F475371

General Info

Members Datasets Scaffolds Average Seq Length
689 243 1378 107

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10250163|Ga0070701_102501632
Length 124
Sequence MQLALPDGQAADTKEGTMAYTHHELKHKTLAELRDIAKDIQHDAVQGYTQLNKEHLVVAICQALNIEMHEHHDVVGIDKAAIKSRIKALKAKRDEAINAHDHAALKKARRGIHRLKRQIHKATV

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
196 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.89
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 32.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10250163 3300005438 Bacteria 1070
2 CNAas_1001213 3300000532 Bacteria 2308
3 rootL2_10321848 3300003322 Unclassified 1147
4 Ga0058863_10003188 3300004799 Bacteria 2469
5 Ga0058863_11030591 3300004799 Unclassified 878
6 Ga0058861_10087753 3300004800 Bacteria 1549
7 Ga0058862_10059034 3300004803 Bacteria 1644
8 Ga0065714_10064448 3300005288 Bacteria 81247
9 Ga0065714_10432047 3300005288 Unclassified 552
10 Ga0065704_10107877 3300005289 Bacteria 2041
11 Ga0065704_10627652 3300005289 Bacteria 593
12 Ga0065704_10630925 3300005289 Bacteria 592
13 Ga0065712_10018227 3300005290 Bacteria 1335
14 Ga0065712_10647557 3300005290 Bacteria 569
15 Ga0065712_10746057 3300005290 Unclassified 530
16 Ga0065715_10719438 3300005293 Bacteria 631
17 Ga0065715_10757465 3300005293 Unclassified 627
18 Ga0065707_10208407 3300005295 Bacteria 1277
19 Ga0065707_10216915 3300005295 Bacteria 1241
20 Ga0065707_10382260 3300005295 Bacteria 875
21 Ga0065707_10966224 3300005295 Unclassified 548
22 Ga0070676_10013005 3300005328 Unclassified 4560
23 Ga0070676_10091762 3300005328 Unclassified 1862
24 Ga0070676_10461510 3300005328 Unclassified 895
25 Ga0070676_10801370 3300005328 Bacteria 695
26 Ga0070676_10923349 3300005328 Unclassified 651
27 Ga0070690_100197490 3300005330 Unclassified 1398
28 Ga0070690_100540635 3300005330 Bacteria 877
29 Ga0070670_100017411 3300005331 Bacteria 6163
30 Ga0070670_100077412 3300005331 Bacteria 2858
31 Ga0070670_100645040 3300005331 Bacteria 950
32 Ga0070670_101223325 3300005331 Bacteria 687
33 Ga0070670_101241444 3300005331 Unclassified 682
34 Ga0068869_100277966 3300005334 Bacteria 1346
35 Ga0068869_100447549 3300005334 Bacteria 1070
36 Ga0070666_10709647 3300005335 Unclassified 738
37 Ga0070680_100019628 3300005336 Bacteria 5361
38 Ga0070680_100379093 3300005336 Bacteria 1204
39 Ga0070680_101696071 3300005336 Unclassified 548
40 Ga0070682_100019082 3300005337 Bacteria 4017
41 Ga0068868_100414799 3300005338 Unclassified 1165
42 Ga0068868_101730410 3300005338 Unclassified 590
43 Ga0070660_100076155 3300005339 Bacteria 2628
44 Ga0070689_100039138 3300005340 Bacteria 3629
45 Ga0070689_100097188 3300005340 Bacteria 2328
46 Ga0070689_100779848 3300005340 Bacteria 839
47 Ga0070689_101970411 3300005340 Unclassified 534
48 Ga0070687_100292511 3300005343 Unclassified 1030
49 Ga0070687_101003993 3300005343 Unclassified 605
50 Ga0070692_10029023 3300005345 Bacteria 2755
51 Ga0070692_10055700 3300005345 Bacteria 2068
52 Ga0070668_100568249 3300005347 Unclassified 989
53 Ga0070669_100005699 3300005353 Bacteria 8983
54 Ga0070669_100038321 3300005353 Bacteria 3480
55 Ga0070669_100072206 3300005353 Bacteria 2554
56 Ga0070669_101242360 3300005353 Bacteria 644
57 Ga0070675_100023125 3300005354 Bacteria 4967
58 Ga0070675_100436987 3300005354 Bacteria 1172
59 Ga0070675_101080226 3300005354 Bacteria 738
60 Ga0070674_101082914 3300005356 Unclassified 707
61 Ga0070673_100259315 3300005364 Bacteria 1518
62 Ga0070673_100282515 3300005364 Bacteria 1456
63 Ga0070673_101463635 3300005364 Unclassified 644
64 Ga0070673_101704755 3300005364 Unclassified 596
65 Ga0070688_100826589 3300005365 Bacteria 726
66 Ga0070659_100099443 3300005366 Bacteria 2340
67 Ga0070703_10018325 3300005406 Bacteria 2023
68 Ga0070714_101869537 3300005435 Bacteria 586
69 Ga0070713_100283616 3300005436 Bacteria 1520
70 Ga0070701_10221584 3300005438 Bacteria 1128
71 Ga0070701_10681787 3300005438 Unclassified 689
72 Ga0070701_11140466 3300005438 Bacteria 550
73 Ga0070711_100262692 3300005439 Bacteria 1359
74 Ga0070705_100071334 3300005440 Bacteria 2101
75 Ga0070705_100077709 3300005440 Unclassified 2028
76 Ga0070705_100216168 3300005440 Bacteria 1324
77 Ga0070705_100248907 3300005440 Bacteria 1246
78 Ga0070705_100661647 3300005440 Unclassified 816
79 Ga0070705_100932011 3300005440 Unclassified 701
80 Ga0070705_101154768 3300005440 Bacteria 636
81 Ga0070700_100008158 3300005441 Bacteria 5698
82 Ga0070700_100073070 3300005441 Bacteria 2194
83 Ga0070700_100085754 3300005441 Bacteria 2043
84 Ga0070700_100089378 3300005441 Bacteria 2007
85 Ga0070700_100095771 3300005441 Bacteria 1946
86 Ga0070700_100145168 3300005441 Bacteria 1617
87 Ga0070700_101940107 3300005441 Unclassified 510
88 Ga0070694_100002639 3300005444 Bacteria 10606
89 Ga0070694_100008768 3300005444 Bacteria 6196
90 Ga0070694_100027942 3300005444 Bacteria 3667
91 Ga0070694_100040673 3300005444 Bacteria 3099
92 Ga0070694_100159955 3300005444 Bacteria 1652
93 Ga0070694_100235885 3300005444 Unclassified 1378
94 Ga0070694_100394891 3300005444 Bacteria 1081
95 Ga0070694_100866606 3300005444 Unclassified 744
96 Ga0070694_101354831 3300005444 Unclassified 599
97 Ga0070694_101608911 3300005444 Unclassified 551
98 Ga0070708_100252613 3300005445 Bacteria 1656
99 Ga0070708_100511423 3300005445 Bacteria 1133
100 Ga0070708_100714838 3300005445 Unclassified 943
101 Ga0070678_100091271 3300005456 Bacteria 2337
