0373947_0000021 3300035725 Bacteria 89576
522 Ga0373937_1106017 3300036401 Unclassified 741
523 Ga0373925_0000404 3300037068 Bacteria 43931
524 Ga0373925_0057645 3300037068 Bacteria 2911
525 Ga0242420_002346 3300038996 Bacteria 2690
526 Ga0466966_0339502 3300044684 Bacteria 903
527 Ga0466968_0483637 3300044735 Unclassified 615
528 Ga0451576_0975841 3300045051 Bacteria 888
529 Ga0466967_0061719 3300045976 Bacteria 3326
530 Ga0495603_0001580 3300046455 Bacteria 13331
531 Ga0495603_0789019 3300046455 Unclassified 542
532 Ga0495629_0005460 3300046459 Bacteria 9485
533 Ga0495629_0018521 3300046459 Bacteria 4981
534 Ga0495629_0019846 3300046459 Bacteria 4797
535 Ga0495629_0725699 3300046459 Unclassified 659
536 Ga0495651_0026382 3300046462 Bacteria 4525
537 Ga0495653_0009556 3300046463 Bacteria 7934
538 Ga0495580_0000722 3300046472 Bacteria 28259
539 Ga0495580_0027413 3300046472 Bacteria 4145
540 Ga0495582_0000297 3300046473 Bacteria 27434
541 Ga0495582_0101879 3300046473 Bacteria 1608
542 Ga0495639_0000027 3300046475 Bacteria 68298
543 Ga0495639_0098898 3300046475 Bacteria 1376
544 Ga0495639_0223918 3300046475 Bacteria 925
545 Ga0495664_0279721 3300046477 Bacteria 1008
546 Ga0495594_0014596 3300046499 Bacteria 4119
547 Ga0495594_0056259 3300046499 Bacteria 2170
548 Ga0495594_0092303 3300046499 Bacteria 1697
549 Ga0495608_0011217 3300046511 Bacteria 6238
550 Ga0495628_0010464 3300046516 Bacteria 7877
551 Ga0495630_0000527 3300046517 Bacteria 28192
552 Ga0495666_0152580 3300046526 Bacteria 1074
553 Ga0495666_0157051 3300046526 Bacteria 1056
554 Ga0495652_0008602 3300046529 Bacteria 9306
555 Ga0495665_0000010 3300046531 Bacteria 71277
556 Ga0495665_0291065 3300046531 Unclassified 837
557 Ga0495640_0239192 3300046533 Bacteria 1140
558 Ga0495586_0032828 3300046535 Unclassified 2784
559 Ga0495586_0052020 3300046535 Bacteria 2217
560 Ga0495586_0358222 3300046535 Unclassified 838
561 Ga0495586_0426141 3300046535 Unclassified 764
562 Ga0495587_0006278 3300046536 Bacteria 7757
563 Ga0495645_0003484 3300046543 Bacteria 10672
564 Ga0495622_0481175 3300046557 Unclassified 531
565 Ga0495667_0004148 3300046559 Bacteria 9744
566 Ga0495635_0036859 3300046663 Bacteria 3386
567 Ga0495588_0000637 3300046674 Bacteria 16296
568 Ga0495588_0244316 3300046674 Bacteria 947
569 Ga0495657_0013067 3300046675 Bacteria 6137
570 Ga0495623_0002456 3300046679 Bacteria 12296
571 Ga0495646_0002336 3300046680 Bacteria 11624
572 Ga0495647_0221907 3300046681 Unclassified 835
573 Ga0495658_0000072 3300046683 Bacteria 52083
574 Ga0495658_0054560 3300046683 Bacteria 2274
575 Ga0495658_0206725 3300046683 Bacteria 1225
576 Ga0495658_0522962 3300046683 Unclassified 759
577 Ga0495613_0039340 3300046689 Bacteria 3506
578 Ga0495613_0112753 3300046689 Bacteria 1958
579 Ga0495670_0344486 3300046691 Bacteria 802
580 Ga0495600_0008175 3300046809 Bacteria 6422
581 Ga0495581_0000086 3300047315 Bacteria 37647
582 Ga0495581_0049471 3300047315 Unclassified 2427
583 Ga0495604_0030140 3300047317 Bacteria 4311
584 Ga0495674_0005055 3300047319 Bacteria 12688
585 Ga0495674_0135922 3300047319 Bacteria 2069
586 Ga0495674_0941854 3300047319 Unclassified 665
587 Ga0495680_0005722 3300047322 Bacteria 11642
