F475413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 689 | 317 | 1378 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_867832_c1|nmdc:mga0qj67_867832_c1_110_661 |
| Length | 183 |
| Sequence | MQWSEAERRSPPSRMKEARGVAIELYRIDDRLIHGQVVVGWGQPLALEFIVLVDNEVAASEWEQELYRMGVPPEMSVYFDDVVSAVNNLKGYQTDDRRGLLLTADIASMAQLCSATGAIQRVNVGGIHHKPGRVQRLRYVFLNPQEEAALRALEARGIEVSAQDVPAARPLPLAELLSAEGVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 191 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 192 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 193 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 273 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 276 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 277 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 282 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 285 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 288 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 289 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 290 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 295 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 311 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 312 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 315 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.87 |
| Nodule | 0 |
| Rhizoplane | 0.73 |
| Rhizosphere | 98.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0qj67_867832_c1 | 3300050509 | Bacteria | 712 |
| 2 | MBSR1b_contig_7113257 | 2162886012 | Unclassified | 892 |
| 3 | JGI25406J46586_10027133 | 3300003203 | Bacteria | 2200 |
| 4 | Ga0058861_11254204 | 3300004800 | Bacteria | 995 |
| 5 | Ga0065715_10155019 | 3300005293 | Unclassified | 1679 |
| 6 | Ga0070658_11017278 | 3300005327 | Bacteria | 721 |
| 7 | Ga0070676_10082868 | 3300005328 | Bacteria | 1950 |
| 8 | Ga0070676_10229131 | 3300005328 | Bacteria | 1231 |
| 9 | Ga0070676_11108804 | 3300005328 | Bacteria | 598 |
| 10 | Ga0070683_100018701 | 3300005329 | Bacteria | 6140 |
| 11 | Ga0070683_100048126 | 3300005329 | Bacteria | 3942 |
| 12 | Ga0070683_100105630 | 3300005329 | Unclassified | 2655 |
| 13 | Ga0070683_100140094 | 3300005329 | Bacteria | 2291 |
| 14 | Ga0070683_100806179 | 3300005329 | Bacteria | 900 |
| 15 | Ga0070690_100199565 | 3300005330 | Bacteria | 1391 |
| 16 | Ga0070680_100002160 | 3300005336 | Bacteria | 14534 |
| 17 | Ga0070680_100017939 | 3300005336 | Bacteria | 5587 |
| 18 | Ga0070680_100074412 | 3300005336 | Bacteria | 2795 |
| 19 | Ga0070680_100107617 | 3300005336 | Bacteria | 2319 |
| 20 | Ga0070680_100207641 | 3300005336 | Bacteria | 1652 |
| 21 | Ga0070680_100248916 | 3300005336 | Unclassified | 1502 |
| 22 | Ga0070680_100902931 | 3300005336 | Bacteria | 762 |
| 23 | Ga0070680_101741593 | 3300005336 | Unclassified | 540 |
| 24 | Ga0070682_100177954 | 3300005337 | Bacteria | 1483 |
| 25 | Ga0068868_100047687 | 3300005338 | Bacteria | 3359 |
| 26 | Ga0068868_100228985 | 3300005338 | Unclassified | 1558 |
| 27 | Ga0070660_100013102 | 3300005339 | Bacteria | 5937 |
| 28 | Ga0070660_100479078 | 3300005339 | Bacteria | 1034 |
| 29 | Ga0070691_10079477 | 3300005341 | Archaea | 1603 |
| 30 | Ga0070691_10217178 | 3300005341 | Bacteria | 1012 |
| 31 | Ga0070691_10259335 | 3300005341 | Bacteria | 935 |
| 32 | Ga0070691_10647094 | 3300005341 | Unclassified | 629 |
| 33 | Ga0070687_100029297 | 3300005343 | Bacteria | 2679 |
| 34 | Ga0070687_100106100 | 3300005343 | Bacteria | 1582 |
| 35 | Ga0070687_100132182 | 3300005343 | Bacteria | 1442 |
| 36 | Ga0070661_100000718 | 3300005344 | Bacteria | 24252 |
| 37 | Ga0070661_100144489 | 3300005344 | Bacteria | 1795 |
| 38 | Ga0070692_10011167 | 3300005345 | Bacteria | 4117 |
| 39 | Ga0070692_10019832 | 3300005345 | Bacteria | 3251 |
| 40 | Ga0070669_100236042 | 3300005353 | Bacteria | 1451 |
| 41 | Ga0070669_100555434 | 3300005353 | Unclassified | 958 |
| 42 | Ga0070675_100390857 | 3300005354 | Bacteria | 1239 |
| 43 | Ga0070675_101122138 | 3300005354 | Bacteria | 723 |
| 44 | Ga0070671_100396306 | 3300005355 | Bacteria | 1181 |
| 45 | Ga0070674_100320335 | 3300005356 | Bacteria | 1243 |
| 46 | Ga0070673_100099877 | 3300005364 | Bacteria | 2388 |
| 47 | Ga0070673_100102908 | 3300005364 | Bacteria | 2355 |
| 48 | Ga0070688_100073019 | 3300005365 | Bacteria | 2200 |
| 49 | Ga0070688_100649786 | 3300005365 | Bacteria | 812 |
| 50 | Ga0070667_100080602 | 3300005367 | Unclassified | 2784 |
| 51 | Ga0070709_10003599 | 3300005434 | Bacteria | 8324 |
| 52 | Ga0070709_10023328 | 3300005434 | Bacteria | 3630 |
| 53 | Ga0070709_10036117 | 3300005434 | Bacteria | 3008 |
| 54 | Ga0070714_100078321 | 3300005435 | Bacteria | 2872 |
| 55 | Ga0070713_100000365 | 3300005436 | Bacteria | 29146 |
| 56 | Ga0070713_101019650 | 3300005436 | Bacteria | 799 |
| 57 | Ga0070710_10181297 | 3300005437 | Bacteria | 1319 |
| 58 | Ga0070701_10003239 | 3300005438 | Bacteria | 6410 |
| 59 | Ga0070701_10144819 | 3300005438 | Bacteria | 1362 |
| 60 | Ga0070701_10251948 | 3300005438 | Bacteria | 1067 |
| 61 | Ga0070711_100072603 | 3300005439 | Bacteria | 2428 |
| 62 | Ga0070711_100273926 | 3300005439 | Unclassified | 1333 |
| 63 | Ga0070711_100687293 | 3300005439 | Unclassified | 861 |
| 64 | Ga0070705_100320480 | 3300005440 | Bacteria | 1119 |
| 65 | Ga0070700_100012485 | 3300005441 | Bacteria | 4745 |
| 66 | Ga0070700_100056535 | 3300005441 | Bacteria | 2460 |
| 67 | Ga0070700_100404168 | 3300005441 | Bacteria | 1028 |
| 68 | Ga0070694_100036874 | 3300005444 | Bacteria | 3240 |
| 69 | Ga0070694_100372594 | 3300005444 | Bacteria | 1112 |
| 70 | Ga0070708_100002649 | 3300005445 | Bacteria | 13862 |
| 71 | Ga0070708_100053104 | 3300005445 | Bacteria | 3595 |
| 72 | Ga0070708_100798424 | 3300005445 | Bacteria | 887 |
| 73 | Ga0070708_101065545 | 3300005445 | Bacteria | 757 |
| 74 | Ga0070663_100184510 | 3300005455 | Unclassified | 1620 |
| 75 | Ga0070663_100267913 | 3300005455 | Unclassified | 1357 |
| 76 | Ga0070662_100005154 | 3300005457 | Bacteria | 8333 |
| 77 | Ga0070681_10000119 | 3300005458 | Bacteria | 59101 |
| 78 | Ga0070681_10012112 | 3300005458 | Bacteria | 8552 |
| 79 | Ga0070681_10012713 | 3300005458 | Bacteria | 8355 |
| 80 | Ga0070681_10042038 | 3300005458 | Bacteria | 4582 |
| 81 | Ga0070681_10105541 | 3300005458 | Unclassified | 2759 |
| 82 | Ga0070681_10212364 | 3300005458 | Bacteria | 1851 |
| 83 | Ga0070681_10220634 | 3300005458 | Bacteria | 1811 |
| 84 | Ga0070681_10295948 | 3300005458 | Bacteria | 1528 |
| 85 | Ga0070681_10352771 | 3300005458 | Unclassified | 1381 |
| 86 | Ga0070681_10670702 | 3300005458 | Unclassified | 952 |
| 87 | Ga0070681_10747356 | 3300005458 | Bacteria | 895 |
| 88 | Ga0070681_10877826 | 3300005458 | Unclassified | 815 |
| 89 | Ga0068867_100012942 | 3300005459 | Bacteria | 5903 |
| 90 | Ga0068867_100087623 | 3300005459 | Bacteria | 2358 |
| 91 | Ga0070706_100214635 | 3300005467 | Unclassified | 1796 |
| 92 | Ga0070706_100931269 | 3300005467 | Unclassified | 802 |
| 93 | Ga0070707_100012069 | 3300005468 | Bacteria | 8065 |
| 94 | Ga0070707_100227776 | 3300005468 | Unclassified | 1815 |
| 95 | Ga0070707_101630666 | 3300005468 | Unclassified | 612 |
| 96 | Ga0070698_100118685 | 3300005471 | Bacteria | 2606 |
| 97 | Ga0070699_100009176 | 3300005518 | Bacteria | 8576 |
| 98 | Ga0070699_100034453 | 3300005518 | Bacteria | 4376 |
| 99 | Ga0070699_100164873 | 3300005518 | Bacteria | 1962 |
| 100 | Ga0070699_100174406 | 3300005518 | Bacteria | 1906 |
| 101 | Ga0070699_100185768 | 3300005518 | Bacteria | 1846 |
| 102 | Ga0070699_100926061 | 3300005518 | Unclassified | 798 |
| 103 | Ga0070679_100000066 | 3300005530 | Bacteria | 78387 |
| 104 | Ga0070679_100003412 | 3300005530 | Bacteria | 14549 |
| 105 | Ga0070679_100022174 | 3300005530 | Bacteria | 6206 |
| 106 | Ga0070679_100039597 | 3300005530 | Bacteria | 4684 |
| 107 | Ga0070679_100088278 | 3300005530 | Bacteria | 3088 |
| 108 | Ga0070679_100115196 | 3300005530 | Bacteria | 2673 |
| 109 | Ga0070679_100155573 | 3300005530 | Bacteria | 2261 |
| 110 | Ga0070679_100614232 | 3300005530 | Bacteria | 1030 |
| 111 | Ga0070679_100804184 | 3300005530 | Unclassified | 883 |
| 112 | Ga0070684_100009052 | 3300005535 | Bacteria | 7826 |
| 113 | Ga0070684_100011200 | 3300005535 | Bacteria | 7140 |
| 114 | Ga0070684_100024204 | 3300005535 | Bacteria | 5090 |
| 115 | Ga0070684_100028274 | 3300005535 | Bacteria | 4742 |
| 116 | Ga0070684_100087472 | 3300005535 | Bacteria | 2767 |
| 117 | Ga0070684_100665202 | 3300005535 | Archaea | 970 |
| 118 | Ga0070684_101535287 | 3300005535 | Unclassified | 628 |