102 Ga0070678_101154680 3300005456 Bacteria 717
103 Ga0070662_100312259 3300005457 Bacteria 1280
104 Ga0070662_101128059 3300005457 Bacteria 673
105 Ga0070681_10011223 3300005458 Bacteria 8860
106 Ga0068867_100444759 3300005459 Bacteria 1103
107 Ga0068867_100594520 3300005459 Bacteria 964
108 Ga0068867_100755750 3300005459 Bacteria 863
109 Ga0068867_101597095 3300005459 Bacteria 609
110 Ga0068867_101731577 3300005459 Unclassified 586
111 Ga0070685_11629004 3300005466 Unclassified 500
112 Ga0070706_100068510 3300005467 Bacteria 3281
113 Ga0070706_100239677 3300005467 Unclassified 1693
114 Ga0070706_100529373 3300005467 Unclassified 1096
115 Ga0070706_100652638 3300005467 Unclassified 977
116 Ga0070706_100807583 3300005467 Unclassified 868
117 Ga0070707_100061855 3300005468 Unclassified 3591
118 Ga0070707_100073300 3300005468 Bacteria 3301
119 Ga0070707_100124125 3300005468 Bacteria 2508
120 Ga0070707_100761131 3300005468 Unclassified 932
121 Ga0070707_100778928 3300005468 Unclassified 920
122 Ga0070707_101858659 3300005468 Unclassified 569
123 Ga0070698_100000512 3300005471 Bacteria 41226
124 Ga0070698_100063333 3300005471 Unclassified 3729
125 Ga0070698_100152257 3300005471 Bacteria 2260
126 Ga0070698_100167000 3300005471 Bacteria 2143
127 Ga0070698_100494070 3300005471 Unclassified 1161
128 Ga0070698_101563725 3300005471 Bacteria 611
129 Ga0070698_102177529 3300005471 Bacteria 508
130 Ga0070699_100037227 3300005518 Bacteria 4209
131 Ga0070699_100110234 3300005518 Bacteria 2416
132 Ga0070699_100289145 3300005518 Unclassified 1469
133 Ga0070699_100323208 3300005518 Unclassified 1387
134 Ga0070699_100656035 3300005518 Bacteria 958
135 Ga0070679_100338570 3300005530 Bacteria 1452
136 Ga0070684_102128664 3300005535 Unclassified 529
137 Ga0070697_100121997 3300005536 Bacteria 2180
138 Ga0070697_100301448 3300005536 Unclassified 1377
139 Ga0070697_100337564 3300005536 Bacteria 1300
140 Ga0070697_100626947 3300005536 Bacteria 946
141 Ga0070697_100933891 3300005536 Bacteria 770
142 Ga0070697_101367232 3300005536 Unclassified 632
143 Ga0070697_101402935 3300005536 Unclassified 624
144 Ga0070672_100294256 3300005543 Bacteria 1375
145 Ga0070672_101394611 3300005543 Bacteria 627
146 Ga0070672_101464545 3300005543 Unclassified 611
147 Ga0070686_100272456 3300005544 Unclassified 1245
148 Ga0070686_100810383 3300005544 Bacteria 755
149 Ga0070695_100005066 3300005545 Bacteria 7762
150 Ga0070695_101331362 3300005545 Unclassified 594
151 Ga0070696_100024375 3300005546 Bacteria 4112
152 Ga0070696_100048377 3300005546 Bacteria 2952
153 Ga0070696_100430217 3300005546 Unclassified 1038
154 Ga0070696_101440564 3300005546 Bacteria 588
155 Ga0070696_102021400 3300005546 Unclassified 501
156 Ga0070693_100016028 3300005547 Bacteria 3871
157 Ga0070693_100114690 3300005547 Bacteria 1663
158 Ga0070693_100139075 3300005547 Bacteria 1526
159 Ga0070693_100511717 3300005547 Unclassified 853
160 Ga0070693_100835825 3300005547 Unclassified 685
161 Ga0070665_102370857 3300005548 Unclassified 533
162 Ga0070704_100008986 3300005549 Bacteria 6022
163 Ga0070704_100015362 3300005549 Bacteria 4809
164 Ga0070704_100021218 3300005549 Unclassified 4207
165 Ga0070704_100051523 3300005549 Bacteria 2899
166 Ga0070704_101006915 3300005549 Bacteria 754
167 Ga0070704_101407787 3300005549 Unclassified 640
168 Ga0070704_101663494 3300005549 Unclassified 589
169 Ga0070704_102218955 3300005549 Unclassified 511
170 Ga0068855_100801784 3300005563 Unclassified 1001
171 Ga0068857_101406540 3300005577 Unclassified 679
172 Ga0068857_102200594 3300005577 Bacteria 541
173 Ga0068854_100104047 3300005578 Bacteria 2132
174 Ga0068854_100419557 3300005578 Unclassified 1111
175 Ga0068854_100600506 3300005578 Unclassified 940
176 Ga0068854_101577185 3300005578 Unclassified 598
177 Ga0070702_100030040 3300005615 Bacteria 2960
178 Ga0070702_100197481 3300005615 Bacteria 1329
179 Ga0070702_100427118 3300005615 Bacteria 955
180 Ga0070702_100763929 3300005615 Bacteria 744
181 Ga0068852_100274987 3300005616 Bacteria 1622
182 Ga0068852_100327747 3300005616 Unclassified 1489
183 Ga0068852_100377914 3300005616 Bacteria 1389
184 Ga0068852_101202221 3300005616 Bacteria 779
185 Ga0068852_101698347 3300005616 Unclassified 654
186 Ga0068859_100007346 3300005617 Bacteria 11179
187 Ga0068859_100052075 3300005617 Unclassified 4116
188 Ga0068859_100055062 3300005617 Bacteria 4002
189 Ga0068859_100352072 3300005617 Bacteria 1567
190 Ga0068859_100488834 3300005617 Bacteria 1326
191 Ga0068859_100591537 3300005617 Bacteria 1203
192 Ga0068859_100730266 3300005617 Bacteria 1080
193 Ga0068859_102947628 3300005617 Unclassified 521
194 Ga0068864_100028528 3300005618 Bacteria 4719
195 Ga0068864_100427473 3300005618 Bacteria 1263
196 Ga0068864_100499007 3300005618 Bacteria 1170
197 Ga0068864_101325184 3300005618 Unclassified 721
198 Ga0068864_101589830 3300005618 Unclassified 658
199 Ga0068866_11254055 3300005718 Bacteria 537
200 Ga0068861_100004341 3300005719 Bacteria 9515
201 Ga0068861_100006028 3300005719 Bacteria 8242
202 Ga0068861_100026521 3300005719 Bacteria 4213
203 Ga0068861_100184250 3300005719 Bacteria 1740
204 Ga0068861_100849354 3300005719 Bacteria 861
205 Ga0068870_10026785 3300005840 Bacteria 2877
206 Ga0068870_10793882 3300005840 Bacteria 661
207 Ga0068863_100160799 3300005841 Bacteria 2152
208 Ga0068863_100303309 3300005841 Bacteria 1549