588 Ga0495684_0007549 3300047471 Bacteria 8417
589 Ga0495684_0230902 3300047471 Unclassified 1353
590 Ga0495593_0000208 3300047673 Bacteria 30996
591 Ga0495593_0126362 3300047673 Unclassified 1300
592 Ga0495602_0118791 3300048088 Unclassified 2131
593 Ga0495614_0000022 3300048089 Bacteria 44200
594 Ga0496100_0010071 3300048903 Bacteria 5340
595 Ga0496101_0000951 3300048904 Bacteria 17097
596 Ga0496102_0129715 3300048905 Bacteria 2359
597 Ga0496102_0404434 3300048905 Bacteria 1283
598 Ga0496104_0032710 3300048907 Bacteria 4841
599 Ga0496105_0198503 3300048908 Bacteria 1638
600 Ga0496106_0019645 3300048909 Bacteria 5011
601 Ga0496106_1413484 3300048909 Unclassified 537
602 Ga0496108_0457269 3300048911 Bacteria 1115
603 Ga0496108_0484681 3300048911 Unclassified 1080
604 Ga0496109_0248842 3300048912 Bacteria 1674
605 Ga0496109_0474732 3300048912 Bacteria 1181
606 Ga0496110_0255797 3300048913 Bacteria 1594
607 Ga0496110_1535569 3300048913 Unclassified 576
608 Ga0496111_1244118 3300048914 Unclassified 526
609 Ga0496112_0097711 3300048915 Bacteria 2907
610 Ga0496113_1126153 3300048916 Bacteria 615
611 Ga0496114_0000753 3300048917 Bacteria 24155
612 Ga0496115_0436239 3300048918 Unclassified 1060
613 Ga0501296_075707 3300049519 Bacteria 527
614 Ga0501298_189328 3300049521 Bacteria 518
615 Ga0501201_007922 3300049651 Bacteria 1020
616 Ga0501202_013589 3300049652 Bacteria 1550
617 Ga0501207_029937 3300049654 Bacteria 911
618 Ga0501217_004924 3300049661 Bacteria 2769
619 Ga0501217_015121 3300049661 Bacteria 1753
620 Ga0501217_021975 3300049661 Bacteria 1510
621 Ga0501222_028260 3300049662 Bacteria 765
622 Ga0501222_045570 3300049662 Unclassified 632
623 Ga0501223_016933 3300049663 Bacteria 1439
624 Ga0501223_041371 3300049663 Bacteria 894
625 Ga0501223_102421 3300049663 Unclassified 591
626 Ga0501224_015975 3300049664 Bacteria 1113
627 Ga0501224_016848 3300049664 Bacteria 1085
628 Ga0501227_090257 3300049665 Unclassified 808
629 Ga0501233_125947 3300049668 Unclassified 696
630 Ga0501235_038080 3300049669 Bacteria 1095
631 Ga0501239_081430 3300049672 Unclassified 520
632 Ga0501240_017733 3300049673 Bacteria 1039
633 Ga0501243_080137 3300049675 Bacteria 634
634 Ga0501249_003453 3300049679 Bacteria 3174
635 Ga0501249_038692 3300049679 Unclassified 1078
636 Ga0501249_046835 3300049679 Bacteria 988
637 Ga0501250_000877 3300049680 Bacteria 2254
638 Ga0501251_101264 3300049681 Unclassified 527
639 Ga0501252_011674 3300049682 Bacteria 1053
640 Ga0501252_013936 3300049682 Bacteria 988
641 Ga0501253_002816 3300049683 Bacteria 2006
642 Ga0501257_017349 3300049686 Bacteria 1674
643 Ga0501258_031481 3300049687 Unclassified 672
644 Ga0501259_028441 3300049688 Bacteria 1041
645 Ga0501221_002730 3300049704 Bacteria 2904
646 Ga0501221_031546 3300049704 Bacteria 1108
647 Ga0501225_0013948 3300049705 Bacteria 2247
648 Ga0501225_0045759 3300049705 Bacteria 1212
649 Ga0501234_005558 3300049707 Bacteria 1974
650 Ga0501245_002689 3300049708 Bacteria 2381
651 Ga0501245_039342 3300049708 Unclassified 809
652 Ga0501241_038960 3300049758 Bacteria 916
653 Ga0501263_000105 3300049760 Bacteria 4472
654 Ga0501263_026516 3300049760 Bacteria 802
655 Ga0501265_018673 3300049762 Unclassified 919
656 Ga0501266_009009 3300049763 Bacteria 1259