| 119 | Ga0070697_100183726 | 3300005536 | Unclassified | 1773 |
| 120 | Ga0070697_100255183 | 3300005536 | Bacteria | 1500 |
| 121 | Ga0070697_100379447 | 3300005536 | Archaea | 1224 |
| 122 | Ga0070697_100421544 | 3300005536 | Bacteria | 1160 |
| 123 | Ga0070686_100056610 | 3300005544 | Bacteria | 2516 |
| 124 | Ga0070686_100418287 | 3300005544 | Unclassified | 1023 |
| 125 | Ga0070695_100017975 | 3300005545 | Bacteria | 4290 |
| 126 | Ga0070695_100201004 | 3300005545 | Bacteria | 1424 |
| 127 | Ga0070696_100000107 | 3300005546 | Bacteria | 42492 |
| 128 | Ga0070696_100043961 | 3300005546 | Bacteria | 3092 |
| 129 | Ga0070696_100148215 | 3300005546 | Bacteria | 1720 |
| 130 | Ga0070696_100336689 | 3300005546 | Bacteria | 1165 |
| 131 | Ga0070693_100006308 | 3300005547 | Bacteria | 5747 |
| 132 | Ga0070693_100019267 | 3300005547 | Bacteria | 3574 |
| 133 | Ga0070693_100401293 | 3300005547 | Bacteria | 951 |
| 134 | Ga0070665_100278054 | 3300005548 | Unclassified | 1676 |
| 135 | Ga0070704_100086597 | 3300005549 | Bacteria | 2322 |
| 136 | Ga0068855_100002271 | 3300005563 | Bacteria | 23735 |
| 137 | Ga0068855_100044173 | 3300005563 | Bacteria | 5275 |
| 138 | Ga0068855_100074748 | 3300005563 | Bacteria | 3935 |
| 139 | Ga0068855_100594883 | 3300005563 | Bacteria | 1193 |
| 140 | Ga0068854_100226582 | 3300005578 | Unclassified | 1481 |
| 141 | Ga0068854_100353289 | 3300005578 | Unclassified | 1204 |
| 142 | Ga0068856_100529421 | 3300005614 | Unclassified | 1200 |
| 143 | Ga0068856_101247460 | 3300005614 | Unclassified | 759 |
| 144 | Ga0070702_100163551 | 3300005615 | Bacteria | 1441 |
| 145 | Ga0068852_100029599 | 3300005616 | Bacteria | 4501 |
| 146 | Ga0068852_100049160 | 3300005616 | Bacteria | 3607 |
| 147 | Ga0068852_100705418 | 3300005616 | Bacteria | 1019 |
| 148 | Ga0068859_100145368 | 3300005617 | Bacteria | 2446 |
| 149 | Ga0068859_100241752 | 3300005617 | Bacteria | 1895 |
| 150 | Ga0068859_100612496 | 3300005617 | Unclassified | 1182 |
| 151 | Ga0068864_100870212 | 3300005618 | Unclassified | 889 |
| 152 | Ga0068866_10011204 | 3300005718 | Bacteria | 3871 |
| 153 | Ga0068861_100597076 | 3300005719 | Unclassified | 1013 |
| 154 | Ga0068861_100619063 | 3300005719 | Unclassified | 996 |
| 155 | Ga0068858_100325637 | 3300005842 | Bacteria | 1469 |
| 156 | Ga0068862_100044961 | 3300005844 | Unclassified | 3767 |
| 157 | Ga0081455_10188513 | 3300005937 | Unclassified | 1555 |
| 158 | Ga0070717_10005342 | 3300006028 | Bacteria | 9365 |
| 159 | Ga0070717_10114705 | 3300006028 | Bacteria | 2302 |
| 160 | Ga0070716_100254543 | 3300006173 | Bacteria | 1198 |
| 161 | Ga0070712_100022496 | 3300006175 | Bacteria | 4154 |
| 162 | Ga0070712_100051807 | 3300006175 | Bacteria | 2860 |
| 163 | Ga0068871_100363209 | 3300006358 | Unclassified | 1283 |
| 164 | Ga0075428_100625532 | 3300006844 | Bacteria | 1149 |
| 165 | Ga0075428_100773190 | 3300006844 | Bacteria | 1021 |
| 166 | Ga0075430_100043061 | 3300006846 | Bacteria | 3816 |
| 167 | Ga0075430_100941189 | 3300006846 | Bacteria | 712 |
| 168 | Ga0075431_100041102 | 3300006847 | Bacteria | 4767 |
| 169 | Ga0075431_100075924 | 3300006847 | Bacteria | 3468 |
| 170 | Ga0075433_10010917 | 3300006852 | Bacteria | 7309 |
| 171 | Ga0075433_10061187 | 3300006852 | Bacteria | 3298 |
| 172 | Ga0075433_10429583 | 3300006852 | Bacteria | 1165 |
| 173 | Ga0075434_100004197 | 3300006871 | Bacteria | 12910 |
| 174 | Ga0075434_100059637 | 3300006871 | Bacteria | 3793 |
| 175 | Ga0075434_100326924 | 3300006871 | Bacteria | 1554 |
| 176 | Ga0075434_100387531 | 3300006871 | Bacteria | 1418 |
| 177 | Ga0075429_100044871 | 3300006880 | Bacteria | 3845 |
| 178 | Ga0075429_100264958 | 3300006880 | Bacteria | 1505 |
| 179 | Ga0068865_100065218 | 3300006881 | Bacteria | 2565 |
| 180 | Ga0068865_100709599 | 3300006881 | Unclassified | 860 |
| 181 | Ga0075436_100234048 | 3300006914 | Unclassified | 1305 |
| 182 | Ga0075436_100594187 | 3300006914 | Bacteria | 815 |
| 183 | Ga0097620_100145363 | 3300006931 | Bacteria | 2446 |
| 184 | Ga0097620_100241755 | 3300006931 | Bacteria | 1895 |
| 185 | Ga0097620_100612510 | 3300006931 | Unclassified | 1182 |
| 186 | Ga0075435_100069868 | 3300007076 | Bacteria | 2865 |
| 187 | Ga0075435_101386032 | 3300007076 | Unclassified | 616 |
| 188 | Ga0099794_10000059 | 3300007265 | Bacteria | 42270 |
| 189 | Ga0105240_10030397 | 3300009093 | Bacteria | 7021 |
| 190 | Ga0105240_10137412 | 3300009093 | Bacteria | 2926 |
| 191 | Ga0105240_10427692 | 3300009093 | Unclassified | 1486 |
| 192 | Ga0105240_10832703 | 3300009093 | Unclassified | 997 |
| 193 | Ga0111539_10016990 | 3300009094 | Bacteria | 9005 |
| 194 | Ga0111539_10017366 | 3300009094 | Bacteria | 8905 |
| 195 | Ga0114129_10016042 | 3300009147 | Bacteria | 10654 |
| 196 | Ga0114129_10603922 | 3300009147 | Bacteria | 1421 |
| 197 | Ga0105241_10085041 | 3300009174 | Bacteria | 2485 |
| 198 | Ga0105241_10273467 | 3300009174 | Archaea | 1440 |
| 199 | Ga0105248_10045032 | 3300009177 | Bacteria | 4947 |
| 200 | Ga0105248_10102481 | 3300009177 | Unclassified | 3226 |
| 201 | Ga0105238_10029562 | 3300009551 | Bacteria | 5582 |
| 202 | Ga0105238_10033352 | 3300009551 | Bacteria | 5241 |
| 203 | Ga0105239_12067769 | 3300010375 | Bacteria | 662 |
| 204 | Ga0157373_10011686 | 3300013100 | Bacteria | 6447 |
| 205 | Ga0157371_10013927 | 3300013102 | Bacteria | 6091 |
| 206 | Ga0157370_10003680 | 3300013104 | Bacteria | 17906 |
| 207 | Ga0157370_10058871 | 3300013104 | Unclassified | 3651 |
| 208 | Ga0157370_10158568 | 3300013104 | Unclassified | 2106 |
| 209 | Ga0157370_10377296 | 3300013104 | Bacteria | 1306 |
| 210 | Ga0157370_10551516 | 3300013104 | Bacteria | 1057 |
| 211 | Ga0157369_10016784 | 3300013105 | Bacteria | 8229 |
| 212 | Ga0157369_10068321 | 3300013105 | Unclassified | 3818 |
| 213 | Ga0157369_10127726 | 3300013105 | Bacteria | 2694 |
| 214 | Ga0157374_12060720 | 3300013296 | Bacteria | 597 |
| 215 | Ga0157378_10446236 | 3300013297 | Bacteria | 1283 |
| 216 | Ga0157378_10490569 | 3300013297 | Bacteria | 1225 |
| 217 | Ga0157372_10002786 | 3300013307 | Bacteria | 18883 |
| 218 | Ga0157372_10009596 | 3300013307 | Bacteria | 10286 |
| 219 | Ga0157372_10033314 | 3300013307 | Bacteria | 5657 |
| 220 | Ga0157372_10042027 | 3300013307 | Bacteria | 5055 |
| 221 | Ga0157372_10050005 | 3300013307 | Bacteria | 4651 |
| 222 | Ga0157375_10096223 | 3300013308 | Bacteria | 3033 |
| 223 | Ga0157375_10577086 | 3300013308 | Bacteria | 1285 |
| 224 | Ga0157375_10828356 | 3300013308 | Unclassified | 1073 |
| 225 | Ga0163163_10284617 | 3300014325 | Unclassified | 1705 |
| 226 | Ga0157380_10144849 | 3300014326 | Bacteria | 2046 |
| 227 | Ga0157377_10168987 | 3300014745 | Bacteria | 1366 |
| 228 | Ga0207692_10134092 | 3300025898 | Bacteria | 1402 |
| 229 | Ga0207699_10047210 | 3300025906 | Bacteria | 2524 |
| 230 | Ga0207699_10070799 | 3300025906 | Unclassified | 2130 |
| 231 | Ga0207699_10115585 | 3300025906 | Bacteria | 1727 |
| 232 | Ga0207699_10286176 | 3300025906 | Bacteria | 1147 |
| 233 | Ga0207645_10018381 | 3300025907 | Bacteria | 4599 |
| 234 | Ga0207705_10005450 | 3300025909 | Bacteria | 9518 |
| 235 | Ga0207705_10141440 | 3300025909 | Bacteria | 1797 |
| 236 | Ga0207705_10193201 | 3300025909 | Bacteria | 1540 |
| 237 | Ga0207705_10297916 | 3300025909 | Bacteria | 1236 |
| 238 | Ga0207684_10862021 | 3300025910 | Bacteria | 763 |
| 239 | Ga0207654_10164022 | 3300025911 | Unclassified | 1438 |
| 240 | Ga0207654_10841467 | 3300025911 | Unclassified | 664 |
| 241 | Ga0207707_10001516 | 3300025912 | Bacteria | 21421 |
| 242 | Ga0207707_10002653 | 3300025912 | Bacteria | 15992 |
| 243 | Ga0207707_10003111 | 3300025912 | Bacteria | 14731 |
| 244 | Ga0207707_10021937 | 3300025912 | Bacteria | 5581 |
| 245 | Ga0207707_10061286 | 3300025912 | Bacteria | 3273 |
| 246 | Ga0207707_10110999 | 3300025912 | Bacteria | 2397 |
| 247 | Ga0207707_10172292 | 3300025912 | Bacteria | 1891 |
| 248 | Ga0207707_10417104 | 3300025912 | Unclassified | 1151 |
| 249 | Ga0207707_10550902 | 3300025912 | Unclassified | 980 |
| 250 | Ga0207695_10002624 | 3300025913 | Bacteria | 26302 |
| 251 | Ga0207695_10030043 | 3300025913 | Bacteria | 5991 |
| 252 | Ga0207695_10070743 | 3300025913 | Unclassified | 3565 |
| 253 | Ga0207695_10705879 | 3300025913 | Unclassified | 889 |
| 254 | Ga0207693_10004234 | 3300025915 | Bacteria | 12168 |
| 255 | Ga0207693_10010340 | 3300025915 | Bacteria | 7575 |
| 256 | Ga0207693_10068503 | 3300025915 | Bacteria | 2777 |
| 257 | Ga0207663_10127726 | 3300025916 | Bacteria | 1752 |