209 Ga0068863_100776903 3300005841 Bacteria 954
210 Ga0068863_100782114 3300005841 Unclassified 951
211 Ga0068863_100949807 3300005841 Unclassified 861
212 Ga0068858_100288539 3300005842 Bacteria 1564
213 Ga0068858_100296675 3300005842 Bacteria 1541
214 Ga0068858_100930573 3300005842 Unclassified 850
215 Ga0068858_101549736 3300005842 Unclassified 654
216 Ga0068860_100090299 3300005843 Bacteria 2918
217 Ga0068860_100108006 3300005843 Bacteria 2659
218 Ga0068860_100142384 3300005843 Bacteria 2305
219 Ga0068860_100278942 3300005843 Unclassified 1633
220 Ga0068860_100475295 3300005843 Bacteria 1245
221 Ga0068860_101021361 3300005843 Bacteria 845
222 Ga0068860_102588661 3300005843 Unclassified 526
223 Ga0068862_100015433 3300005844 Bacteria 6345
224 Ga0068862_100101401 3300005844 Bacteria 2518
225 Ga0068862_100317731 3300005844 Bacteria 1436
226 Ga0068862_101086623 3300005844 Bacteria 794
227 Ga0068862_101636512 3300005844 Bacteria 651
228 Ga0068862_102283900 3300005844 Unclassified 552
229 Ga0081538_10092629 3300005981 Unclassified 1555
230 Ga0081539_10002993 3300005985 Bacteria 22084
231 Ga0081539_10005135 3300005985 Bacteria 13662
232 Ga0075432_10034018 3300006058 Unclassified 1769
233 Ga0070715_10000007 3300006163 Bacteria 192075
234 Ga0070716_100000007 3300006173 Bacteria 256300
235 Ga0070716_100246263 3300006173 Bacteria 1215
236 Ga0070716_101816625 3300006173 Unclassified 505
237 Ga0097621_100235087 3300006237 Bacteria 1601
238 Ga0097621_101202087 3300006237 Unclassified 714
239 Ga0097621_101211502 3300006237 Unclassified 711
240 Ga0068871_100297976 3300006358 Bacteria 1415
241 Ga0075428_100313564 3300006844 Bacteria 1686
242 Ga0075428_100371407 3300006844 Bacteria 1534
243 Ga0075428_100616731 3300006844 Unclassified 1158
244 Ga0075428_100632514 3300006844 Bacteria 1142
245 Ga0075428_101124322 3300006844 Unclassified 829
246 Ga0075428_101387690 3300006844 Unclassified 738
247 Ga0075428_102536519 3300006844 Unclassified 524
248 Ga0075430_100010429 3300006846 Bacteria 7866
249 Ga0075430_100210430 3300006846 Bacteria 1613
250 Ga0075430_101512848 3300006846 Bacteria 551
251 Ga0075431_100022589 3300006847 Bacteria 6431
252 Ga0075431_100069893 3300006847 Unclassified 3622
253 Ga0075433_10002856 3300006852 Bacteria 13236
254 Ga0075433_10009542 3300006852 Bacteria 7759
255 Ga0075433_10015522 3300006852 Bacteria 6252
256 Ga0075433_10037958 3300006852 Bacteria 4158
257 Ga0075433_10108272 3300006852 Bacteria 2465
258 Ga0075433_10184593 3300006852 Bacteria 1855
259 Ga0075433_10245536 3300006852 Bacteria 1589
260 Ga0075433_10618910 3300006852 Unclassified 950
261 Ga0075433_10968771 3300006852 Unclassified 741
262 Ga0075433_10986905 3300006852 Bacteria 734
263 Ga0075433_11097582 3300006852 Unclassified 692
264 Ga0075434_100000051 3300006871 Bacteria 57214
265 Ga0075434_100014506 3300006871 Bacteria 7533
266 Ga0075434_100016452 3300006871 Bacteria 7110
267 Ga0075434_100021250 3300006871 Bacteria 6309
268 Ga0075434_100099428 3300006871 Bacteria 2914
269 Ga0075434_100193489 3300006871 Bacteria 2054
270 Ga0075434_100925087 3300006871 Bacteria 887
271 Ga0075434_101899061 3300006871 Bacteria 601
272 Ga0075429_100073722 3300006880 Unclassified 2973
273 Ga0075429_100243918 3300006880 Bacteria 1574
274 Ga0075429_100254190 3300006880 Bacteria 1539
275 Ga0075436_100001049 3300006914 Bacteria 18662
276 Ga0075436_100039480 3300006914 Bacteria 3258
277 Ga0075436_100125019 3300006914 Unclassified 1801
278 Ga0075436_100186085 3300006914 Bacteria 1469
279 Ga0075436_100417874 3300006914 Bacteria 973
280 Ga0075436_100877441 3300006914 Unclassified 670
281 Ga0075436_100982964 3300006914 Unclassified 633
282 Ga0097620_100007346 3300006931 Bacteria 11179
283 Ga0097620_100052077 3300006931 Unclassified 4116
284 Ga0097620_100055062 3300006931 Bacteria 4002
285 Ga0097620_100128832 3300006931 Bacteria 2601
286 Ga0097620_100352068 3300006931 Bacteria 1567
287 Ga0097620_100488856 3300006931 Bacteria 1326
288 Ga0097620_100591512 3300006931 Bacteria 1203
289 Ga0097620_100730280 3300006931 Bacteria 1080
290 Ga0097620_102947781 3300006931 Unclassified 521
291 Ga0075435_100000006 3300007076 Bacteria 119843
292 Ga0075435_100000786 3300007076 Bacteria 19744
293 Ga0075435_100031968 3300007076 Bacteria 4153
294 Ga0075435_100192733 3300007076 Unclassified 1725
295 Ga0075435_100317202 3300007076 Bacteria 1334
296 Ga0099794_10766166 3300007265 Unclassified 516
297 Ga0105250_10107820 3300009092 Bacteria 1139
298 Ga0105240_11436657 3300009093 Unclassified 724
299 Ga0105240_11548458 3300009093 Bacteria 694
300 Ga0105240_12303071 3300009093 Unclassified 558
301 Ga0111539_10019217 3300009094 Bacteria 8439
302 Ga0111539_10294404 3300009094 Bacteria 1889
303 Ga0111539_10340900 3300009094 Bacteria 1745
304 Ga0111539_10394722 3300009094 Unclassified 1611
305 Ga0111539_10875068 3300009094 Bacteria 1045
306 Ga0111539_11554515 3300009094 Unclassified 767
307 Ga0105245_10593842 3300009098 Unclassified 1133
308 Ga0105245_10599976 3300009098 Bacteria 1127
309 Ga0105245_11559974 3300009098 Bacteria 712
310 Ga0105245_11838159 3300009098 Bacteria 659
311 Ga0105247_10421980 3300009101 Bacteria 955
312 Ga0105247_10937350 3300009101 Unclassified 671
313 Ga0114129_10004434 3300009147 Bacteria 19818
314 Ga0114129_10015365 3300009147 Bacteria 10893
315 Ga0114129_10017772 3300009147 Bacteria 10126
316 Ga0114129_10028789 3300009147 Bacteria 7871
317 Ga0114129_10079602 3300009147 Bacteria 4556