657 Ga0501268_025173 3300049765 Bacteria 1044
658 Ga0501268_032985 3300049765 Unclassified 946
659 Ga0501269_051072 3300049766 Unclassified 569
660 Ga0501270_007900 3300049767 Bacteria 1331
661 Ga0501270_008917 3300049767 Unclassified 1282
662 Ga0501278_004429 3300049774 Bacteria 1013
663 nmdc:mga06z11_701900_c1 3300050494 Bacteria 616
664 nmdc:mga05p37_129996_c1 3300050507 Bacteria 3090
665 nmdc:mga05p37_15643_c1 3300050507 Bacteria 9118
666 nmdc:mga05p37_218139_c1 3300050507 Bacteria 2303
667 nmdc:mga05p37_440129_c1 3300050507 Bacteria 1512
668 nmdc:mga09592_316027_c1 3300050508 Bacteria 1353
669 nmdc:mga09592_371303_c1 3300050508 Unclassified 1237
670 nmdc:mga06r32_106223_c1 3300050510 Unclassified 2758
671 nmdc:mga06r32_50710_c1 3300050510 Unclassified 3969
672 nmdc:mga08y16_140865_c1 3300050511 Unclassified 2507
673 nmdc:mga08y16_25258_c1 3300050511 Bacteria 6264
674 nmdc:mga0n895_12144_c1 3300050512 Bacteria 7709
675 nmdc:mga0n895_125586_c1 3300050512 Bacteria 2589
676 nmdc:mga0n895_137469_c1 3300050512 Bacteria 2471
677 nmdc:mga0n895_19759_c1 3300050512 Bacteria 6267
678 nmdc:mga0n895_201378_c1 3300050512 Bacteria 2022
679 nmdc:mga0rr50_184371_c1 3300050513 Bacteria 1707
680 nmdc:mga0rr50_238969_c1 3300050513 Bacteria 1505
681 nmdc:mga0rr50_55090_c1 3300050513 Unclassified 2965
682 nmdc:mga0rr50_826802_c1 3300050513 Bacteria 790
683 nmdc:mga08x19_123845_c1 3300050514 Bacteria 1735
684 nmdc:mga0a205_1276390_c1 3300050515 Unclassified 582
685 nmdc:mga0a205_139138_c1 3300050515 Unclassified 2328
686 nmdc:mga0a205_144788_c1 3300050515 Bacteria 2276
687 nmdc:mga0a205_37536_c1 3300050515 Unclassified 4659
688 nmdc:mga0a205_39080_c1 3300050515 Bacteria 4566
689 Ga0495601_0009220 3300053077 Bacteria 5833
690 Ga0495619_0006014 3300053085 Bacteria 7689
691 Ga0070666_10292143
692 MBSR1b_contig_11558287
693 JGI24737J22298_10172342
694 Ga0065704_10215893
695 Ga0065712_10023321
696 Ga0065712_10052932
697 Ga0065715_10140548
698 Ga0065715_10243080
699 Ga0065707_10088979
700 Ga0065707_10424919
701 Ga0070658_11704657
702 Ga0070676_10006221
703 Ga0070676_10026274
704 Ga0070676_10457461
705 Ga0070683_100003180
706 Ga0070683_100012221
707 Ga0070683_100048411
708 Ga0070683_100098017
709 Ga0070683_100254174
710 Ga0070683_101584291
711 Ga0070690_100144937
712 Ga0070690_100376651
713 Ga0070670_100013920
714 Ga0070670_100257356
715 Ga0070677_10272953
716 Ga0070677_10538734
717 Ga0068869_100022412
718 Ga0068869_100122714
719 Ga0070666_10285243
720 Ga0070666_10421843
721 Ga0070666_10902427
722 Ga0070680_100005405
723 Ga0070680_100021970
724 Ga0070680_100959833
725 Ga0070682_100880320
726 Ga0070682_101881582
727 Ga0068868_100006383
728 Ga0068868_100056712
729 Ga0068868_100078813
730 Ga0068868_100312003
731 Ga0068868_100485986
732 Ga0070660_100516148
733 Ga0070660_101914899
734 Ga0070689_100051789
735 Ga0070689_100135731
736 Ga0070691_10235371
737 Ga0070687_100003780
738 Ga0070687_100045253
739 Ga0070661_100016249
740 Ga0070692_10018235
741 Ga0070692_10040765
742 Ga0070668_100006976
743 Ga0070668_100068006
744 Ga0070668_100120917
745 Ga0070668_100612487
746 Ga0070668_100974316
747 Ga0070669_100011129
748 Ga0070669_100847637
749 Ga0070669_101039253
750 Ga0070669_101244397