| 258 | Ga0207660_10001459 | 3300025917 | Bacteria | 15885 |
| 259 | Ga0207660_10090570 | 3300025917 | Bacteria | 2266 |
| 260 | Ga0207660_10149871 | 3300025917 | Bacteria | 1791 |
| 261 | Ga0207660_10344871 | 3300025917 | Bacteria | 1193 |
| 262 | Ga0207660_10519198 | 3300025917 | Archaea | 967 |
| 263 | Ga0207662_10020690 | 3300025918 | Bacteria | 3755 |
| 264 | Ga0207662_10043409 | 3300025918 | Bacteria | 2652 |
| 265 | Ga0207662_10088166 | 3300025918 | Bacteria | 1905 |
| 266 | Ga0207657_10006253 | 3300025919 | Bacteria | 12383 |
| 267 | Ga0207649_10139464 | 3300025920 | Bacteria | 1657 |
| 268 | Ga0207649_10144530 | 3300025920 | Bacteria | 1631 |
| 269 | Ga0207649_10430692 | 3300025920 | Bacteria | 992 |
| 270 | Ga0207652_10000184 | 3300025921 | Bacteria | 66070 |
| 271 | Ga0207652_10002383 | 3300025921 | Bacteria | 15874 |
| 272 | Ga0207652_10019280 | 3300025921 | Bacteria | 5608 |
| 273 | Ga0207652_10033158 | 3300025921 | Bacteria | 4347 |
| 274 | Ga0207652_10072664 | 3300025921 | Bacteria | 2992 |
| 275 | Ga0207652_10259714 | 3300025921 | Unclassified | 1567 |
| 276 | Ga0207652_10372575 | 3300025921 | Bacteria | 1289 |
| 277 | Ga0207652_10724247 | 3300025921 | Unclassified | 887 |
| 278 | Ga0207652_10765049 | 3300025921 | Bacteria | 859 |
| 279 | Ga0207646_10103468 | 3300025922 | Bacteria | 2553 |
| 280 | Ga0207646_10221422 | 3300025922 | Unclassified | 1710 |
| 281 | Ga0207646_11115316 | 3300025922 | Unclassified | 694 |
| 282 | Ga0207681_10107249 | 3300025923 | Bacteria | 2026 |
| 283 | Ga0207694_10020485 | 3300025924 | Bacteria | 5003 |
| 284 | Ga0207694_10082527 | 3300025924 | Bacteria | 2527 |
| 285 | Ga0207659_10697433 | 3300025926 | Bacteria | 869 |
| 286 | Ga0207700_10000601 | 3300025928 | Bacteria | 21049 |
| 287 | Ga0207700_10011250 | 3300025928 | Bacteria | 5697 |
| 288 | Ga0207664_10060871 | 3300025929 | Bacteria | 3010 |
| 289 | Ga0207706_10007439 | 3300025933 | Bacteria | 10127 |
| 290 | Ga0207706_10069928 | 3300025933 | Unclassified | 3087 |
| 291 | Ga0207669_10116598 | 3300025937 | Bacteria | 1803 |
| 292 | Ga0207704_10317607 | 3300025938 | Bacteria | 1200 |
| 293 | Ga0207711_10114664 | 3300025941 | Bacteria | 2400 |
| 294 | Ga0207689_10045966 | 3300025942 | Bacteria | 3609 |
| 295 | Ga0207661_10004594 | 3300025944 | Bacteria | 9674 |
| 296 | Ga0207661_10050354 | 3300025944 | Bacteria | 3318 |
| 297 | Ga0207661_10079166 | 3300025944 | Bacteria | 2708 |
| 298 | Ga0207661_10362844 | 3300025944 | Bacteria | 1309 |
| 299 | Ga0207661_11022913 | 3300025944 | Bacteria | 761 |
| 300 | Ga0207667_10001901 | 3300025949 | Bacteria | 26210 |
| 301 | Ga0207667_10040067 | 3300025949 | Bacteria | 4988 |
| 302 | Ga0207667_10176364 | 3300025949 | Bacteria | 2196 |
| 303 | Ga0207667_10442523 | 3300025949 | Bacteria | 1321 |
| 304 | Ga0207667_10754298 | 3300025949 | Unclassified | 972 |
| 305 | Ga0207651_10492637 | 3300025960 | Unclassified | 1058 |
| 306 | Ga0207668_10856802 | 3300025972 | Bacteria | 807 |
| 307 | Ga0207640_10000855 | 3300025981 | Bacteria | 17272 |
| 308 | Ga0207640_10009373 | 3300025981 | Bacteria | 5481 |
| 309 | Ga0207658_10111914 | 3300025986 | Bacteria | 2160 |
| 310 | Ga0207677_10052671 | 3300026023 | Bacteria | 2766 |
| 311 | Ga0207677_10298351 | 3300026023 | Bacteria | 1330 |
| 312 | Ga0207678_10000599 | 3300026067 | Bacteria | 33054 |
| 313 | Ga0207678_10099438 | 3300026067 | Unclassified | 2485 |
| 314 | Ga0207708_10016907 | 3300026075 | Bacteria | 5492 |
| 315 | Ga0207708_10230732 | 3300026075 | Bacteria | 1486 |
| 316 | Ga0207702_11151351 | 3300026078 | Unclassified | 770 |
| 317 | Ga0207648_10044412 | 3300026089 | Bacteria | 3898 |
| 318 | Ga0207676_10361887 | 3300026095 | Unclassified | 1345 |
| 319 | Ga0207675_100073178 | 3300026118 | Bacteria | 3206 |
| 320 | Ga0207675_100189408 | 3300026118 | Bacteria | 1973 |
| 321 | Ga0207675_100201325 | 3300026118 | Unclassified | 1912 |
| 322 | Ga0207698_10049004 | 3300026142 | Bacteria | 3212 |
| 323 | Ga0209969_1008709 | 3300027360 | Bacteria | 1442 |
| 324 | Ga0209967_1025214 | 3300027364 | Bacteria | 880 |
| 325 | Ga0209981_1010436 | 3300027378 | Unclassified | 1274 |
| 326 | Ga0209981_1055348 | 3300027378 | Bacteria | 604 |
| 327 | Ga0210000_1016596 | 3300027462 | Unclassified | 1113 |
| 328 | Ga0209995_1001619 | 3300027471 | Bacteria | 3495 |
| 329 | Ga0209968_1007357 | 3300027526 | Bacteria | 1665 |
| 330 | Ga0209968_1009646 | 3300027526 | Bacteria | 1478 |
| 331 | Ga0209999_1004833 | 3300027543 | Unclassified | 2424 |
| 332 | Ga0209999_1038128 | 3300027543 | Bacteria | 899 |
| 333 | Ga0209588_1003020 | 3300027671 | Bacteria | 4636 |
| 334 | Ga0209998_10000274 | 3300027717 | Bacteria | 16290 |
| 335 | Ga0209974_10035854 | 3300027876 | Bacteria | 1647 |
| 336 | Ga0207428_10201618 | 3300027907 | Bacteria | 1497 |
| 337 | Ga0207428_10452360 | 3300027907 | Unclassified | 936 |
| 338 | Ga0268265_10090110 | 3300028380 | Bacteria | 2449 |
| 339 | Ga0268264_11001206 | 3300028381 | Bacteria | 842 |
| 340 | Ga0265332_10008139 | 3300031238 | Bacteria | 4715 |
| 341 | Ga0265320_10080759 | 3300031240 | Bacteria | 1518 |
| 342 | Ga0265340_10069845 | 3300031247 | Bacteria | 1667 |
| 343 | Ga0307408_100007301 | 3300031548 | Bacteria | 7310 |
| 344 | Ga0307408_100015459 | 3300031548 | Bacteria | 5081 |
| 345 | Ga0307408_100142769 | 3300031548 | Bacteria | 1881 |
| 346 | Ga0307408_100183793 | 3300031548 | Bacteria | 1679 |
| 347 | Ga0307408_100498899 | 3300031548 | Bacteria | 1065 |
| 348 | Ga0265314_10136631 | 3300031711 | Bacteria | 1521 |
| 349 | Ga0265342_10020882 | 3300031712 | Bacteria | 4190 |
| 350 | Ga0307405_10000555 | 3300031731 | Bacteria | 14193 |
| 351 | Ga0307405_10000716 | 3300031731 | Bacteria | 12887 |
| 352 | Ga0307405_10040514 | 3300031731 | Unclassified | 2822 |
| 353 | Ga0307413_10010197 | 3300031824 | Bacteria | 4541 |
| 354 | Ga0307413_10102036 | 3300031824 | Bacteria | 1898 |
| 355 | Ga0307413_11409896 | 3300031824 | Bacteria | 613 |
| 356 | Ga0307410_10000571 | 3300031852 | Bacteria | 15118 |
| 357 | Ga0307410_10008576 | 3300031852 | Bacteria | 5677 |
| 358 | Ga0307410_10051378 | 3300031852 | Bacteria | 2778 |
| 359 | Ga0307410_10053205 | 3300031852 | Bacteria | 2739 |
| 360 | Ga0307410_10127985 | 3300031852 | Bacteria | 1862 |
| 361 | Ga0307410_10371156 | 3300031852 | Bacteria | 1149 |
| 362 | Ga0307410_10433325 | 3300031852 | Unclassified | 1069 |
| 363 | Ga0307410_10931968 | 3300031852 | Bacteria | 746 |
| 364 | Ga0307406_10013577 | 3300031901 | Bacteria | 4668 |
| 365 | Ga0307406_10029885 | 3300031901 | Bacteria | 3303 |
| 366 | Ga0307406_10169470 | 3300031901 | Unclassified | 1579 |
| 367 | Ga0307406_10205944 | 3300031901 | Bacteria | 1452 |
| 368 | Ga0307406_10227780 | 3300031901 | Unclassified | 1390 |
| 369 | Ga0307406_10552926 | 3300031901 | Bacteria | 942 |
| 370 | Ga0307406_10879423 | 3300031901 | Bacteria | 761 |
| 371 | Ga0307407_10002531 | 3300031903 | Bacteria | 7181 |
| 372 | Ga0307407_10002737 | 3300031903 | Bacteria | 7010 |
| 373 | Ga0307407_10060474 | 3300031903 | Unclassified | 2211 |
| 374 | Ga0307407_10161205 | 3300031903 | Bacteria | 1468 |
| 375 | Ga0307412_10005921 | 3300031911 | Bacteria | 6892 |
| 376 | Ga0307412_10006175 | 3300031911 | Bacteria | 6753 |
| 377 | Ga0307412_10012952 | 3300031911 | Bacteria | 4876 |
| 378 | Ga0307412_10047450 | 3300031911 | Bacteria | 2821 |
| 379 | Ga0307412_10868604 | 3300031911 | Unclassified | 788 |
| 380 | Ga0307409_100000084 | 3300031995 | Bacteria | 33710 |
| 381 | Ga0307409_100000742 | 3300031995 | Bacteria | 14668 |
| 382 | Ga0307409_100073955 | 3300031995 | Bacteria | 2721 |
| 383 | Ga0307409_100074067 | 3300031995 | Unclassified | 2719 |
| 384 | Ga0307409_100089815 | 3300031995 | Bacteria | 2513 |
| 385 | Ga0307409_100389893 | 3300031995 | Bacteria | 1327 |
| 386 | Ga0307409_100483839 | 3300031995 | Bacteria | 1202 |
| 387 | Ga0307409_100697010 | 3300031995 | Bacteria | 1014 |
| 388 | Ga0307416_100000582 | 3300032002 | Bacteria | 18751 |
| 389 | Ga0307416_100012115 | 3300032002 | Bacteria | 5791 |
| 390 | Ga0307416_100024173 | 3300032002 | Bacteria | 4428 |
| 391 | Ga0307416_100033976 | 3300032002 | Bacteria | 3874 |
| 392 | Ga0307416_100055905 | 3300032002 | Bacteria | 3181 |
| 393 | Ga0307416_100154738 | 3300032002 | Bacteria | 2109 |
| 394 | Ga0307416_100270080 | 3300032002 | Bacteria | 1669 |
| 395 | Ga0307416_100305367 | 3300032002 | Bacteria | 1584 |
| 396 | Ga0307416_100313233 | 3300032002 | Bacteria | 1567 |
| 397 | Ga0307416_100438385 | 3300032002 | Bacteria | 1356 |
| 398 | Ga0307416_100996369 | 3300032002 | Bacteria | 941 |