318 Ga0114129_10401447 3300009147 Bacteria 1806
319 Ga0114129_10445863 3300009147 Bacteria 1698
320 Ga0114129_10584032 3300009147 Bacteria 1449
321 Ga0114129_10597917 3300009147 Bacteria 1430
322 Ga0114129_10759090 3300009147 Bacteria 1241
323 Ga0114129_11239402 3300009147 Unclassified 927
324 Ga0114129_11273512 3300009147 Unclassified 912
325 Ga0114129_12179605 3300009147 Bacteria 667
326 Ga0114129_12822032 3300009147 Bacteria 577
327 Ga0105243_10231072 3300009148 Bacteria 1641
328 Ga0105243_10236284 3300009148 Bacteria 1624
329 Ga0105243_10366905 3300009148 Bacteria 1327
330 Ga0105243_10853419 3300009148 Unclassified 902
331 Ga0105243_10969766 3300009148 Bacteria 851
332 Ga0105241_10147694 3300009174 Bacteria 1920
333 Ga0105241_10279134 3300009174 Unclassified 1426
334 Ga0105241_10304663 3300009174 Bacteria 1368
335 Ga0105241_10322396 3300009174 Unclassified 1333
336 Ga0105241_10392761 3300009174 Bacteria 1215
337 Ga0105242_10112459 3300009176 Bacteria 2324
338 Ga0105242_10697849 3300009176 Bacteria 992
339 Ga0105242_11604401 3300009176 Unclassified 684
340 Ga0105242_12142224 3300009176 Bacteria 603
341 Ga0105248_10046898 3300009177 Bacteria 4845
342 Ga0105248_10493629 3300009177 Bacteria 1380
343 Ga0105248_11040624 3300009177 Bacteria 925
344 Ga0105248_11453792 3300009177 Bacteria 776
345 Ga0105248_11745379 3300009177 Bacteria 706
346 Ga0105237_10384547 3300009545 Bacteria 1408
347 Ga0105238_10107996 3300009551 Bacteria 2764
348 Ga0105238_10874630 3300009551 Bacteria 916
349 Ga0105238_11558496 3300009551 Unclassified 690
350 Ga0105238_12324061 3300009551 Bacteria 571
351 Ga0105249_10068712 3300009553 Bacteria 3268
352 Ga0105249_10270273 3300009553 Unclassified 1693
353 Ga0105249_10372295 3300009553 Bacteria 1452
354 Ga0105249_10448600 3300009553 Bacteria 1328
355 Ga0105249_10628983 3300009553 Bacteria 1130
356 Ga0099796_10442327 3300010159 Unclassified 577
357 Ga0105239_10012393 3300010375 Bacteria 9494
358 Ga0105239_11616993 3300010375 Unclassified 749
359 Ga0105246_10625098 3300011119 Bacteria 934
360 Ga0105246_11172749 3300011119 Unclassified 705
361 Ga0157373_10014383 3300013100 Bacteria 5802
362 Ga0157373_10773662 3300013100 Bacteria 707
363 Ga0157371_10264330 3300013102 Unclassified 1241
364 Ga0157371_10767091 3300013102 Bacteria 725
365 Ga0157371_11512697 3300013102 Unclassified 524
366 Ga0157374_11164180 3300013296 Unclassified 792
367 Ga0157374_12037175 3300013296 Bacteria 600
368 Ga0157378_10067466 3300013297 Bacteria 3206
369 Ga0157378_10195641 3300013297 Bacteria 1909
370 Ga0157378_10389404 3300013297 Archaea 1371
371 Ga0157378_10499404 3300013297 Bacteria 1215
372 Ga0157378_10752960 3300013297 Bacteria 997
373 Ga0157378_13059888 3300013297 Bacteria 519
374 Ga0163162_10051878 3300013306 Bacteria 4117
375 Ga0163162_10107384 3300013306 Bacteria 2887
376 Ga0163162_10126179 3300013306 Bacteria 2665
377 Ga0163162_11188511 3300013306 Bacteria 865
378 Ga0163162_11302984 3300013306 Bacteria 825
379 Ga0163162_11933624 3300013306 Unclassified 675
380 Ga0163162_13188191 3300013306 Bacteria 526
381 Ga0157372_10085250 3300013307 Bacteria 3583
382 Ga0157372_12207994 3300013307 Unclassified 632
383 Ga0157375_10040923 3300013308 Bacteria 4471
384 Ga0157375_10830733 3300013308 Unclassified 1071
385 Ga0157375_11102887 3300013308 Bacteria 929
386 Ga0157375_11416552 3300013308 Unclassified 819
387 Ga0163163_10010566 3300014325 Bacteria 8312
388 Ga0163163_10015016 3300014325 Bacteria 7140
389 Ga0163163_11324782 3300014325 Bacteria 782
390 Ga0163163_12343113 3300014325 Unclassified 593
391 Ga0157380_10018165 3300014326 Bacteria 5217
392 Ga0157380_10082799 3300014326 Bacteria 2627
393 Ga0157380_10601209 3300014326 Bacteria 1088
394 Ga0157380_11962817 3300014326 Bacteria 647
395 Ga0157380_13036029 3300014326 Bacteria 535
396 Ga0157380_13244752 3300014326 Unclassified 520
397 Ga0157380_13448627 3300014326 Bacteria 506
398 Ga0157377_10095159 3300014745 Bacteria 1765
399 Ga0157377_10119305 3300014745 Bacteria 1596
400 Ga0157377_10454664 3300014745 Bacteria 885
401 Ga0157379_10290017 3300014968 Unclassified 1490
402 Ga0157379_11568252 3300014968 Unclassified 642
403 Ga0157379_11903512 3300014968 Bacteria 586
404 Ga0157376_10356182 3300014969 Bacteria 1402
405 Ga0163161_10059003 3300017792 Bacteria 2790
406 Ga0163161_10520725 3300017792 Bacteria 971
407 Ga0163161_11631698 3300017792 Unclassified 569
408 Ga0206356_10795272 3300020070 Bacteria 1664
409 Ga0224712_10088254 3300022467 Bacteria 1294
410 Ga0207697_10243444 3300025315 Unclassified 795
411 Ga0207696_1212458 3300025711 Bacteria 506
412 Ga0207653_10018301 3300025885 Bacteria 2206
413 Ga0207653_10104352 3300025885 Unclassified 1006
414 Ga0207642_10728195 3300025899 Bacteria 627
415 Ga0207710_10422088 3300025900 Bacteria 686
416 Ga0207688_10116907 3300025901 Bacteria 1553
417 Ga0207680_10691343 3300025903 Unclassified 731
418 Ga0207647_10519844 3300025904 Unclassified 662
419 Ga0207685_10000007 3300025905 Bacteria 278341
420 Ga0207699_10616239 3300025906 Bacteria 791
421 Ga0207645_10023283 3300025907 Unclassified 4025
422 Ga0207645_10063619 3300025907 Unclassified 2358
423 Ga0207645_10280490 3300025907 Bacteria 1106
424 Ga0207645_10557272 3300025907 Bacteria 778
425 Ga0207643_10112346 3300025908 Bacteria 1606
426 Ga0207684_10097969 3300025910 Bacteria 2504
427 Ga0207684_10234963 3300025910 Bacteria 1582
428 Ga0207684_10587071 3300025910 Unclassified 952