751 Ga0070675_100156240
752 Ga0070671_100630139
753 Ga0070671_101151412
754 Ga0070674_100069380
755 Ga0070674_100079117
756 Ga0070674_100087262
757 Ga0070673_100265615
758 Ga0070673_100570313
759 Ga0070673_100855398
760 Ga0070688_100031201
761 Ga0070688_100230237
762 Ga0070688_100836664
763 Ga0070659_100062749
764 Ga0070667_100038819
765 Ga0070667_100099004
766 Ga0070667_100387965
767 Ga0070667_100551840
768 Ga0070667_101172926
769 Ga0070667_101259925
770 Ga0070667_101713615
771 Ga0070667_101765514
772 Ga0070703_10253352
773 Ga0070709_10004134
774 Ga0070709_10055247
775 Ga0070713_100381759
776 Ga0070710_10210050
777 Ga0070710_10358529
778 Ga0070701_10090668
779 Ga0070711_100059443
780 Ga0070711_100159615
781 Ga0070711_100318690
782 Ga0070705_100258727
783 Ga0070700_100004441
784 Ga0070700_100010421
785 Ga0070700_100229241
786 Ga0070700_100350729
787 Ga0070700_100394427
788 Ga0070700_100809162
789 Ga0070694_100105385
790 Ga0070694_100106875
791 Ga0070694_101803712
792 Ga0070708_101558637
793 Ga0070663_100121231
794 Ga0070663_100579190
795 Ga0070663_100887673
796 Ga0070678_101308036
797 Ga0070662_100010096
798 Ga0070662_100417211
799 Ga0070662_101357551
800 Ga0070681_10008403
801 Ga0070681_10147486
802 Ga0070681_10230400
803 Ga0068867_100029095
804 Ga0068867_100036452
805 Ga0070685_10003180
806 Ga0070685_10059432
807 Ga0070706_100426074
808 Ga0070706_100773009
809 Ga0070707_100698791
810 Ga0070698_100035165
811 Ga0070698_100281756
812 Ga0070698_100319254
813 Ga0070698_100469821
814 Ga0070698_100972641
815 Ga0070698_101460708
816 Ga0070699_100946630
817 Ga0070699_101555533
818 Ga0070679_100000310
819 Ga0070679_100998038
820 Ga0070684_100018401
821 Ga0070684_100054608
822 Ga0070684_100114787
823 Ga0070684_100170744
824 Ga0070697_101050321
825 Ga0070697_101139722
826 Ga0068853_100498314
827 Ga0068853_101131642
828 Ga0070672_100010502
829 Ga0070672_100121604
830 Ga0070672_100209071
831 Ga0070672_100500493
832 Ga0070672_101088865
833 Ga0070686_100011045
834 Ga0070686_100538984
835 Ga0070695_100003879
836 Ga0070695_100155277
837 Ga0070695_100210989
838 Ga0070695_100389084
839 Ga0070695_100653536
840 Ga0070696_100213010
841 Ga0070693_100013238
842 Ga0070665_100433215
843 Ga0070665_101079155
844 Ga0070704_100406148
845 Ga0068855_100088454
846 Ga0068855_100094285
847 Ga0068855_100413269
848 Ga0068855_100474722
849 Ga0068855_102353830
850 Ga0070664_100037994
851 Ga0070664_100090892
852 Ga0070664_101146457
853 Ga0070664_101290591
854 Ga0068857_100204834
855 Ga0068857_100240206
856 Ga0068854_100810545
857 Ga0068854_100854228
858 Ga0070702_100134186
859 Ga0068852_100005474
860 Ga0068852_100052548
861 Ga0068852_100977814
862 Ga0068859_100026255
863 Ga0068859_100479449
864 Ga0068859_100877279
865 Ga0068864_100711173
866 Ga0068866_10004837
867 Ga0068866_10106670
868 Ga0068866_10434386
869 Ga0068866_10602724
870 Ga0068861_100001264
871 Ga0068861_101905806
872 Ga0068851_10044965
873 Ga0068870_10185235
874 Ga0068870_10447757
875 Ga0068863_100008070
876 Ga0068863_100034335
877 Ga0068863_100448842
878 Ga0068858_100038234
879 Ga0068862_100007690
880 Ga0068862_100020681
881 Ga0068862_100202481
882 Ga0068862_100433162
883 Ga0068862_101655097
884 Ga0081455_10083228