| 399 | Ga0307416_101444157 | 3300032002 | Bacteria | 794 |
| 400 | Ga0307416_101537097 | 3300032002 | Unclassified | 771 |
| 401 | Ga0307414_10004059 | 3300032004 | Bacteria | 7894 |
| 402 | Ga0307414_10388299 | 3300032004 | Unclassified | 1209 |
| 403 | Ga0307414_10404026 | 3300032004 | Bacteria | 1187 |
| 404 | Ga0307414_10478206 | 3300032004 | Bacteria | 1098 |
| 405 | Ga0307414_10689840 | 3300032004 | Bacteria | 924 |
| 406 | Ga0307411_10000070 | 3300032005 | Bacteria | 31137 |
| 407 | Ga0307411_10000464 | 3300032005 | Bacteria | 14014 |
| 408 | Ga0307411_10269735 | 3300032005 | Bacteria | 1349 |
| 409 | Ga0307411_10281805 | 3300032005 | Bacteria | 1323 |
| 410 | Ga0307411_10980194 | 3300032005 | Unclassified | 756 |
| 411 | Ga0307415_100012688 | 3300032126 | Bacteria | 4882 |
| 412 | Ga0307415_100063514 | 3300032126 | Bacteria | 2566 |
| 413 | Ga0307415_100123083 | 3300032126 | Bacteria | 1949 |
| 414 | Ga0307415_100336987 | 3300032126 | Bacteria | 1264 |
| 415 | Ga0307415_100415035 | 3300032126 | Bacteria | 1153 |
| 416 | Ga0307415_100440999 | 3300032126 | Unclassified | 1123 |
| 417 | Ga0307415_100664956 | 3300032126 | Bacteria | 935 |
| 418 | Ga0307415_100741583 | 3300032126 | Bacteria | 891 |
| 419 | Ga0307415_101147179 | 3300032126 | Unclassified | 730 |
| 420 | Ga0307415_101236366 | 3300032126 | Bacteria | 705 |
| 421 | Ga0373938_0039572 | 3300034957 | Bacteria | 1043 |
| 422 | Ga0373926_0000731 | 3300035083 | Bacteria | 9111 |
| 423 | Ga0373934_0003588 | 3300035086 | Bacteria | 5707 |
| 424 | Ga0373934_0013031 | 3300035086 | Bacteria | 3140 |
| 425 | Ga0373944_0013591 | 3300035089 | Bacteria | 2261 |
| 426 | Ga0373923_0004376 | 3300035111 | Bacteria | 4681 |
| 427 | Ga0373936_0039903 | 3300035113 | Bacteria | 1879 |
| 428 | Ga0373941_0003829 | 3300035115 | Unclassified | 3446 |
| 429 | Ga0373945_0011667 | 3300035116 | Bacteria | 2908 |
| 430 | Ga0373945_0171212 | 3300035116 | Bacteria | 890 |
| 431 | Ga0373953_0004240 | 3300035117 | Unclassified | 4552 |
| 432 | Ga0373953_0112842 | 3300035117 | Bacteria | 1150 |
| 433 | Ga0373954_0018872 | 3300035118 | Bacteria | 3107 |
| 434 | Ga0373956_0119668 | 3300035119 | Bacteria | 1229 |
| 435 | Ga0373957_0025895 | 3300035120 | Bacteria | 2118 |
| 436 | Ga0373957_0040474 | 3300035120 | Bacteria | 1752 |
| 437 | Ga0373960_0072614 | 3300035121 | Bacteria | 1067 |
| 438 | Ga0373943_0024931 | 3300035170 | Bacteria | 2792 |
| 439 | Ga0373955_0042205 | 3300035172 | Bacteria | 2448 |
| 440 | Ga0373942_0087674 | 3300035207 | Unclassified | 933 |
| 441 | Ga0373924_0323359 | 3300035410 | Unclassified | 686 |
| 442 | Ga0373935_0008971 | 3300035692 | Bacteria | 5983 |
| 443 | Ga0373935_0213549 | 3300035692 | Bacteria | 1338 |
| 444 | Ga0373927_0010703 | 3300035695 | Bacteria | 6111 |
| 445 | Ga0373927_0260959 | 3300035695 | Bacteria | 1139 |
| 446 | Ga0373933_0008609 | 3300035724 | Bacteria | 5565 |
| 447 | Ga0373933_0170060 | 3300035724 | Bacteria | 1386 |
| 448 | Ga0373947_0002620 | 3300035725 | Bacteria | 10799 |
| 449 | Ga0373937_0008633 | 3300036401 | Bacteria | 8852 |
| 450 | Ga0373937_0058483 | 3300036401 | Bacteria | 3542 |
| 451 | Ga0373937_0093255 | 3300036401 | Bacteria | 2791 |
| 452 | Ga0373925_0002987 | 3300037068 | Bacteria | 13332 |
| 453 | Ga0373925_0070236 | 3300037068 | Unclassified | 2647 |
| 454 | Ga0373925_0134938 | 3300037068 | Bacteria | 1928 |
| 455 | Ga0439436_0126766 | 3300041404 | Bacteria | 715 |
| 456 | Ga0439462_0082213 | 3300042015 | Bacteria | 880 |
| 457 | Ga0439434_0024995 | 3300042435 | Bacteria | 1802 |
| 458 | Ga0439435_0141928 | 3300042436 | Unclassified | 766 |
| 459 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 460 | Ga0451577_0003144 | 3300042876 | Bacteria | 18597 |
| 461 | Ga0451577_0006182 | 3300042876 | Bacteria | 12031 |
| 462 | Ga0451577_0012030 | 3300042876 | Bacteria | 8144 |
| 463 | Ga0451577_0037993 | 3300042876 | Bacteria | 4332 |
| 464 | Ga0451577_0498620 | 3300042876 | Bacteria | 1105 |
| 465 | Ga0451577_0508620 | 3300042876 | Bacteria | 1094 |
| 466 | Ga0451577_0516173 | 3300042876 | Bacteria | 1085 |
| 467 | Ga0451577_0879926 | 3300042876 | Bacteria | 807 |
| 468 | Ga0466969_0060917 | 3300044656 | Bacteria | 1834 |
| 469 | Ga0466966_0011886 | 3300044684 | Bacteria | 5767 |
| 470 | Ga0466966_0089775 | 3300044684 | Bacteria | 1909 |
| 471 | Ga0466961_0002229 | 3300044693 | Bacteria | 12067 |
| 472 | Ga0466963_0215414 | 3300044694 | Bacteria | 1344 |
| 473 | Ga0466964_0120295 | 3300044706 | Bacteria | 1183 |
| 474 | Ga0453684_0001936 | 3300044712 | Bacteria | 53406 |
| 475 | Ga0453684_0042658 | 3300044712 | Bacteria | 6113 |
| 476 | Ga0453684_0068150 | 3300044712 | Bacteria | 4519 |
| 477 | Ga0453684_1776906 | 3300044712 | Bacteria | 628 |
| 478 | Ga0466957_0100755 | 3300044842 | Bacteria | 1821 |
| 479 | Ga0466959_0058194 | 3300045049 | Bacteria | 2815 |
| 480 | Ga0451576_0020415 | 3300045051 | Bacteria | 7216 |
| 481 | Ga0451576_0036756 | 3300045051 | Bacteria | 5189 |
| 482 | Ga0451576_0047821 | 3300045051 | Bacteria | 4496 |
| 483 | Ga0466958_0112777 | 3300045836 | Bacteria | 1698 |
| 484 | Ga0466967_0043886 | 3300045976 | Bacteria | 3874 |
| 485 | Ga0495592_0024160 | 3300046454 | Bacteria | 4620 |
| 486 | Ga0495592_0066816 | 3300046454 | Unclassified | 2630 |
| 487 | Ga0495592_0157765 | 3300046454 | Unclassified | 1564 |
| 488 | Ga0495603_0002982 | 3300046455 | Bacteria | 10011 |
| 489 | Ga0495603_0010128 | 3300046455 | Bacteria | 5705 |
| 490 | Ga0495629_0014112 | 3300046459 | Bacteria | 5755 |
| 491 | Ga0495629_0066215 | 3300046459 | Bacteria | 2521 |
| 492 | Ga0495651_0012210 | 3300046462 | Bacteria | 6615 |
| 493 | Ga0495651_0121374 | 3300046462 | Bacteria | 1919 |
| 494 | Ga0495653_0017133 | 3300046463 | Bacteria | 5893 |
| 495 | Ga0495653_0019406 | 3300046463 | Bacteria | 5513 |
| 496 | Ga0495653_0106169 | 3300046463 | Bacteria | 2026 |
| 497 | Ga0495580_0005679 | 3300046472 | Bacteria | 10261 |
| 498 | Ga0495580_0028551 | 3300046472 | Bacteria | 4055 |
| 499 | Ga0495580_0627283 | 3300046472 | Bacteria | 708 |
| 500 | Ga0495582_0005504 | 3300046473 | Bacteria | 7053 |
| 501 | Ga0495582_0021050 | 3300046473 | Bacteria | 3571 |
| 502 | Ga0495639_0000704 | 3300046475 | Bacteria | 15302 |
| 503 | Ga0495639_0056059 | 3300046475 | Bacteria | 1798 |
| 504 | Ga0495639_0331344 | 3300046475 | Bacteria | 762 |
| 505 | Ga0495662_0164175 | 3300046476 | Unclassified | 1094 |
| 506 | Ga0495664_0018129 | 3300046477 | Bacteria | 4027 |
| 507 | Ga0495608_0013916 | 3300046511 | Bacteria | 5583 |
| 508 | Ga0495608_0029791 | 3300046511 | Unclassified | 3699 |
| 509 | Ga0495608_0159058 | 3300046511 | Bacteria | 1437 |
| 510 | Ga0495608_0225512 | 3300046511 | Unclassified | 1174 |
| 511 | Ga0495618_0106210 | 3300046514 | Bacteria | 1798 |
| 512 | Ga0495628_0005937 | 3300046516 | Bacteria | 10685 |
| 513 | Ga0495628_0072022 | 3300046516 | Bacteria | 2693 |
| 514 | Ga0495630_0018256 | 3300046517 | Bacteria | 5151 |
| 515 | Ga0495630_0057174 | 3300046517 | Bacteria | 2923 |
| 516 | Ga0495630_0134362 | 3300046517 | Bacteria | 1879 |
| 517 | Ga0495643_0000249 | 3300046522 | Bacteria | 79178 |
| 518 | Ga0495652_0014836 | 3300046529 | Bacteria | 6985 |
| 519 | Ga0495652_0058304 | 3300046529 | Bacteria | 3269 |
| 520 | Ga0495652_0441741 | 3300046529 | Unclassified | 912 |
| 521 | Ga0495665_0001067 | 3300046531 | Bacteria | 14571 |
| 522 | Ga0495665_0009112 | 3300046531 | Bacteria | 5379 |
| 523 | Ga0495640_0017040 | 3300046533 | Bacteria | 5422 |
| 524 | Ga0495640_0121824 | 3300046533 | Bacteria | 1695 |
| 525 | Ga0495586_0707697 | 3300046535 | Bacteria | 582 |
| 526 | Ga0495587_0007410 | 3300046536 | Bacteria | 7106 |
| 527 | Ga0495587_0010356 | 3300046536 | Bacteria | 5939 |
| 528 | Ga0495598_0103586 | 3300046537 | Bacteria | 945 |
| 529 | Ga0495645_0015144 | 3300046543 | Bacteria | 5482 |
| 530 | Ga0495645_0040476 | 3300046543 | Bacteria | 3399 |
| 531 | Ga0495645_0173034 | 3300046543 | Bacteria | 1485 |
| 532 | Ga0495622_0111379 | 3300046557 | Bacteria | 1253 |
| 533 | Ga0495667_0006744 | 3300046559 | Bacteria | 7791 |
| 534 | Ga0495667_0021279 | 3300046559 | Bacteria | 4376 |
| 535 | Ga0495667_0414042 | 3300046559 | Unclassified | 848 |
| 536 | Ga0495656_0251352 | 3300046615 | Bacteria | 893 |
| 537 | Ga0495634_0061553 | 3300046642 | Unclassified | 2495 |
| 538 | Ga0495634_0289771 | 3300046642 | Bacteria | 992 |
| 539 | Ga0495635_0004505 | 3300046663 | Bacteria | 9651 |
| 540 | Ga0495635_0011934 | 3300046663 | Bacteria | 6086 |
| 541 | Ga0495635_0435305 | 3300046663 | Bacteria | 868 |
| 542 | Ga0495659_0073384 | 3300046664 | Bacteria | 1286 |