429 Ga0207684_11425878 3300025910 Unclassified 566
430 Ga0207654_10111100 3300025911 Bacteria 1705
431 Ga0207654_10559734 3300025911 Bacteria 813
432 Ga0207654_10961973 3300025911 Bacteria 620
433 Ga0207654_11282614 3300025911 Unclassified 534
434 Ga0207707_10062209 3300025912 Bacteria 3248
435 Ga0207695_10786075 3300025913 Bacteria 832
436 Ga0207671_10281857 3300025914 Bacteria 1311
437 Ga0207693_11383701 3300025915 Bacteria 523
438 Ga0207660_10091640 3300025917 Bacteria 2255
439 Ga0207660_10097925 3300025917 Bacteria 2187
440 Ga0207660_11038822 3300025917 Bacteria 668
441 Ga0207662_10360495 3300025918 Unclassified 978
442 Ga0207662_10555912 3300025918 Bacteria 795
443 Ga0207657_10335312 3300025919 Bacteria 1194
444 Ga0207652_10357876 3300025921 Bacteria 1317
445 Ga0207646_10118884 3300025922 Bacteria 2374
446 Ga0207646_10125109 3300025922 Unclassified 2311
447 Ga0207646_10182807 3300025922 Unclassified 1894
448 Ga0207646_10574847 3300025922 Bacteria 1012
449 Ga0207646_11424154 3300025922 Bacteria 602
450 Ga0207681_10177557 3300025923 Bacteria 1619
451 Ga0207681_10539618 3300025923 Bacteria 959
452 Ga0207681_11156740 3300025923 Bacteria 650
453 Ga0207694_10016329 3300025924 Bacteria 5605
454 Ga0207694_10816230 3300025924 Unclassified 788
455 Ga0207650_10028689 3300025925 Bacteria 3993
456 Ga0207650_11100229 3300025925 Unclassified 676
457 Ga0207659_10007776 3300025926 Bacteria 6621
458 Ga0207659_10901255 3300025926 Unclassified 760
459 Ga0207687_11140840 3300025927 Bacteria 670
460 Ga0207690_10683911 3300025932 Bacteria 843
461 Ga0207690_10918473 3300025932 Unclassified 726
462 Ga0207706_10111982 3300025933 Bacteria 2401
463 Ga0207706_10119851 3300025933 Bacteria 2313
464 Ga0207686_10207187 3300025934 Bacteria 1408
465 Ga0207686_11001627 3300025934 Unclassified 678
466 Ga0207709_10145612 3300025935 Bacteria 1634
467 Ga0207709_10181629 3300025935 Bacteria 1486
468 Ga0207709_10262310 3300025935 Bacteria 1267
469 Ga0207709_10567504 3300025935 Bacteria 894
470 Ga0207670_10834876 3300025936 Bacteria 769
471 Ga0207670_11604837 3300025936 Unclassified 553
472 Ga0207669_11096016 3300025937 Unclassified 672
473 Ga0207704_10963391 3300025938 Bacteria 720
474 Ga0207665_10000027 3300025939 Bacteria 96926
475 Ga0207665_10150106 3300025939 Bacteria 1669
476 Ga0207665_10236497 3300025939 Bacteria 1344
477 Ga0207665_11542031 3300025939 Unclassified 527
478 Ga0207691_10416952 3300025940 Bacteria 1144
479 Ga0207691_11123632 3300025940 Bacteria 653
480 Ga0207691_11198528 3300025940 Unclassified 630
481 Ga0207711_10070567 3300025941 Bacteria 3030
482 Ga0207711_10175042 3300025941 Bacteria 1949
483 Ga0207711_10798499 3300025941 Bacteria 879
484 Ga0207711_11389723 3300025941 Bacteria 644
485 Ga0207689_10042341 3300025942 Bacteria 3767
486 Ga0207689_10929882 3300025942 Unclassified 734
487 Ga0207689_11048625 3300025942 Unclassified 688
488 Ga0207689_11448394 3300025942 Unclassified 575
489 Ga0207679_11419918 3300025945 Unclassified 637
490 Ga0207667_10954120 3300025949 Bacteria 847
491 Ga0207667_11578928 3300025949 Unclassified 625
492 Ga0207651_10218131 3300025960 Bacteria 1540
493 Ga0207651_10326010 3300025960 Bacteria 1285
494 Ga0207651_10539783 3300025960 Bacteria 1013
495 Ga0207651_10573445 3300025960 Bacteria 984
496 Ga0207712_10004949 3300025961 Bacteria 8421
497 Ga0207712_10874675 3300025961 Unclassified 793
498 Ga0207712_11760733 3300025961 Unclassified 555
499 Ga0207640_10174049 3300025981 Bacteria 1607
500 Ga0207640_10269994 3300025981 Unclassified 1330
501 Ga0207640_10444673 3300025981 Bacteria 1067
502 Ga0207640_10486585 3300025981 Bacteria 1025
503 Ga0207677_11193918 3300026023 Bacteria 696
504 Ga0207677_12086353 3300026023 Bacteria 527
505 Ga0207703_10309133 3300026035 Bacteria 1444
506 Ga0207703_10320190 3300026035 Bacteria 1420
507 Ga0207703_11684350 3300026035 Unclassified 610
508 Ga0207639_10589608 3300026041 Bacteria 1024
509 Ga0207639_11146220 3300026041 Unclassified 729
510 Ga0207639_11531307 3300026041 Unclassified 626
511 Ga0207708_10032428 3300026075 Bacteria 3967
512 Ga0207708_10070807 3300026075 Bacteria 2670
513 Ga0207708_10073240 3300026075 Bacteria 2625
514 Ga0207708_10074864 3300026075 Bacteria 2595
515 Ga0207708_10100425 3300026075 Bacteria 2239
516 Ga0207641_10083393 3300026088 Bacteria 2780
517 Ga0207641_10257386 3300026088 Bacteria 1633
518 Ga0207641_10599224 3300026088 Bacteria 1078
519 Ga0207641_10769283 3300026088 Unclassified 951
520 Ga0207641_11344983 3300026088 Bacteria 715
521 Ga0207641_12536084 3300026088 Unclassified 511
522 Ga0207648_10013172 3300026089 Bacteria 7708
523 Ga0207648_10165174 3300026089 Bacteria 1956
524 Ga0207648_10260150 3300026089 Unclassified 1548
525 Ga0207676_10058504 3300026095 Bacteria 3041
526 Ga0207676_10406935 3300026095 Bacteria 1273
527 Ga0207676_10554227 3300026095 Unclassified 1098
528 Ga0207676_10835913 3300026095 Unclassified 900
529 Ga0207674_11250069 3300026116 Bacteria 712
530 Ga0207674_11405503 3300026116 Bacteria 667
531 Ga0207675_100018226 3300026118 Bacteria 6545
532 Ga0207675_100020909 3300026118 Bacteria 6101
533 Ga0207675_100021724 3300026118 Bacteria 5972
534 Ga0207675_100240448 3300026118 Bacteria 1749
535 Ga0207675_101361702 3300026118 Bacteria 730
536 Ga0207683_10163119 3300026121 Bacteria 2016
537 Ga0207683_10651487 3300026121 Bacteria 976
538 Ga0207698_10042550 3300026142 Bacteria 3395
539 Ga0207698_10228074 3300026142 Unclassified 1689