885 Ga0075432_10085769
886 Ga0070716_100003376
887 Ga0070716_100204857
888 Ga0070716_100280313
889 Ga0070712_100086408
890 Ga0070712_100114696
891 Ga0097621_100033917
892 Ga0097621_100197137
893 Ga0097621_100511036
894 Ga0068871_100052294
895 Ga0075428_100097315
896 Ga0075428_100709510
897 Ga0075428_100759943
898 Ga0075428_102420697
899 Ga0075431_100037873
900 Ga0075431_100738176
901 Ga0075433_10007765
902 Ga0075433_10036465
903 Ga0075434_100026132
904 Ga0075434_100033246
905 Ga0075434_100038757
906 Ga0075434_100056780
907 Ga0075434_100127831
908 Ga0075434_101554516
909 Ga0075429_100032646
910 Ga0068865_100003354
911 Ga0068865_100071451
912 Ga0068865_100191794
913 Ga0075436_100010139
914 Ga0075436_100420627
915 Ga0097620_100026256
916 Ga0097620_100479464
917 Ga0097620_100877260
918 Ga0075435_100081850
919 Ga0075435_100189649
920 Ga0075435_100641794
921 Ga0075435_101370727
922 Ga0105240_10000646
923 Ga0105240_10036046
924 Ga0105240_10185831
925 Ga0105240_11123713
926 Ga0105240_11848521
927 Ga0111539_10020900
928 Ga0111539_10113853
929 Ga0111539_12494284
930 Ga0105245_10079515
931 Ga0105245_10531609
932 Ga0105245_10593159
933 Ga0105245_12002687
934 Ga0105245_12527858
935 Ga0105247_10448112
936 Ga0114129_10018598
937 Ga0114129_10025654
938 Ga0114129_10244370
939 Ga0114129_11275464
940 Ga0105243_10200897
941 Ga0105243_11189655
942 Ga0105243_12940030
943 Ga0105241_10036726
944 Ga0105241_11053882
945 Ga0105241_11087153
946 Ga0105242_10033266
947 Ga0105242_10167516
948 Ga0105242_10525748
949 Ga0105248_10028015
950 Ga0105248_10161765
951 Ga0105248_10375980
952 Ga0105248_10536495
953 Ga0105248_11509465
954 Ga0105248_12345339
955 Ga0105237_10035985
956 Ga0105237_10325962
957 Ga0105238_10051163
958 Ga0105249_10006103
959 Ga0105249_10377479
960 Ga0105239_10001040
961 Ga0105239_10043940
962 Ga0105246_10657473
963 Ga0157319_1012382
964 Ga0157345_1009276
965 Ga0157324_1044722
966 Ga0157327_1045130
967 Ga0157373_10097066
968 Ga0157373_10944779
969 Ga0157371_10012827
970 Ga0157370_10421229
971 Ga0157369_10076637
972 Ga0157369_10133998
973 Ga0157369_10866838
974 Ga0157374_10352623
975 Ga0157378_10001096
976 Ga0157378_10018413
977 Ga0157378_10326600
978 Ga0157378_10326667
979 Ga0157378_10355999
980 Ga0157378_11136949
981 Ga0157378_11166859
982 Ga0163162_10084310
983 Ga0163162_10989006
984 Ga0157372_10054604
985 Ga0157372_10121770
986 Ga0157372_10424601
987 Ga0157372_10438773
988 Ga0157372_11035257
989 Ga0157375_10127130
990 Ga0157375_10231096
991 Ga0157375_10264158
992 Ga0157375_10489007
993 Ga0157375_10783708
994 Ga0163163_10148492
995 Ga0163163_10196567
996 Ga0163163_12312706
997 Ga0157380_10231548
998 Ga0157380_10552951
999 Ga0157377_10136008
1000 Ga0157377_10805944
1001 Ga0157377_10892454
1002 Ga0157379_10238752
1003 Ga0157376_10284377
1004 Ga0157376_12788586
1005 Ga0163161_10061628
1006 Ga0163161_11141718
1007 Ga0207697_10361862
1008 Ga0207656_10195154
1009 Ga0207682_10170731
1010 Ga0207692_10063743
1011 Ga0207692_11101407
1012 Ga0207642_10280588
1013 Ga0207688_10546812
1014 Ga0207680_10063602
1015 Ga0207680_10399759
1016 Ga0207680_10535495
1017 Ga0207680_10900367
1018 Ga0207647_10273853
1019 Ga0207699_10025347
1020 Ga0207699_10069606
1021 Ga0207699_10097334
1022 Ga0207645_10002412