| 543 | Ga0495588_0001415 | 3300046674 | Bacteria | 10249 |
| 544 | Ga0495657_0015202 | 3300046675 | Bacteria | 5636 |
| 545 | Ga0495657_0151006 | 3300046675 | Unclassified | 1442 |
| 546 | Ga0495657_0547366 | 3300046675 | Bacteria | 672 |
| 547 | Ga0495599_0010839 | 3300046678 | Bacteria | 5585 |
| 548 | Ga0495599_0013143 | 3300046678 | Bacteria | 5116 |
| 549 | Ga0495599_0032011 | 3300046678 | Bacteria | 3301 |
| 550 | Ga0495599_0135774 | 3300046678 | Bacteria | 1527 |
| 551 | Ga0495599_0629339 | 3300046678 | Unclassified | 623 |
| 552 | Ga0495623_0002993 | 3300046679 | Bacteria | 11115 |
| 553 | Ga0495623_0083164 | 3300046679 | Bacteria | 1977 |
| 554 | Ga0495646_0051771 | 3300046680 | Unclassified | 2483 |
| 555 | Ga0495658_0001668 | 3300046683 | Bacteria | 11553 |
| 556 | Ga0495613_0005287 | 3300046689 | Bacteria | 9700 |
| 557 | Ga0495613_0137953 | 3300046689 | Bacteria | 1744 |
| 558 | Ga0495613_0586587 | 3300046689 | Bacteria | 743 |
| 559 | Ga0495613_0682270 | 3300046689 | Unclassified | 677 |
| 560 | Ga0495600_0003030 | 3300046809 | Bacteria | 9812 |
| 561 | Ga0495600_0372013 | 3300046809 | Unclassified | 893 |
| 562 | Ga0495581_0000809 | 3300047315 | Bacteria | 16635 |
| 563 | Ga0495604_0005420 | 3300047317 | Bacteria | 10117 |
| 564 | Ga0495604_0075674 | 3300047317 | Bacteria | 2534 |
| 565 | Ga0495674_0006248 | 3300047319 | Bacteria | 11431 |
| 566 | Ga0495674_0011877 | 3300047319 | Bacteria | 8209 |
| 567 | Ga0495674_0026894 | 3300047319 | Bacteria | 5262 |
| 568 | Ga0495674_0653292 | 3300047319 | Bacteria | 829 |
| 569 | Ga0495680_0025992 | 3300047322 | Bacteria | 4835 |
| 570 | Ga0495680_0027329 | 3300047322 | Bacteria | 4690 |
| 571 | Ga0495680_0182286 | 3300047322 | Bacteria | 1515 |
| 572 | Ga0495675_0007997 | 3300047444 | Bacteria | 6541 |
| 573 | Ga0495675_0030392 | 3300047444 | Bacteria | 3447 |
| 574 | Ga0495675_0206069 | 3300047444 | Unclassified | 1195 |
| 575 | Ga0495675_0239155 | 3300047444 | Bacteria | 1093 |
| 576 | Ga0495675_0392955 | 3300047444 | Unclassified | 809 |
| 577 | Ga0495684_0005933 | 3300047471 | Bacteria | 9491 |
| 578 | Ga0495684_0091913 | 3300047471 | Bacteria | 2298 |
| 579 | Ga0495684_0184704 | 3300047471 | Bacteria | 1544 |
| 580 | Ga0495684_0185284 | 3300047471 | Unclassified | 1541 |
| 581 | Ga0495593_0002738 | 3300047673 | Bacteria | 10610 |
| 582 | Ga0495593_0320295 | 3300047673 | Unclassified | 775 |
| 583 | Ga0495602_0003786 | 3300048088 | Bacteria | 15729 |
| 584 | Ga0495602_0094817 | 3300048088 | Bacteria | 2465 |
| 585 | Ga0495602_0242281 | 3300048088 | Unclassified | 1348 |
| 586 | Ga0495614_0000708 | 3300048089 | Bacteria | 14038 |
| 587 | Ga0495615_0069194 | 3300048090 | Bacteria | 948 |
| 588 | Ga0496104_0073425 | 3300048907 | Bacteria | 3255 |
| 589 | Ga0496105_0092303 | 3300048908 | Bacteria | 2500 |
| 590 | Ga0496112_0004132 | 3300048915 | Bacteria | 12214 |
| 591 | Ga0496113_0047993 | 3300048916 | Unclassified | 3176 |
| 592 | Ga0496115_0077378 | 3300048918 | Bacteria | 2705 |
| 593 | Ga0501292_063489 | 3300049515 | Bacteria | 674 |
| 594 | Ga0501031_0693887 | 3300049568 | Unclassified | 654 |
| 595 | Ga0501032_0410970 | 3300049569 | Bacteria | 869 |
| 596 | Ga0501033_0137898 | 3300049570 | Bacteria | 1765 |
| 597 | Ga0501033_0333386 | 3300049570 | Bacteria | 1064 |
| 598 | Ga0501034_0044690 | 3300049571 | Bacteria | 4478 |
| 599 | Ga0501034_0175367 | 3300049571 | Bacteria | 2110 |
| 600 | Ga0501034_0493767 | 3300049571 | Bacteria | 1138 |
| 601 | Ga0501034_0529074 | 3300049571 | Bacteria | 1090 |
| 602 | Ga0501036_0409407 | 3300049572 | Bacteria | 1131 |
| 603 | Ga0501037_0008487 | 3300049573 | Bacteria | 7531 |
| 604 | Ga0501037_0258930 | 3300049573 | Bacteria | 1216 |
| 605 | Ga0501038_0134279 | 3300049574 | Bacteria | 2029 |
| 606 | Ga0501038_0187885 | 3300049574 | Bacteria | 1664 |
| 607 | Ga0501043_0064822 | 3300049579 | Unclassified | 2869 |
| 608 | Ga0501043_0351167 | 3300049579 | Bacteria | 1120 |
| 609 | Ga0501047_0002652 | 3300049581 | Bacteria | 17033 |
| 610 | Ga0501047_0072927 | 3300049581 | Bacteria | 3305 |
| 611 | Ga0501048_0980032 | 3300049582 | Bacteria | 608 |
| 612 | Ga0501073_0319498 | 3300049589 | Bacteria | 1071 |
| 613 | Ga0501073_0586295 | 3300049589 | Unclassified | 770 |
| 614 | Ga0501075_0585636 | 3300049591 | Bacteria | 851 |
| 615 | Ga0501075_0698066 | 3300049591 | Unclassified | 773 |
| 616 | Ga0501076_0460530 | 3300049592 | Bacteria | 1047 |
| 617 | Ga0501077_0342700 | 3300049593 | Bacteria | 953 |
| 618 | Ga0501198_052432 | 3300049649 | Unclassified | 730 |
| 619 | Ga0501201_012826 | 3300049651 | Bacteria | 838 |
| 620 | Ga0501209_108154 | 3300049656 | Bacteria | 819 |
| 621 | Ga0501216_001545 | 3300049660 | Bacteria | 3126 |
| 622 | Ga0501217_062110 | 3300049661 | Bacteria | 1000 |
| 623 | Ga0501222_005200 | 3300049662 | Bacteria | 1759 |
| 624 | Ga0501223_037061 | 3300049663 | Bacteria | 948 |
| 625 | Ga0501224_002012 | 3300049664 | Bacteria | 2753 |
| 626 | Ga0501227_008086 | 3300049665 | Bacteria | 2257 |
| 627 | Ga0501230_007848 | 3300049667 | Bacteria | 1596 |
| 628 | Ga0501233_004321 | 3300049668 | Bacteria | 2598 |
| 629 | Ga0501235_045430 | 3300049669 | Bacteria | 1010 |
| 630 | Ga0501243_008486 | 3300049675 | Bacteria | 1584 |
| 631 | Ga0501249_016906 | 3300049679 | Bacteria | 1569 |
| 632 | Ga0501249_132509 | 3300049679 | Bacteria | 616 |
| 633 | Ga0501252_014777 | 3300049682 | Bacteria | 968 |
| 634 | Ga0501255_020195 | 3300049684 | Bacteria | 856 |
| 635 | Ga0501257_068393 | 3300049686 | Bacteria | 904 |
| 636 | Ga0501221_121079 | 3300049704 | Unclassified | 669 |
| 637 | Ga0501225_0005860 | 3300049705 | Bacteria | 3596 |
| 638 | Ga0501245_003415 | 3300049708 | Bacteria | 2156 |
| 639 | Ga0501079_0197222 | 3300049741 | Bacteria | 1572 |
| 640 | Ga0501079_0345924 | 3300049741 | Bacteria | 1165 |
| 641 | Ga0501081_0260169 | 3300049743 | Unclassified | 1268 |
| 642 | Ga0501081_0352066 | 3300049743 | Bacteria | 1085 |
| 643 | Ga0501081_0513199 | 3300049743 | Bacteria | 894 |
| 644 | Ga0501264_025873 | 3300049761 | Bacteria | 649 |
| 645 | Ga0501268_000435 | 3300049765 | Unclassified | 4502 |
| 646 | Ga0501035_0008182 | 3300049822 | Bacteria | 9744 |
| 647 | Ga0501035_0016094 | 3300049822 | Bacteria | 6901 |
| 648 | Ga0501035_0610153 | 3300049822 | Unclassified | 888 |
| 649 | Ga0501044_0001375 | 3300049823 | Bacteria | 28520 |
| 650 | Ga0501044_0026721 | 3300049823 | Bacteria | 6109 |
| 651 | Ga0501044_0240090 | 3300049823 | Unclassified | 1756 |
| 652 | nmdc:mga05p37_1189156_c1 | 3300050507 | Bacteria | 789 |
| 653 | nmdc:mga05p37_1200058_c1 | 3300050507 | Unclassified | 784 |
| 654 | nmdc:mga05p37_145833_c1 | 3300050507 | Bacteria | 2899 |
| 655 | nmdc:mga09592_300766_c1 | 3300050508 | Bacteria | 1391 |
| 656 | nmdc:mga0qj67_532631_c1 | 3300050509 | Bacteria | 943 |
| 657 | nmdc:mga06r32_139610_c1 | 3300050510 | Unclassified | 2399 |
| 658 | nmdc:mga06r32_53086_c1 | 3300050510 | Bacteria | 3883 |
| 659 | nmdc:mga06r32_587938_c1 | 3300050510 | Unclassified | 1085 |
| 660 | nmdc:mga08y16_15652_c1 | 3300050511 | Bacteria | 7975 |
| 661 | nmdc:mga0n895_13203_c1 | 3300050512 | Bacteria | 7441 |
| 662 | nmdc:mga0n895_26470_c1 | 3300050512 | Bacteria | 5495 |
| 663 | nmdc:mga0n895_417189_c1 | 3300050512 | Bacteria | 1357 |
| 664 | nmdc:mga0n895_82917_c1 | 3300050512 | Unclassified | 3197 |
| 665 | nmdc:mga0n895_878660_c1 | 3300050512 | Bacteria | 883 |
| 666 | nmdc:mga0rr50_187040_c1 | 3300050513 | Bacteria | 1696 |
| 667 | nmdc:mga0rr50_933036_c1 | 3300050513 | Bacteria | 740 |
| 668 | nmdc:mga08x19_15238_c2 | 3300050514 | Bacteria | 3833 |
| 669 | nmdc:mga08x19_285967_c1 | 3300050514 | Unclassified | 1143 |
| 670 | nmdc:mga08x19_33036_c1 | 3300050514 | Bacteria | 3264 |
| 671 | nmdc:mga0a205_288871_c1 | 3300050515 | Bacteria | 1515 |
| 672 | nmdc:mga0a205_29377_c1 | 3300050515 | Bacteria | 5260 |
| 673 | nmdc:mga0a205_773571_c1 | 3300050515 | Unclassified | 808 |
| 674 | Ga0495601_0019485 | 3300053077 | Unclassified | 4138 |
| 675 | Ga0495601_0134502 | 3300053077 | Bacteria | 1611 |
| 676 | Ga0495612_0006380 | 3300053078 | Unclassified | 4854 |
| 677 | Ga0495612_0063399 | 3300053078 | Bacteria | 1533 |
| 678 | Ga0495595_0214382 | 3300053084 | Bacteria | 960 |
| 679 | Ga0495619_0012227 | 3300053085 | Bacteria | 5399 |
| 680 | Ga0495619_0280993 | 3300053085 | Bacteria | 1153 |
| 681 | Ga0495619_0546880 | 3300053085 | Unclassified | 794 |
| 682 | Ga0500583_0050352 | 3300053092 | Unclassified | 1931 |
| 683 | Ga0500554_043714 | 3300053102 | Bacteria | 1385 |