540 Ga0207698_10358026 3300026142 Bacteria 1381
541 Ga0207428_10047689 3300027907 Bacteria 3439
542 Ga0207428_10213705 3300027907 Bacteria 1448
543 Ga0207428_10214186 3300027907 Bacteria 1446
544 Ga0207428_10296683 3300027907 Bacteria 1197
545 Ga0268265_10121144 3300028380 Bacteria 2155
546 Ga0268265_10202221 3300028380 Unclassified 1724
547 Ga0268265_11555613 3300028380 Unclassified 666
548 Ga0268265_11577044 3300028380 Bacteria 661
549 Ga0268265_12454400 3300028380 Unclassified 527
550 Ga0268264_10095773 3300028381 Bacteria 2569
551 Ga0268264_10541893 3300028381 Unclassified 1140
552 Ga0268264_10976673 3300028381 Unclassified 853
553 Ga0268264_11180401 3300028381 Unclassified 775
554 Ga0268264_11781431 3300028381 Bacteria 626
555 Ga0307408_101913940 3300031548 Unclassified 569
556 Ga0307408_102232441 3300031548 Unclassified 529
557 Ga0307405_10069266 3300031731 Bacteria 2261
558 Ga0316577_10566204 3300031733 Bacteria 646
559 Ga0307406_11386737 3300031901 Bacteria 616
560 Ga0307409_101844220 3300031995 Unclassified 634
561 Ga0307411_10247230 3300032005 Bacteria 1400
562 Ga0316580_10088811 3300032139 Bacteria 946
563 Ga0316580_10212763 3300032139 Unclassified 596
564 Ga0373950_0040238 3300034818 Unclassified 893
565 Ga0373938_0179662 3300034957 Unclassified 577
566 Ga0373929_0139750 3300035085 Unclassified 642
567 Ga0373941_0016682 3300035115 Bacteria 2001
568 Ga0373942_0031051 3300035207 Bacteria 1410
569 Ga0373942_0171742 3300035207 Unclassified 706
570 Ga0373962_0142907 3300035242 Unclassified 779
571 Ga0373937_0120758 3300036401 Bacteria 2442
572 Ga0316584_0257294 3300036712 Bacteria 1274
573 Ga0316584_0438854 3300036712 Unclassified 925
574 Ga0395900_0096483 3300037418 Bacteria 3038
575 Ga0395905_0521357 3300037471 Bacteria 1089
576 Ga0242420_006388 3300038996 Bacteria 1861
577 Ga0439453_0118018 3300041408 Bacteria 606
578 Ga0439462_0029334 3300042015 Bacteria 1455
579 Ga0439435_0038456 3300042436 Bacteria 1330
580 Ga0439459_0201919 3300042438 Unclassified 543
581 Ga0439464_0018013 3300042439 Bacteria 1920
582 Ga0451577_0253363 3300042876 Bacteria 1593
583 Ga0451577_0292434 3300042876 Bacteria 1476
584 Ga0451577_0411504 3300042876 Unclassified 1228
585 Ga0451577_1315952 3300042876 Bacteria 642
586 Ga0451577_1711051 3300042876 Unclassified 553
587 Ga0453683_0219145 3300044673 Bacteria 1210
588 Ga0453683_0415709 3300044673 Bacteria 868
589 Ga0453684_0138565 3300044712 Bacteria 2909
590 Ga0453684_0153737 3300044712 Unclassified 2731
591 Ga0453684_0845718 3300044712 Bacteria 984
592 Ga0451576_0489938 3300045051 Unclassified 1291
593 Ga0495642_0452997 3300046528 Unclassified 567
594 Ga0495598_0091398 3300046537 Unclassified 993
595 Ga0495598_0093293 3300046537 Unclassified 985
596 Ga0495656_0806459 3300046615 Bacteria 507
597 Ga0495659_0021572 3300046664 Bacteria 2172
598 Ga0495588_0737605 3300046674 Bacteria 515
599 Ga0495658_0055556 3300046683 Bacteria 2256
600 Ga0495669_0318757 3300046684 Unclassified 750
601 Ga0495636_0268142 3300047318 Unclassified 793
602 Ga0495636_0499790 3300047318 Bacteria 588
603 Ga0496100_1243793 3300048903 Unclassified 587
604 Ga0496102_0312060 3300048905 Bacteria 1482
605 Ga0496102_0921702 3300048905 Unclassified 795
606 Ga0496102_1809219 3300048905 Unclassified 528
607 Ga0496104_0236235 3300048907 Bacteria 1740
608 Ga0496104_1444340 3300048907 Unclassified 591
609 Ga0496109_0647793 3300048912 Unclassified 993
610 Ga0496112_0179879 3300048915 Bacteria 2079
611 Ga0496112_0219977 3300048915 Bacteria 1855
612 Ga0496112_0283087 3300048915 Bacteria 1605
613 Ga0496112_1317414 3300048915 Bacteria 638
614 Ga0496113_0340294 3300048916 Unclassified 1203
615 Ga0496113_0426009 3300048916 Unclassified 1066
616 Ga0501067_0762209 3300049583 Bacteria 545
617 Ga0501072_0911556 3300049588 Bacteria 686
618 Ga0501075_1086888 3300049591 Bacteria 607
619 Ga0501076_0485604 3300049592 Unclassified 1018
620 Ga0501261_082944 3300049690 Unclassified 583
621 Ga0501080_0532346 3300049742 Unclassified 1048
622 nmdc:mga05p37_11722_c1 3300050507 Bacteria 10450
623 nmdc:mga05p37_1244937_c1 3300050507 Bacteria 764
624 nmdc:mga05p37_1247257_c1 3300050507 Bacteria 763
625 nmdc:mga05p37_160062_c2 3300050507 Bacteria 1273
626 nmdc:mga05p37_38076_c1 3300050507 Bacteria 5898
627 nmdc:mga05p37_399790_c1 3300050507 Unclassified 1604
628 nmdc:mga05p37_612338_c2 3300050507 Bacteria 800
629 nmdc:mga05p37_637424_c1 3300050507 Bacteria 1196
630 nmdc:mga05p37_66922_c1 3300050507 Bacteria 4420
631 nmdc:mga05p37_73731_c1 3300050507 Unclassified 2023
632 nmdc:mga05p37_810868_c1 3300050507 Bacteria 1022
633 nmdc:mga05p37_982557_c1 3300050507 Bacteria 899
634 nmdc:mga09592_281261_c1 3300050508 Bacteria 1443
635 nmdc:mga09592_28277_c1 3300050508 Unclassified 4657
636 nmdc:mga09592_598591_c1 3300050508 Unclassified 945
637 nmdc:mga0qj67_51729_c1 3300050509 Bacteria 3249
638 nmdc:mga06r32_1249498_c1 3300050510 Bacteria 688
639 nmdc:mga06r32_1448088_c1 3300050510 Unclassified 628
640 nmdc:mga06r32_34221_c1 3300050510 Unclassified 4791
641 nmdc:mga08y16_1721017_c1 3300050511 Bacteria 582
642 nmdc:mga08y16_191778_c1 3300050511 Bacteria 2120
643 nmdc:mga08y16_374219_c1 3300050511 Bacteria 1461
644 nmdc:mga08y16_588348_c1 3300050511 Bacteria 1123
645 nmdc:mga08y16_82959_c1 3300050511 Bacteria 3341
646 nmdc:mga0n895_1185560_c1 3300050512 Unclassified 738
647 nmdc:mga0n895_1616239_c1 3300050512 Unclassified 612