1023 Ga0207645_10006775
1024 Ga0207645_10051684
1025 Ga0207645_10113941
1026 Ga0207643_10016260
1027 Ga0207684_10139711
1028 Ga0207684_10629155
1029 Ga0207707_10022174
1030 Ga0207707_10205245
1031 Ga0207707_10402877
1032 Ga0207695_10000682
1033 Ga0207695_10086536
1034 Ga0207695_10327804
1035 Ga0207695_10816782
1036 Ga0207671_10212400
1037 Ga0207693_10062964
1038 Ga0207663_10035700
1039 Ga0207663_10232165
1040 Ga0207660_10089568
1041 Ga0207660_10347823
1042 Ga0207660_10567320
1043 Ga0207662_10009121
1044 Ga0207662_10032845
1045 Ga0207662_10064280
1046 Ga0207657_10214807
1047 Ga0207649_10008301
1048 Ga0207649_10625271
1049 Ga0207652_10007225
1050 Ga0207652_10201130
1051 Ga0207646_10138777
1052 Ga0207646_10733937
1053 Ga0207646_11367987
1054 Ga0207681_10008029
1055 Ga0207681_10010295
1056 Ga0207681_10655931
1057 Ga0207681_10990821
1058 Ga0207681_11270179
1059 Ga0207694_10043263
1060 Ga0207650_10137437
1061 Ga0207650_10571336
1062 Ga0207650_10815504
1063 Ga0207659_10116353
1064 Ga0207687_10018902
1065 Ga0207687_10356381
1066 Ga0207687_10435750
1067 Ga0207687_11615379
1068 Ga0207700_10504441
1069 Ga0207664_11486702
1070 Ga0207644_10149279
1071 Ga0207690_10055294
1072 Ga0207690_11101006
1073 Ga0207706_10000748
1074 Ga0207706_10002730
1075 Ga0207706_10168343
1076 Ga0207686_10123309
1077 Ga0207686_10142375
1078 Ga0207670_10058200
1079 Ga0207670_10414872
1080 Ga0207669_10084646
1081 Ga0207669_10094767
1082 Ga0207669_10129786
1083 Ga0207669_10382374
1084 Ga0207669_11091627
1085 Ga0207704_10010016
1086 Ga0207704_10180264
1087 Ga0207704_10597166
1088 Ga0207704_11278317
1089 Ga0207665_10000973
1090 Ga0207665_10100716
1091 Ga0207691_10003034
1092 Ga0207691_10044015
1093 Ga0207691_10133559
1094 Ga0207691_10583452
1095 Ga0207691_10676457
1096 Ga0207691_11349811
1097 Ga0207711_10067956
1098 Ga0207711_10836901
1099 Ga0207711_11566850
1100 Ga0207689_10004715
1101 Ga0207689_10346791
1102 Ga0207661_10017256
1103 Ga0207661_10079612
1104 Ga0207661_10134595
1105 Ga0207661_10272252
1106 Ga0207679_10226329
1107 Ga0207679_10302817
1108 Ga0207679_10303962
1109 Ga0207679_10319274
1110 Ga0207679_10984646
1111 Ga0207679_11454263
1112 Ga0207679_11727688
1113 Ga0207667_10543991
1114 Ga0207667_10880299
1115 Ga0207667_11473826
1116 Ga0207651_10629401
1117 Ga0207651_11499684
1118 Ga0207712_10002773
1119 Ga0207668_10020312
1120 Ga0207668_10077586
1121 Ga0207668_10542362
1122 Ga0207668_10838100
1123 Ga0207658_10022774
1124 Ga0207658_10215676
1125 Ga0207658_10302121
1126 Ga0207658_11246172
1127 Ga0207677_10078419
1128 Ga0207677_10097393
1129 Ga0207677_10116182
1130 Ga0207677_10191775
1131 Ga0207677_10623297
1132 Ga0207677_10801385
1133 Ga0207703_10056596
1134 Ga0207703_10176665
1135 Ga0207639_11097803
1136 Ga0207678_10058412
1137 Ga0207678_10602454
1138 Ga0207678_11024702
1139 Ga0207708_10005360
1140 Ga0207708_10047878
1141 Ga0207708_10167349
1142 Ga0207708_10246288
1143 Ga0207708_10547636
1144 Ga0207641_10000259
1145 Ga0207641_10635271
1146 Ga0207648_10012271
1147 Ga0207648_10142958
1148 Ga0207648_10166798
1149 Ga0207676_10134004
1150 Ga0207674_10418122
1151 Ga0207674_10624747
1152 Ga0207675_100000638
1153 Ga0207675_100093960
1154 Ga0207675_100276121
1155 Ga0207683_10006951
1156 Ga0207683_11101376