| 684 | Ga0500628_000335 | 3300053129 | Bacteria | 9033 |
| 685 | Ga0500577_0114370 | 3300053142 | Bacteria | 1117 |
| 686 | Ga0500586_160587 | 3300053145 | Bacteria | 762 |
| 687 | Ga0500596_026796 | 3300053735 | Bacteria | 883 |
| 688 | Ga0501084_0857765 | 3300054114 | Bacteria | 764 |
| 689 | Ga0590071_007993 | 3300059421 | Bacteria | 2499 |
| 690 | nmdc:mga0qj67_867832_c1 | |||
| 691 | MBSR1b_contig_7113257 | |||
| 692 | JGI25406J46586_10027133 | |||
| 693 | Ga0058861_11254204 | |||
| 694 | Ga0065715_10155019 | |||
| 695 | Ga0070658_11017278 | |||
| 696 | Ga0070676_10082868 | |||
| 697 | Ga0070676_10229131 | |||
| 698 | Ga0070676_11108804 | |||
| 699 | Ga0070683_100018701 | |||
| 700 | Ga0070683_100048126 | |||
| 701 | Ga0070683_100105630 | |||
| 702 | Ga0070683_100140094 | |||
| 703 | Ga0070683_100806179 | |||
| 704 | Ga0070690_100199565 | |||
| 705 | Ga0070680_100002160 | |||
| 706 | Ga0070680_100017939 | |||
| 707 | Ga0070680_100074412 | |||
| 708 | Ga0070680_100107617 | |||
| 709 | Ga0070680_100207641 | |||
| 710 | Ga0070680_100248916 | |||
| 711 | Ga0070680_100902931 | |||
| 712 | Ga0070680_101741593 | |||
| 713 | Ga0070682_100177954 | |||
| 714 | Ga0068868_100047687 | |||
| 715 | Ga0068868_100228985 | |||
| 716 | Ga0070660_100013102 | |||
| 717 | Ga0070660_100479078 | |||
| 718 | Ga0070691_10079477 | |||
| 719 | Ga0070691_10217178 | |||
| 720 | Ga0070691_10259335 | |||
| 721 | Ga0070691_10647094 | |||
| 722 | Ga0070687_100029297 | |||
| 723 | Ga0070687_100106100 | |||
| 724 | Ga0070687_100132182 | |||
| 725 | Ga0070661_100000718 | |||
| 726 | Ga0070661_100144489 | |||
| 727 | Ga0070692_10011167 | |||
| 728 | Ga0070692_10019832 | |||
| 729 | Ga0070669_100236042 | |||
| 730 | Ga0070669_100555434 | |||
| 731 | Ga0070675_100390857 | |||
| 732 | Ga0070675_101122138 | |||
| 733 | Ga0070671_100396306 | |||
| 734 | Ga0070674_100320335 | |||
| 735 | Ga0070673_100099877 | |||
| 736 | Ga0070673_100102908 | |||
| 737 | Ga0070688_100073019 | |||
| 738 | Ga0070688_100649786 | |||
| 739 | Ga0070667_100080602 | |||
| 740 | Ga0070709_10003599 | |||
| 741 | Ga0070709_10023328 | |||
| 742 | Ga0070709_10036117 | |||
| 743 | Ga0070714_100078321 | |||
| 744 | Ga0070713_100000365 | |||
| 745 | Ga0070713_101019650 | |||
| 746 | Ga0070710_10181297 | |||
| 747 | Ga0070701_10003239 | |||
| 748 | Ga0070701_10144819 | |||
| 749 | Ga0070701_10251948 | |||
| 750 | Ga0070711_100072603 | |||
| 751 | Ga0070711_100273926 | |||
| 752 | Ga0070711_100687293 | |||
| 753 | Ga0070705_100320480 | |||
| 754 | Ga0070700_100012485 | |||
| 755 | Ga0070700_100056535 | |||
| 756 | Ga0070700_100404168 | |||
| 757 | Ga0070694_100036874 | |||
| 758 | Ga0070694_100372594 | |||
| 759 | Ga0070708_100002649 | |||
| 760 | Ga0070708_100053104 | |||
| 761 | Ga0070708_100798424 | |||
| 762 | Ga0070708_101065545 | |||
| 763 | Ga0070663_100184510 | |||
| 764 | Ga0070663_100267913 | |||
| 765 | Ga0070662_100005154 | |||
| 766 | Ga0070681_10000119 | |||
| 767 | Ga0070681_10012112 | |||
| 768 | Ga0070681_10012713 | |||
| 769 | Ga0070681_10042038 | |||
| 770 | Ga0070681_10105541 | |||
| 771 | Ga0070681_10212364 | |||
| 772 | Ga0070681_10220634 | |||
| 773 | Ga0070681_10295948 | |||
| 774 | Ga0070681_10352771 | |||
| 775 | Ga0070681_10670702 | |||
| 776 | Ga0070681_10747356 | |||
| 777 | Ga0070681_10877826 | |||
| 778 | Ga0068867_100012942 | |||
| 779 | Ga0068867_100087623 | |||
| 780 | Ga0070706_100214635 | |||
| 781 | Ga0070706_100931269 | |||
| 782 | Ga0070707_100012069 | |||
| 783 | Ga0070707_100227776 | |||
| 784 | Ga0070707_101630666 | |||
| 785 | Ga0070698_100118685 | |||
| 786 | Ga0070699_100009176 | |||
| 787 | Ga0070699_100034453 | |||
| 788 | Ga0070699_100164873 | |||
| 789 | Ga0070699_100174406 | |||
| 790 | Ga0070699_100185768 | |||
| 791 | Ga0070699_100926061 | |||
| 792 | Ga0070679_100000066 | |||
| 793 | Ga0070679_100003412 | |||
| 794 | Ga0070679_100022174 | |||
| 795 | Ga0070679_100039597 | |||
| 796 | Ga0070679_100088278 | |||
| 797 | Ga0070679_100115196 | |||
| 798 | Ga0070679_100155573 | |||
| 799 | Ga0070679_100614232 | |||
| 800 | Ga0070679_100804184 | |||
| 801 | Ga0070684_100009052 | |||
| 802 | Ga0070684_100011200 | |||
| 803 | Ga0070684_100024204 | |||
| 804 | Ga0070684_100028274 | |||
| 805 | Ga0070684_100087472 | |||
| 806 | Ga0070684_100665202 | |||
| 807 | Ga0070684_101535287 | |||
| 808 | Ga0070697_100183726 | |||
| 809 | Ga0070697_100255183 | |||
| 810 | Ga0070697_100379447 | |||
| 811 | Ga0070697_100421544 | |||
| 812 | Ga0070686_100056610 | |||
| 813 | Ga0070686_100418287 | |||
| 814 | Ga0070695_100017975 | |||
| 815 | Ga0070695_100201004 | |||
| 816 | Ga0070696_100000107 | |||
| 817 | Ga0070696_100043961 | |||
| 818 | Ga0070696_100148215 | |||
| 819 | Ga0070696_100336689 | |||
| 820 | Ga0070693_100006308 | |||
| 821 | Ga0070693_100019267 | |||
| 822 | Ga0070693_100401293 | |||
| 823 | Ga0070665_100278054 | |||
| 824 | Ga0070704_100086597 | |||
| 825 | Ga0068855_100002271 | |||
| 826 | Ga0068855_100044173 | |||
| 827 | Ga0068855_100074748 | |||
| 828 | Ga0068855_100594883 | |||
| 829 | Ga0068854_100226582 | |||
| 830 | Ga0068854_100353289 | |||
| 831 | Ga0068856_100529421 | |||
| 832 | Ga0068856_101247460 | |||
| 833 | Ga0070702_100163551 | |||
| 834 | Ga0068852_100029599 | |||
| 835 | Ga0068852_100049160 | |||
| 836 | Ga0068852_100705418 | |||
| 837 | Ga0068859_100145368 | |||
| 838 | Ga0068859_100241752 | |||
| 839 | Ga0068859_100612496 | |||
| 840 | Ga0068864_100870212 | |||
| 841 | Ga0068866_10011204 | |||
| 842 | Ga0068861_100597076 | |||
| 843 | Ga0068861_100619063 | |||
| 844 | Ga0068858_100325637 | |||
| 845 | Ga0068862_100044961 | |||
| 846 | Ga0081455_10188513 | |||
| 847 | Ga0070717_10005342 | |||
| 848 | Ga0070717_10114705 | |||
| 849 | Ga0070716_100254543 | |||
| 850 | Ga0070712_100022496 | |||
| 851 | Ga0070712_100051807 | |||
| 852 | Ga0068871_100363209 | |||
| 853 | Ga0075428_100625532 | |||
| 854 | Ga0075428_100773190 | |||
| 855 | Ga0075430_100043061 | |||
| 856 | Ga0075430_100941189 | |||
| 857 | Ga0075431_100041102 | |||
| 858 | Ga0075431_100075924 | |||
| 859 | Ga0075433_10010917 | |||
| 860 | Ga0075433_10061187 | |||
| 861 | Ga0075433_10429583 | |||
| 862 | Ga0075434_100004197 | |||
| 863 | Ga0075434_100059637 | |||
| 864 | Ga0075434_100326924 | |||
| 865 | Ga0075434_100387531 | |||
| 866 | Ga0075429_100044871 | |||
| 867 | Ga0075429_100264958 | |||
| 868 | Ga0068865_100065218 | |||
| 869 | Ga0068865_100709599 | |||
| 870 | Ga0075436_100234048 | |||
| 871 | Ga0075436_100594187 | |||
| 872 | Ga0097620_100145363 | |||
| 873 | Ga0097620_100241755 | |||
| 874 | Ga0097620_100612510 | |||
| 875 | Ga0075435_100069868 | |||
| 876 | Ga0075435_101386032 | |||
| 877 | Ga0099794_10000059 | |||
| 878 | Ga0105240_10030397 | |||
| 879 | Ga0105240_10137412 | |||
| 880 | Ga0105240_10427692 | |||
| 881 | Ga0105240_10832703 | |||
| 882 | Ga0111539_10016990 | |||
| 883 | Ga0111539_10017366 | |||
| 884 | Ga0114129_10016042 | |||
| 885 | Ga0114129_10603922 | |||
| 886 | Ga0105241_10085041 | |||
| 887 | Ga0105241_10273467 | |||
| 888 | Ga0105248_10045032 | |||
| 889 | Ga0105248_10102481 | |||
| 890 | Ga0105238_10029562 | |||
| 891 | Ga0105238_10033352 | |||
| 892 | Ga0105239_12067769 | |||
| 893 | Ga0157373_10011686 | |||
| 894 | Ga0157371_10013927 | |||
| 895 | Ga0157370_10003680 | |||
| 896 | Ga0157370_10058871 | |||
| 897 | Ga0157370_10158568 | |||
| 898 | Ga0157370_10377296 | |||
| 899 | Ga0157370_10551516 | |||
| 900 | Ga0157369_10016784 | |||
| 901 | Ga0157369_10068321 | |||
| 902 | Ga0157369_10127726 | |||
| 903 | Ga0157374_12060720 | |||
| 904 | Ga0157378_10446236 | |||
| 905 | Ga0157378_10490569 | |||
| 906 | Ga0157372_10002786 | |||
| 907 | Ga0157372_10009596 | |||
| 908 | Ga0157372_10033314 | |||
| 909 | Ga0157372_10042027 | |||
| 910 | Ga0157372_10050005 | |||
| 911 | Ga0157375_10096223 | |||
| 912 | Ga0157375_10577086 | |||
| 913 | Ga0157375_10828356 | |||
| 914 | Ga0163163_10284617 | |||
| 915 | Ga0157380_10144849 | |||
| 916 | Ga0157377_10168987 | |||
| 917 | Ga0207692_10134092 | |||
| 918 | Ga0207699_10047210 | |||
| 919 | Ga0207699_10070799 | |||
| 920 | Ga0207699_10115585 | |||
| 921 | Ga0207699_10286176 | |||
| 922 | Ga0207645_10018381 | |||
| 923 | Ga0207705_10005450 | |||
| 924 | Ga0207705_10141440 | |||
| 925 | Ga0207705_10193201 | |||
| 926 | Ga0207705_10297916 | |||
| 927 | Ga0207684_10862021 | |||
| 928 | Ga0207654_10164022 | |||
| 929 | Ga0207654_10841467 | |||
| 930 | Ga0207707_10001516 | |||
| 931 | Ga0207707_10002653 | |||
| 932 | Ga0207707_10003111 | |||
| 933 | Ga0207707_10021937 | |||