648 nmdc:mga0n895_238672_c1 3300050512 Bacteria 1845
649 nmdc:mga0n895_339749_c1 3300050512 Bacteria 1521
650 nmdc:mga0n895_34985_c1 3300050512 Bacteria 4839
651 nmdc:mga0n895_52_c1 3300050512 Bacteria 69311
652 nmdc:mga0n895_59931_c1 3300050512 Bacteria 3755
653 nmdc:mga0n895_685949_c1 3300050512 Bacteria 1021
654 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
655 nmdc:mga0rr50_224363_c1 3300050513 Unclassified 1553
656 nmdc:mga0rr50_3201_c1 3300050513 Bacteria 9368
657 nmdc:mga0rr50_352055_c1 3300050513 Unclassified 1239
658 nmdc:mga0rr50_380263_c1 3300050513 Bacteria 1190
659 nmdc:mga08x19_335721_c1 3300050514 Unclassified 1054
660 nmdc:mga08x19_35415_c1 3300050514 Bacteria 3158
661 nmdc:mga08x19_43287_c1 3300050514 Bacteria 2872
662 nmdc:mga08x19_609_c1 3300050514 Bacteria 23121
663 nmdc:mga08x19_67783_c1 3300050514 Bacteria 2322
664 nmdc:mga08x19_751295_c1 3300050514 Unclassified 692
665 nmdc:mga08x19_792624_c1 3300050514 Unclassified 673
666 nmdc:mga0a205_123864_c1 3300050515 Bacteria 2485
667 nmdc:mga0a205_17793_c1 3300050515 Bacteria 6669
668 nmdc:mga0a205_18048_c1 3300050515 Bacteria 6628
669 nmdc:mga0a205_220727_c1 3300050515 Bacteria 1781
670 nmdc:mga0a205_225072_c1 3300050515 Unclassified 1761
671 nmdc:mga0a205_281880_c1 3300050515 Bacteria 1537
672 nmdc:mga0a205_31567_c1 3300050515 Bacteria 5075
673 nmdc:mga0a205_340635_c1 3300050515 Bacteria 1368
674 nmdc:mga0a205_736833_c1 3300050515 Bacteria 835
675 nmdc:mga0a205_762361_c1 3300050515 Unclassified 816
676 nmdc:mga0a205_902747_c1 3300050515 Unclassified 730
677 nmdc:mga0a205_996211_c1 3300050515 Bacteria 685
678 Ga0501084_0874877 3300054114 Bacteria 756
679 Ga0590071_000131 3300059421 Bacteria 20987
680 Ga0590074_001836 3300059423 Bacteria 3469
681 Ga0590075_000277 3300059424 Bacteria 14510
682 Ga0590075_017194 3300059424 Unclassified 1782
683 Ga0590077_000835 3300059426 Bacteria 7968
684 Ga0590077_014718 3300059426 Unclassified 1631
685 Ga0587077_049070 3300059493 Bacteria 877
686 Ga0587091_209913 3300059511 Bacteria 527
687 Ga0587067_083026 3300059640 Bacteria 713
688 Ga0587111_0083471 3300060346 Bacteria 768
689 Ga0530510_1230013 3300061734 Bacteria 574
690 Ga0070701_10250163
691 CNAas_1001213
692 rootL2_10321848
693 Ga0058863_10003188
694 Ga0058863_11030591
695 Ga0058861_10087753
696 Ga0058862_10059034
697 Ga0065714_10064448
698 Ga0065714_10432047
699 Ga0065704_10107877
700 Ga0065704_10627652
701 Ga0065704_10630925
702 Ga0065712_10018227
703 Ga0065712_10647557
704 Ga0065712_10746057
705 Ga0065715_10719438
706 Ga0065715_10757465
707 Ga0065707_10208407
708 Ga0065707_10216915
709 Ga0065707_10382260
710 Ga0065707_10966224
711 Ga0070676_10013005
712 Ga0070676_10091762
713 Ga0070676_10461510
714 Ga0070676_10801370
715 Ga0070676_10923349
716 Ga0070690_100197490
717 Ga0070690_100540635
718 Ga0070670_100017411
719 Ga0070670_100077412
720 Ga0070670_100645040
721 Ga0070670_101223325
722 Ga0070670_101241444
723 Ga0068869_100277966
724 Ga0068869_100447549
725 Ga0070666_10709647
726 Ga0070680_100019628
727 Ga0070680_100379093
728 Ga0070680_101696071
729 Ga0070682_100019082
730 Ga0068868_100414799
731 Ga0068868_101730410
732 Ga0070660_100076155
733 Ga0070689_100039138
734 Ga0070689_100097188
735 Ga0070689_100779848
736 Ga0070689_101970411
737 Ga0070687_100292511
738 Ga0070687_101003993
739 Ga0070692_10029023
740 Ga0070692_10055700
741 Ga0070668_100568249
742 Ga0070669_100005699
743 Ga0070669_100038321
744 Ga0070669_100072206
745 Ga0070669_101242360
746 Ga0070675_100023125
747 Ga0070675_100436987
748 Ga0070675_101080226
749 Ga0070674_101082914
750 Ga0070673_100259315
751 Ga0070673_100282515
752 Ga0070673_101463635
753 Ga0070673_101704755
754 Ga0070688_100826589
755 Ga0070659_100099443
756 Ga0070703_10018325
757 Ga0070714_101869537
758 Ga0070713_100283616
759 Ga0070701_10221584
760 Ga0070701_10681787
761 Ga0070701_11140466
762 Ga0070711_100262692
763 Ga0070705_100071334
764 Ga0070705_100077709
765 Ga0070705_100216168
766 Ga0070705_100248907
767 Ga0070705_100661647
768 Ga0070705_100932011
769 Ga0070705_101154768
770 Ga0070700_100008158
771 Ga0070700_100073070
772 Ga0070700_100085754
773 Ga0070700_100089378
774 Ga0070700_100095771
775 Ga0070700_100145168
776 Ga0070700_101940107
777 Ga0070694_100002639
778 Ga0070694_100008768
779 Ga0070694_100027942
780 Ga0070694_100040673
781 Ga0070694_100159955
782 Ga0070694_100235885
783 Ga0070694_100394891
784 Ga0070694_100866606
785 Ga0070694_101354831
786 Ga0070694_101608911
787 Ga0070708_100252613
788 Ga0070708_100511423
789 Ga0070708_100714838
790 Ga0070678_100091271
791 Ga0070678_101154680
792 Ga0070662_100312259
793 Ga0070662_101128059
794 Ga0070681_10011223
795 Ga0068867_100444759
796 Ga0068867_100594520
797 Ga0068867_100755750
798 Ga0068867_101597095
799 Ga0068867_101731577
800 Ga0070685_11629004
801 Ga0070706_100068510
802 Ga0070706_100239677
803 Ga0070706_100529373
804 Ga0070706_100652638
805 Ga0070706_100807583
806 Ga0070707_100061855
807 Ga0070707_100073300
808 Ga0070707_100124125
809 Ga0070707_100761131
810 Ga0070707_100778928
811 Ga0070707_101858659
812 Ga0070698_100000512
813 Ga0070698_100063333
814 Ga0070698_100152257
815 Ga0070698_100167000
816 Ga0070698_100494070
817 Ga0070698_101563725
818 Ga0070698_102177529
819 Ga0070699_100037227
820 Ga0070699_100110234
821 Ga0070699_100289145
822 Ga0070699_100323208
823 Ga0070699_100656035
824 Ga0070679_100338570
825 Ga0070684_102128664
826 Ga0070697_100121997