1157 Ga0207698_10127517
1158 Ga0207698_10186694
1159 Ga0207698_11581654
1160 Ga0207428_10021466
1161 Ga0268266_10138985
1162 Ga0268265_10183813
1163 Ga0268265_10191099
1164 Ga0268265_10393720
1165 Ga0268265_11000825
1166 Ga0268265_11755640
1167 Ga0268264_10170576
1168 Ga0268264_10633995
1169 Ga0307413_10319283
1170 Ga0307410_11066705
1171 Ga0307406_10368694
1172 Ga0307407_10442596
1173 Ga0307407_10930861
1174 Ga0307412_10347673
1175 Ga0307412_10391007
1176 Ga0307409_100030741
1177 Ga0307409_100162613
1178 Ga0307409_101168460
1179 Ga0307416_101086012
1180 Ga0307414_10414094
1181 Ga0307411_12144684
1182 Ga0373926_0030159
1183 Ga0373926_0083399
1184 Ga0373934_0001660
1185 Ga0373940_0297466
1186 Ga0373936_0008943
1187 Ga0373936_0319884
1188 Ga0373939_0037650
1189 Ga0373953_0011442
1190 Ga0373954_0090742
1191 Ga0373956_0001837
1192 Ga0373957_0014546
1193 Ga0373960_0347852
1194 Ga0373943_0009850
1195 Ga0373943_0589611
1196 Ga0373946_0023310
1197 Ga0373955_0003368
1198 Ga0373955_0738233
1199 Ga0373961_0057002
1200 Ga0373924_0007624
1201 Ga0373935_0001703
1202 Ga0373935_0036917
1203 Ga0373935_1148755
1204 Ga0373927_0001843
1205 Ga0373927_0009125
1206 Ga0373927_0044284
1207 Ga0373927_0243492
1208 Ga0373927_0489692
1209 Ga0373927_0982324
1210 Ga0373933_0002775
1211 Ga0373947_0000021
1212 Ga0373937_1106017
1213 Ga0373925_0000404
1214 Ga0373925_0057645
1215 Ga0242420_002346
1216 Ga0466966_0339502
1217 Ga0466968_0483637
1218 Ga0451576_0975841
1219 Ga0466967_0061719
1220 Ga0495603_0001580
1221 Ga0495603_0789019
1222 Ga0495629_0005460
1223 Ga0495629_0018521
1224 Ga0495629_0019846
1225 Ga0495629_0725699
1226 Ga0495651_0026382
1227 Ga0495653_0009556
1228 Ga0495580_0000722
1229 Ga0495580_0027413
1230 Ga0495582_0000297
1231 Ga0495582_0101879
1232 Ga0495639_0000027
1233 Ga0495639_0098898
1234 Ga0495639_0223918
1235 Ga0495664_0279721
1236 Ga0495594_0014596
1237 Ga0495594_0056259
1238 Ga0495594_0092303
1239 Ga0495608_0011217
1240 Ga0495628_0010464
1241 Ga0495630_0000527
1242 Ga0495666_0152580
1243 Ga0495666_0157051
1244 Ga0495652_0008602
1245 Ga0495665_0000010
1246 Ga0495665_0291065
1247 Ga0495640_0239192
1248 Ga0495586_0032828
1249 Ga0495586_0052020
1250 Ga0495586_0358222
1251 Ga0495586_0426141
1252 Ga0495587_0006278
1253 Ga0495645_0003484
1254 Ga0495622_0481175
1255 Ga0495667_0004148
1256 Ga0495635_0036859
1257 Ga0495588_0000637
1258 Ga0495588_0244316
1259 Ga0495657_0013067
1260 Ga0495623_0002456
1261 Ga0495646_0002336
1262 Ga0495647_0221907
1263 Ga0495658_0000072
1264 Ga0495658_0054560
1265 Ga0495658_0206725
1266 Ga0495658_0522962
1267 Ga0495613_0039340
1268 Ga0495613_0112753
1269 Ga0495670_0344486
1270 Ga0495600_0008175
1271 Ga0495581_0000086
1272 Ga0495581_0049471
1273 Ga0495604_0030140
1274 Ga0495674_0005055
1275 Ga0495674_0135922
1276 Ga0495674_0941854
1277 Ga0495680_0005722
1278 Ga0495684_0007549
1279 Ga0495684_0230902
1280 Ga0495593_0000208
1281 Ga0495593_0126362
1282 Ga0495602_0118791
1283 Ga0495614_0000022
1284 Ga0496100_0010071
1285 Ga0496101_0000951
1286 Ga0496102_0129715
1287 Ga0496102_0404434
1288 Ga0496104_0032710
1289 Ga0496105_0198503
1290 Ga0496106_0019645
1291 Ga0496106_1413484
1292 Ga0496108_0457269
1293 Ga0496108_0484681
1294 Ga0496109_0248842