| 934 | Ga0207707_10061286 | |||
| 935 | Ga0207707_10110999 | |||
| 936 | Ga0207707_10172292 | |||
| 937 | Ga0207707_10417104 | |||
| 938 | Ga0207707_10550902 | |||
| 939 | Ga0207695_10002624 | |||
| 940 | Ga0207695_10030043 | |||
| 941 | Ga0207695_10070743 | |||
| 942 | Ga0207695_10705879 | |||
| 943 | Ga0207693_10004234 | |||
| 944 | Ga0207693_10010340 | |||
| 945 | Ga0207693_10068503 | |||
| 946 | Ga0207663_10127726 | |||
| 947 | Ga0207660_10001459 | |||
| 948 | Ga0207660_10090570 | |||
| 949 | Ga0207660_10149871 | |||
| 950 | Ga0207660_10344871 | |||
| 951 | Ga0207660_10519198 | |||
| 952 | Ga0207662_10020690 | |||
| 953 | Ga0207662_10043409 | |||
| 954 | Ga0207662_10088166 | |||
| 955 | Ga0207657_10006253 | |||
| 956 | Ga0207649_10139464 | |||
| 957 | Ga0207649_10144530 | |||
| 958 | Ga0207649_10430692 | |||
| 959 | Ga0207652_10000184 | |||
| 960 | Ga0207652_10002383 | |||
| 961 | Ga0207652_10019280 | |||
| 962 | Ga0207652_10033158 | |||
| 963 | Ga0207652_10072664 | |||
| 964 | Ga0207652_10259714 | |||
| 965 | Ga0207652_10372575 | |||
| 966 | Ga0207652_10724247 | |||
| 967 | Ga0207652_10765049 | |||
| 968 | Ga0207646_10103468 | |||
| 969 | Ga0207646_10221422 | |||
| 970 | Ga0207646_11115316 | |||
| 971 | Ga0207681_10107249 | |||
| 972 | Ga0207694_10020485 | |||
| 973 | Ga0207694_10082527 | |||
| 974 | Ga0207659_10697433 | |||
| 975 | Ga0207700_10000601 | |||
| 976 | Ga0207700_10011250 | |||
| 977 | Ga0207664_10060871 | |||
| 978 | Ga0207706_10007439 | |||
| 979 | Ga0207706_10069928 | |||
| 980 | Ga0207669_10116598 | |||
| 981 | Ga0207704_10317607 | |||
| 982 | Ga0207711_10114664 | |||
| 983 | Ga0207689_10045966 | |||
| 984 | Ga0207661_10004594 | |||
| 985 | Ga0207661_10050354 | |||
| 986 | Ga0207661_10079166 | |||
| 987 | Ga0207661_10362844 | |||
| 988 | Ga0207661_11022913 | |||
| 989 | Ga0207667_10001901 | |||
| 990 | Ga0207667_10040067 | |||
| 991 | Ga0207667_10176364 | |||
| 992 | Ga0207667_10442523 | |||
| 993 | Ga0207667_10754298 | |||
| 994 | Ga0207651_10492637 | |||
| 995 | Ga0207668_10856802 | |||
| 996 | Ga0207640_10000855 | |||
| 997 | Ga0207640_10009373 | |||
| 998 | Ga0207658_10111914 | |||
| 999 | Ga0207677_10052671 | |||
| 1000 | Ga0207677_10298351 | |||
| 1001 | Ga0207678_10000599 | |||
| 1002 | Ga0207678_10099438 | |||
| 1003 | Ga0207708_10016907 | |||
| 1004 | Ga0207708_10230732 | |||
| 1005 | Ga0207702_11151351 | |||
| 1006 | Ga0207648_10044412 | |||
| 1007 | Ga0207676_10361887 | |||
| 1008 | Ga0207675_100073178 | |||
| 1009 | Ga0207675_100189408 | |||
| 1010 | Ga0207675_100201325 | |||
| 1011 | Ga0207698_10049004 | |||
| 1012 | Ga0209969_1008709 | |||
| 1013 | Ga0209967_1025214 | |||
| 1014 | Ga0209981_1010436 | |||
| 1015 | Ga0209981_1055348 | |||
| 1016 | Ga0210000_1016596 | |||
| 1017 | Ga0209995_1001619 | |||
| 1018 | Ga0209968_1007357 | |||
| 1019 | Ga0209968_1009646 | |||
| 1020 | Ga0209999_1004833 | |||
| 1021 | Ga0209999_1038128 | |||
| 1022 | Ga0209588_1003020 | |||
| 1023 | Ga0209998_10000274 | |||
| 1024 | Ga0209974_10035854 | |||
| 1025 | Ga0207428_10201618 | |||
| 1026 | Ga0207428_10452360 | |||
| 1027 | Ga0268265_10090110 | |||
| 1028 | Ga0268264_11001206 | |||
| 1029 | Ga0265332_10008139 | |||
| 1030 | Ga0265320_10080759 | |||
| 1031 | Ga0265340_10069845 | |||
| 1032 | Ga0307408_100007301 | |||
| 1033 | Ga0307408_100015459 | |||
| 1034 | Ga0307408_100142769 | |||
| 1035 | Ga0307408_100183793 | |||
| 1036 | Ga0307408_100498899 | |||
| 1037 | Ga0265314_10136631 | |||
| 1038 | Ga0265342_10020882 | |||
| 1039 | Ga0307405_10000555 | |||
| 1040 | Ga0307405_10000716 | |||
| 1041 | Ga0307405_10040514 | |||
| 1042 | Ga0307413_10010197 | |||
| 1043 | Ga0307413_10102036 | |||
| 1044 | Ga0307413_11409896 | |||
| 1045 | Ga0307410_10000571 | |||
| 1046 | Ga0307410_10008576 | |||
| 1047 | Ga0307410_10051378 | |||
| 1048 | Ga0307410_10053205 | |||
| 1049 | Ga0307410_10127985 | |||
| 1050 | Ga0307410_10371156 | |||
| 1051 | Ga0307410_10433325 | |||
| 1052 | Ga0307410_10931968 | |||
| 1053 | Ga0307406_10013577 | |||
| 1054 | Ga0307406_10029885 | |||
| 1055 | Ga0307406_10169470 | |||
| 1056 | Ga0307406_10205944 | |||
| 1057 | Ga0307406_10227780 | |||
| 1058 | Ga0307406_10552926 | |||
| 1059 | Ga0307406_10879423 | |||
| 1060 | Ga0307407_10002531 | |||
| 1061 | Ga0307407_10002737 | |||
| 1062 | Ga0307407_10060474 | |||
| 1063 | Ga0307407_10161205 | |||
| 1064 | Ga0307412_10005921 | |||
| 1065 | Ga0307412_10006175 | |||
| 1066 | Ga0307412_10012952 | |||
| 1067 | Ga0307412_10047450 | |||
| 1068 | Ga0307412_10868604 | |||
| 1069 | Ga0307409_100000084 | |||
| 1070 | Ga0307409_100000742 | |||
| 1071 | Ga0307409_100073955 | |||
| 1072 | Ga0307409_100074067 | |||
| 1073 | Ga0307409_100089815 | |||
| 1074 | Ga0307409_100389893 | |||
| 1075 | Ga0307409_100483839 | |||
| 1076 | Ga0307409_100697010 | |||
| 1077 | Ga0307416_100000582 | |||
| 1078 | Ga0307416_100012115 | |||
| 1079 | Ga0307416_100024173 | |||
| 1080 | Ga0307416_100033976 | |||
| 1081 | Ga0307416_100055905 | |||
| 1082 | Ga0307416_100154738 | |||
| 1083 | Ga0307416_100270080 | |||
| 1084 | Ga0307416_100305367 | |||
| 1085 | Ga0307416_100313233 | |||
| 1086 | Ga0307416_100438385 | |||
| 1087 | Ga0307416_100996369 | |||
| 1088 | Ga0307416_101444157 | |||
| 1089 | Ga0307416_101537097 | |||
| 1090 | Ga0307414_10004059 | |||
| 1091 | Ga0307414_10388299 | |||
| 1092 | Ga0307414_10404026 | |||
| 1093 | Ga0307414_10478206 | |||
| 1094 | Ga0307414_10689840 | |||
| 1095 | Ga0307411_10000070 | |||
| 1096 | Ga0307411_10000464 | |||
| 1097 | Ga0307411_10269735 | |||
| 1098 | Ga0307411_10281805 | |||
| 1099 | Ga0307411_10980194 | |||
| 1100 | Ga0307415_100012688 | |||
| 1101 | Ga0307415_100063514 | |||
| 1102 | Ga0307415_100123083 | |||
| 1103 | Ga0307415_100336987 | |||
| 1104 | Ga0307415_100415035 | |||
| 1105 | Ga0307415_100440999 | |||
| 1106 | Ga0307415_100664956 | |||
| 1107 | Ga0307415_100741583 | |||
| 1108 | Ga0307415_101147179 | |||
| 1109 | Ga0307415_101236366 | |||
| 1110 | Ga0373938_0039572 | |||
| 1111 | Ga0373926_0000731 | |||
| 1112 | Ga0373934_0003588 | |||
| 1113 | Ga0373934_0013031 | |||
| 1114 | Ga0373944_0013591 | |||
| 1115 | Ga0373923_0004376 | |||
| 1116 | Ga0373936_0039903 | |||
| 1117 | Ga0373941_0003829 | |||
| 1118 | Ga0373945_0011667 | |||
| 1119 | Ga0373945_0171212 | |||
| 1120 | Ga0373953_0004240 | |||
| 1121 | Ga0373953_0112842 | |||
| 1122 | Ga0373954_0018872 | |||
| 1123 | Ga0373956_0119668 | |||
| 1124 | Ga0373957_0025895 | |||
| 1125 | Ga0373957_0040474 | |||
| 1126 | Ga0373960_0072614 | |||
| 1127 | Ga0373943_0024931 | |||
| 1128 | Ga0373955_0042205 | |||
| 1129 | Ga0373942_0087674 | |||
| 1130 | Ga0373924_0323359 | |||
| 1131 | Ga0373935_0008971 | |||
| 1132 | Ga0373935_0213549 | |||
| 1133 | Ga0373927_0010703 | |||
| 1134 | Ga0373927_0260959 | |||
| 1135 | Ga0373933_0008609 | |||
| 1136 | Ga0373933_0170060 | |||
| 1137 | Ga0373947_0002620 | |||
| 1138 | Ga0373937_0008633 | |||
| 1139 | Ga0373937_0058483 | |||
| 1140 | Ga0373937_0093255 | |||
| 1141 | Ga0373925_0002987 | |||
| 1142 | Ga0373925_0070236 | |||
| 1143 | Ga0373925_0134938 | |||
| 1144 | Ga0439436_0126766 | |||
| 1145 | Ga0439462_0082213 | |||
| 1146 | Ga0439434_0024995 | |||
| 1147 | Ga0439435_0141928 | |||
| 1148 | Ga0451577_0000001 | |||
| 1149 | Ga0451577_0003144 | |||
| 1150 | Ga0451577_0006182 | |||
| 1151 | Ga0451577_0012030 | |||
| 1152 | Ga0451577_0037993 | |||
| 1153 | Ga0451577_0498620 | |||
| 1154 | Ga0451577_0508620 | |||
| 1155 | Ga0451577_0516173 | |||
| 1156 | Ga0451577_0879926 | |||
| 1157 | Ga0466969_0060917 | |||
| 1158 | Ga0466966_0011886 | |||
| 1159 | Ga0466966_0089775 | |||
| 1160 | Ga0466961_0002229 | |||
| 1161 | Ga0466963_0215414 | |||
| 1162 | Ga0466964_0120295 | |||
| 1163 | Ga0453684_0001936 | |||
| 1164 | Ga0453684_0042658 | |||
| 1165 | Ga0453684_0068150 | |||
| 1166 | Ga0453684_1776906 | |||
| 1167 | Ga0466957_0100755 | |||
| 1168 | Ga0466959_0058194 | |||
| 1169 | Ga0451576_0020415 | |||
| 1170 | Ga0451576_0036756 | |||
| 1171 | Ga0451576_0047821 | |||
| 1172 | Ga0466958_0112777 | |||
| 1173 | Ga0466967_0043886 | |||
| 1174 | Ga0495592_0024160 | |||
| 1175 | Ga0495592_0066816 | |||
| 1176 | Ga0495592_0157765 | |||
| 1177 | Ga0495603_0002982 | |||
| 1178 | Ga0495603_0010128 | |||
| 1179 | Ga0495629_0014112 | |||
| 1180 | Ga0495629_0066215 | |||
| 1181 | Ga0495651_0012210 | |||
| 1182 | Ga0495651_0121374 | |||
| 1183 | Ga0495653_0017133 | |||
| 1184 | Ga0495653_0019406 | |||
| 1185 | Ga0495653_0106169 | |||
| 1186 | Ga0495580_0005679 | |||
| 1187 | Ga0495580_0028551 | |||
| 1188 | Ga0495580_0627283 | |||
| 1189 | Ga0495582_0005504 | |||
| 1190 | Ga0495582_0021050 | |||
| 1191 | Ga0495639_0000704 | |||
| 1192 | Ga0495639_0056059 | |||
| 1193 | Ga0495639_0331344 | |||
| 1194 | Ga0495662_0164175 | |||
| 1195 | Ga0495664_0018129 | |||
| 1196 | Ga0495608_0013916 | |||
| 1197 | Ga0495608_0029791 | |||
| 1198 | Ga0495608_0159058 | |||
| 1199 | Ga0495608_0225512 | |||
| 1200 | Ga0495618_0106210 | |||
| 1201 | Ga0495628_0005937 | |||
| 1202 | Ga0495628_0072022 | |||
| 1203 | Ga0495630_0018256 | |||
| 1204 | Ga0495630_0057174 | |||
| 1205 | Ga0495630_0134362 | |||
| 1206 | Ga0495643_0000249 | |||
| 1207 | Ga0495652_0014836 | |||
| 1208 | Ga0495652_0058304 | |||
| 1209 | Ga0495652_0441741 | |||
| 1210 | Ga0495665_0001067 | |||
| 1211 | Ga0495665_0009112 | |||
| 1212 | Ga0495640_0017040 | |||
| 1213 | Ga0495640_0121824 | |||
| 1214 | Ga0495586_0707697 | |||
| 1215 | Ga0495587_0007410 | |||
| 1216 | Ga0495587_0010356 | |||
| 1217 | Ga0495598_0103586 | |||
| 1218 | Ga0495645_0015144 | |||
| 1219 | Ga0495645_0040476 | |||
| 1220 | Ga0495645_0173034 | |||
| 1221 | Ga0495622_0111379 | |||
| 1222 | Ga0495667_0006744 | |||
| 1223 | Ga0495667_0021279 | |||
| 1224 | Ga0495667_0414042 | |||
| 1225 | Ga0495656_0251352 | |||
| 1226 | Ga0495634_0061553 | |||
| 1227 | Ga0495634_0289771 | |||
| 1228 | Ga0495635_0004505 | |||
| 1229 | Ga0495635_0011934 | |||
| 1230 | Ga0495635_0435305 | |||
| 1231 | Ga0495659_0073384 | |||
| 1232 | Ga0495588_0001415 | |||
| 1233 | Ga0495657_0015202 | |||
| 1234 | Ga0495657_0151006 | |||
| 1235 | Ga0495657_0547366 | |||
| 1236 | Ga0495599_0010839 | |||
| 1237 | Ga0495599_0013143 | |||
| 1238 | Ga0495599_0032011 | |||
| 1239 | Ga0495599_0135774 | |||
| 1240 | Ga0495599_0629339 | |||
| 1241 | Ga0495623_0002993 | |||
| 1242 | Ga0495623_0083164 | |||
| 1243 | Ga0495646_0051771 | |||
| 1244 | Ga0495658_0001668 | |||
| 1245 | Ga0495613_0005287 | |||
| 1246 | Ga0495613_0137953 | |||
| 1247 | Ga0495613_0586587 | |||
| 1248 | Ga0495613_0682270 | |||
| 1249 | Ga0495600_0003030 | |||
| 1250 | Ga0495600_0372013 | |||
| 1251 | Ga0495581_0000809 | |||
| 1252 | Ga0495604_0005420 | |||
| 1253 | Ga0495604_0075674 | |||
| 1254 | Ga0495674_0006248 | |||
| 1255 | Ga0495674_0011877 | |||
| 1256 | Ga0495674_0026894 | |||
| 1257 | Ga0495674_0653292 | |||
| 1258 | Ga0495680_0025992 | |||
| 1259 | Ga0495680_0027329 | |||
| 1260 | Ga0495680_0182286 | |||
| 1261 | Ga0495675_0007997 | |||
| 1262 | Ga0495675_0030392 | |||
| 1263 | Ga0495675_0206069 | |||
| 1264 | Ga0495675_0239155 | |||
| 1265 | Ga0495675_0392955 | |||
| 1266 | Ga0495684_0005933 | |||
| 1267 | Ga0495684_0091913 | |||
| 1268 | Ga0495684_0184704 | |||
| 1269 | Ga0495684_0185284 | |||
| 1270 | Ga0495593_0002738 | |||
| 1271 | Ga0495593_0320295 | |||
| 1272 | Ga0495602_0003786 | |||
| 1273 | Ga0495602_0094817 | |||
| 1274 | Ga0495602_0242281 | |||
| 1275 | Ga0495614_0000708 | |||
| 1276 | Ga0495615_0069194 | |||
| 1277 | Ga0496104_0073425 | |||
| 1278 | Ga0496105_0092303 | |||
| 1279 | Ga0496112_0004132 | |||
| 1280 | Ga0496113_0047993 | |||
| 1281 | Ga0496115_0077378 | |||
| 1282 | Ga0501292_063489 | |||
| 1283 | Ga0501031_0693887 | |||
| 1284 | Ga0501032_0410970 | |||
| 1285 | Ga0501033_0137898 | |||
| 1286 | Ga0501033_0333386 | |||
| 1287 | Ga0501034_0044690 | |||
| 1288 | Ga0501034_0175367 | |||
| 1289 | Ga0501034_0493767 | |||
| 1290 | Ga0501034_0529074 | |||
| 1291 | Ga0501036_0409407 | |||
| 1292 | Ga0501037_0008487 | |||
| 1293 | Ga0501037_0258930 | |||
| 1294 | Ga0501038_0134279 | |||
| 1295 | Ga0501038_0187885 | |||
| 1296 | Ga0501043_0064822 | |||
| 1297 | Ga0501043_0351167 | |||
| 1298 | Ga0501047_0002652 | |||
| 1299 | Ga0501047_0072927 | |||
| 1300 | Ga0501048_0980032 | |||
| 1301 | Ga0501073_0319498 | |||
| 1302 | Ga0501073_0586295 | |||
| 1303 | Ga0501075_0585636 | |||
| 1304 | Ga0501075_0698066 | |||
| 1305 | Ga0501076_0460530 | |||
| 1306 | Ga0501077_0342700 | |||
| 1307 | Ga0501198_052432 | |||
| 1308 | Ga0501201_012826 | |||
| 1309 | Ga0501209_108154 | |||
| 1310 | Ga0501216_001545 | |||
| 1311 | Ga0501217_062110 | |||
| 1312 | Ga0501222_005200 | |||
| 1313 | Ga0501223_037061 | |||
| 1314 | Ga0501224_002012 | |||
| 1315 | Ga0501227_008086 | |||
| 1316 | Ga0501230_007848 | |||
| 1317 | Ga0501233_004321 | |||
| 1318 | Ga0501235_045430 | |||
| 1319 | Ga0501243_008486 | |||
| 1320 | Ga0501249_016906 | |||
| 1321 | Ga0501249_132509 | |||
| 1322 | Ga0501252_014777 | |||
| 1323 | Ga0501255_020195 | |||
| 1324 | Ga0501257_068393 | |||
| 1325 | Ga0501221_121079 | |||
| 1326 | Ga0501225_0005860 | |||
| 1327 | Ga0501245_003415 | |||
| 1328 | Ga0501079_0197222 | |||
| 1329 | Ga0501079_0345924 | |||
| 1330 | Ga0501081_0260169 | |||
| 1331 | Ga0501081_0352066 | |||
| 1332 | Ga0501081_0513199 | |||
| 1333 | Ga0501264_025873 | |||
| 1334 | Ga0501268_000435 | |||
| 1335 | Ga0501035_0008182 | |||
| 1336 | Ga0501035_0016094 | |||
| 1337 | Ga0501035_0610153 | |||
| 1338 | Ga0501044_0001375 | |||
| 1339 | Ga0501044_0026721 | |||
| 1340 | Ga0501044_0240090 | |||
| 1341 | nmdc:mga05p37_1189156_c1 | |||
| 1342 | nmdc:mga05p37_1200058_c1 | |||
| 1343 | nmdc:mga05p37_145833_c1 | |||
| 1344 | nmdc:mga09592_300766_c1 | |||
| 1345 | nmdc:mga0qj67_532631_c1 | |||
| 1346 | nmdc:mga06r32_139610_c1 | |||
| 1347 | nmdc:mga06r32_53086_c1 | |||
| 1348 | nmdc:mga06r32_587938_c1 | |||
| 1349 | nmdc:mga08y16_15652_c1 | |||
| 1350 | nmdc:mga0n895_13203_c1 | |||
| 1351 | nmdc:mga0n895_26470_c1 | |||
| 1352 | nmdc:mga0n895_417189_c1 | |||
| 1353 | nmdc:mga0n895_82917_c1 | |||
| 1354 | nmdc:mga0n895_878660_c1 | |||
| 1355 | nmdc:mga0rr50_187040_c1 | |||
| 1356 | nmdc:mga0rr50_933036_c1 | |||
| 1357 | nmdc:mga08x19_15238_c2 | |||
| 1358 | nmdc:mga08x19_285967_c1 | |||
| 1359 | nmdc:mga08x19_33036_c1 | |||
| 1360 | nmdc:mga0a205_288871_c1 | |||
| 1361 | nmdc:mga0a205_29377_c1 | |||
| 1362 | nmdc:mga0a205_773571_c1 | |||
| 1363 | Ga0495601_0019485 | |||
| 1364 | Ga0495601_0134502 | |||
| 1365 | Ga0495612_0006380 | |||
| 1366 | Ga0495612_0063399 | |||
| 1367 | Ga0495595_0214382 | |||
| 1368 | Ga0495619_0012227 | |||
| 1369 | Ga0495619_0280993 | |||
| 1370 | Ga0495619_0546880 | |||
| 1371 | Ga0500583_0050352 | |||
| 1372 | Ga0500554_043714 | |||
| 1373 | Ga0500628_000335 | |||
| 1374 | Ga0500577_0114370 | |||
| 1375 | Ga0500586_160587 | |||
| 1376 | Ga0500596_026796 | |||
| 1377 | Ga0501084_0857765 | |||
| 1378 | Ga0590071_007993 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3eye-assembly1.cif.gz_A | crystal structure of pts system n-acetylgalactosamine-specific iib component 1 from escherichia coli | 0.9221 | 3 | 151 |
| 3p3v-assembly1.cif.gz_A | crystal structure of a pts dependent n-acetyl-galactosamine-iib component (agav, spy_0631) from streptococcus pyogenes at 1.65 a resolution | 0.9078 | 1 | 155 |
| 2jzn-assembly1.cif.gz_C | solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system | 0.9068 | 1 | 158 |
| 5t5d-assembly1.cif.gz_A | crystal structure of the pts iib protein associated with the fucose utilization operon from streptococcus pneumoniae | 0.9028 | 3 | 155 |
| 3eye-assembly1.cif.gz_A | crystal structure of pts system n-acetylgalactosamine-specific iib component 1 from escherichia coli | 0.8936 | 3 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P42904_1_156_3.40.35.10 | Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component | 0.942 | 2 | 155 | 3.40.35.10 |
| 3eyeA00 | Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component | 0.9221 | 3 | 151 | 3.40.35.10 |
| af_P42904_1_156_3.40.35.10 | Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component | 0.919 | 2 | 155 | 3.40.35.10 |
| af_P69797_159_323_3.40.35.10 | Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component | 0.9121 | 1 | 158 | 3.40.35.10 |
| 5t5dA00 | Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component | 0.9028 | 3 | 155 | 3.40.35.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7JRT8-F1-model_v4 | PTS EIIB type-4 domain-containing protein | 0.9953 | 19 | 162 |
GO:0005737
GO:0008982 GO:0009401 GO:0016301 |
| AF-A0A2G4IHJ4-F1-model_v4 | PTS EIIB type-4 domain-containing protein | 0.9947 | 2 | 158 |
GO:0005737
GO:0008982 GO:0009401 GO:0016301 |
| AF-A0A1E4B7F9-F1-model_v4 | PTS EIIB type-4 domain-containing protein | 0.993 | 2 | 160 |
GO:0005737
GO:0008982 GO:0009401 GO:0016301 |
| AF-A0A1Q7KC78-F1-model_v4 | PTS EIIB type-4 domain-containing protein | 0.9925 | 1 | 156 |
GO:0005737
GO:0008982 GO:0009401 GO:0016301 |
| AF-A0A2V7JRT8-F1-model_v4 | PTS EIIB type-4 domain-containing protein | 0.9884 | 19 | 162 |
GO:0005737
GO:0008982 GO:0009401 GO:0016301 |