1295 Ga0496109_0474732
1296 Ga0496110_0255797
1297 Ga0496110_1535569
1298 Ga0496111_1244118
1299 Ga0496112_0097711
1300 Ga0496113_1126153
1301 Ga0496114_0000753
1302 Ga0496115_0436239
1303 Ga0501296_075707
1304 Ga0501298_189328
1305 Ga0501201_007922
1306 Ga0501202_013589
1307 Ga0501207_029937
1308 Ga0501217_004924
1309 Ga0501217_015121
1310 Ga0501217_021975
1311 Ga0501222_028260
1312 Ga0501222_045570
1313 Ga0501223_016933
1314 Ga0501223_041371
1315 Ga0501223_102421
1316 Ga0501224_015975
1317 Ga0501224_016848
1318 Ga0501227_090257
1319 Ga0501233_125947
1320 Ga0501235_038080
1321 Ga0501239_081430
1322 Ga0501240_017733
1323 Ga0501243_080137
1324 Ga0501249_003453
1325 Ga0501249_038692
1326 Ga0501249_046835
1327 Ga0501250_000877
1328 Ga0501251_101264
1329 Ga0501252_011674
1330 Ga0501252_013936
1331 Ga0501253_002816
1332 Ga0501257_017349
1333 Ga0501258_031481
1334 Ga0501259_028441
1335 Ga0501221_002730
1336 Ga0501221_031546
1337 Ga0501225_0013948
1338 Ga0501225_0045759
1339 Ga0501234_005558
1340 Ga0501245_002689
1341 Ga0501245_039342
1342 Ga0501241_038960
1343 Ga0501263_000105
1344 Ga0501263_026516
1345 Ga0501265_018673
1346 Ga0501266_009009
1347 Ga0501268_025173
1348 Ga0501268_032985
1349 Ga0501269_051072
1350 Ga0501270_007900
1351 Ga0501270_008917
1352 Ga0501278_004429
1353 nmdc:mga06z11_701900_c1
1354 nmdc:mga05p37_129996_c1
1355 nmdc:mga05p37_15643_c1
1356 nmdc:mga05p37_218139_c1
1357 nmdc:mga05p37_440129_c1
1358 nmdc:mga09592_316027_c1
1359 nmdc:mga09592_371303_c1
1360 nmdc:mga06r32_106223_c1
1361 nmdc:mga06r32_50710_c1
1362 nmdc:mga08y16_140865_c1
1363 nmdc:mga08y16_25258_c1
1364 nmdc:mga0n895_12144_c1
1365 nmdc:mga0n895_125586_c1
1366 nmdc:mga0n895_137469_c1
1367 nmdc:mga0n895_19759_c1
1368 nmdc:mga0n895_201378_c1
1369 nmdc:mga0rr50_184371_c1
1370 nmdc:mga0rr50_238969_c1
1371 nmdc:mga0rr50_55090_c1
1372 nmdc:mga0rr50_826802_c1
1373 nmdc:mga08x19_123845_c1
1374 nmdc:mga0a205_1276390_c1
1375 nmdc:mga0a205_139138_c1
1376 nmdc:mga0a205_144788_c1
1377 nmdc:mga0a205_37536_c1
1378 nmdc:mga0a205_39080_c1
1379 Ga0495601_0009220
1380 Ga0495619_0006014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

17

158

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.9573 28 138
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.9325 28 138
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.9237 30 139
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.8997 30 139
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8317 29 139
ID Description Score Start End Superfamily
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9228 29 139 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9137 30 137 3.40.1260.10
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9069 29 139 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8825 30 137 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8654 28 138 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A2T2WJZ7-F1-model_v4 Uncharacterized protein 0.9737 29 138
AF-A0A257IWV6-F1-model_v4 Uncharacterized protein 0.9666 28 139
AF-A0A267T7I9-F1-model_v4 Uncharacterized protein 0.9663 26 141
AF-A0A1Q3WUH3-F1-model_v4 Uncharacterized protein 0.9645 28 141
AF-A0A842YKB4-F1-model_v4 DsrE family protein 0.9611 28 138

Map