827 Ga0070697_100301448
828 Ga0070697_100337564
829 Ga0070697_100626947
830 Ga0070697_100933891
831 Ga0070697_101367232
832 Ga0070697_101402935
833 Ga0070672_100294256
834 Ga0070672_101394611
835 Ga0070672_101464545
836 Ga0070686_100272456
837 Ga0070686_100810383
838 Ga0070695_100005066
839 Ga0070695_101331362
840 Ga0070696_100024375
841 Ga0070696_100048377
842 Ga0070696_100430217
843 Ga0070696_101440564
844 Ga0070696_102021400
845 Ga0070693_100016028
846 Ga0070693_100114690
847 Ga0070693_100139075
848 Ga0070693_100511717
849 Ga0070693_100835825
850 Ga0070665_102370857
851 Ga0070704_100008986
852 Ga0070704_100015362
853 Ga0070704_100021218
854 Ga0070704_100051523
855 Ga0070704_101006915
856 Ga0070704_101407787
857 Ga0070704_101663494
858 Ga0070704_102218955
859 Ga0068855_100801784
860 Ga0068857_101406540
861 Ga0068857_102200594
862 Ga0068854_100104047
863 Ga0068854_100419557
864 Ga0068854_100600506
865 Ga0068854_101577185
866 Ga0070702_100030040
867 Ga0070702_100197481
868 Ga0070702_100427118
869 Ga0070702_100763929
870 Ga0068852_100274987
871 Ga0068852_100327747
872 Ga0068852_100377914
873 Ga0068852_101202221
874 Ga0068852_101698347
875 Ga0068859_100007346
876 Ga0068859_100052075
877 Ga0068859_100055062
878 Ga0068859_100352072
879 Ga0068859_100488834
880 Ga0068859_100591537
881 Ga0068859_100730266
882 Ga0068859_102947628
883 Ga0068864_100028528
884 Ga0068864_100427473
885 Ga0068864_100499007
886 Ga0068864_101325184
887 Ga0068864_101589830
888 Ga0068866_11254055
889 Ga0068861_100004341
890 Ga0068861_100006028
891 Ga0068861_100026521
892 Ga0068861_100184250
893 Ga0068861_100849354
894 Ga0068870_10026785
895 Ga0068870_10793882
896 Ga0068863_100160799
897 Ga0068863_100303309
898 Ga0068863_100776903
899 Ga0068863_100782114
900 Ga0068863_100949807
901 Ga0068858_100288539
902 Ga0068858_100296675
903 Ga0068858_100930573
904 Ga0068858_101549736
905 Ga0068860_100090299
906 Ga0068860_100108006
907 Ga0068860_100142384
908 Ga0068860_100278942
909 Ga0068860_100475295
910 Ga0068860_101021361
911 Ga0068860_102588661
912 Ga0068862_100015433
913 Ga0068862_100101401
914 Ga0068862_100317731
915 Ga0068862_101086623
916 Ga0068862_101636512
917 Ga0068862_102283900
918 Ga0081538_10092629
919 Ga0081539_10002993
920 Ga0081539_10005135
921 Ga0075432_10034018
922 Ga0070715_10000007
923 Ga0070716_100000007
924 Ga0070716_100246263
925 Ga0070716_101816625
926 Ga0097621_100235087
927 Ga0097621_101202087
928 Ga0097621_101211502
929 Ga0068871_100297976
930 Ga0075428_100313564
931 Ga0075428_100371407
932 Ga0075428_100616731
933 Ga0075428_100632514
934 Ga0075428_101124322
935 Ga0075428_101387690
936 Ga0075428_102536519
937 Ga0075430_100010429
938 Ga0075430_100210430
939 Ga0075430_101512848
940 Ga0075431_100022589
941 Ga0075431_100069893
942 Ga0075433_10002856
943 Ga0075433_10009542
944 Ga0075433_10015522
945 Ga0075433_10037958
946 Ga0075433_10108272
947 Ga0075433_10184593
948 Ga0075433_10245536
949 Ga0075433_10618910
950 Ga0075433_10968771
951 Ga0075433_10986905
952 Ga0075433_11097582
953 Ga0075434_100000051
954 Ga0075434_100014506
955 Ga0075434_100016452
956 Ga0075434_100021250
957 Ga0075434_100099428
958 Ga0075434_100193489
959 Ga0075434_100925087
960 Ga0075434_101899061
961 Ga0075429_100073722
962 Ga0075429_100243918
963 Ga0075429_100254190
964 Ga0075436_100001049
965 Ga0075436_100039480
966 Ga0075436_100125019
967 Ga0075436_100186085
968 Ga0075436_100417874
969 Ga0075436_100877441
970 Ga0075436_100982964
971 Ga0097620_100007346
972 Ga0097620_100052077
973 Ga0097620_100055062
974 Ga0097620_100128832
975 Ga0097620_100352068
976 Ga0097620_100488856
977 Ga0097620_100591512
978 Ga0097620_100730280
979 Ga0097620_102947781
980 Ga0075435_100000006
981 Ga0075435_100000786
982 Ga0075435_100031968
983 Ga0075435_100192733
984 Ga0075435_100317202
985 Ga0099794_10766166
986 Ga0105250_10107820
987 Ga0105240_11436657
988 Ga0105240_11548458
989 Ga0105240_12303071
990 Ga0111539_10019217
991 Ga0111539_10294404
992 Ga0111539_10340900
993 Ga0111539_10394722
994 Ga0111539_10875068
995 Ga0111539_11554515
996 Ga0105245_10593842
997 Ga0105245_10599976
998 Ga0105245_11559974
999 Ga0105245_11838159
1000 Ga0105247_10421980
1001 Ga0105247_10937350
1002 Ga0114129_10004434
1003 Ga0114129_10015365
1004 Ga0114129_10017772
1005 Ga0114129_10028789
1006 Ga0114129_10079602
1007 Ga0114129_10401447
1008 Ga0114129_10445863
1009 Ga0114129_10584032
1010 Ga0114129_10597917
1011 Ga0114129_10759090
1012 Ga0114129_11239402
1013 Ga0114129_11273512
1014 Ga0114129_12179605
1015 Ga0114129_12822032
1016 Ga0105243_10231072
1017 Ga0105243_10236284
1018 Ga0105243_10366905
1019 Ga0105243_10853419
1020 Ga0105243_10969766
1021 Ga0105241_10147694
1022 Ga0105241_10279134
1023 Ga0105241_10304663
1024 Ga0105241_10322396
1025 Ga0105241_10392761
1026 Ga0105242_10112459
1027 Ga0105242_10697849
1028 Ga0105242_11604401
1029 Ga0105242_12142224
1030 Ga0105248_10046898
1031 Ga0105248_10493629
1032 Ga0105248_11040624
1033 Ga0105248_11453792
1034 Ga0105248_11745379
1035 Ga0105237_10384547
1036 Ga0105238_10107996
1037 Ga0105238_10874630
1038 Ga0105238_11558496
1039 Ga0105238_12324061
1040 Ga0105249_10068712
1041 Ga0105249_10270273
1042 Ga0105249_10372295
1043 Ga0105249_10448600
1044 Ga0105249_10628983
1045 Ga0099796_10442327
1046 Ga0105239_10012393
1047 Ga0105239_11616993
1048 Ga0105246_10625098
1049 Ga0105246_11172749
1050 Ga0157373_10014383
1051 Ga0157373_10773662
1052 Ga0157371_10264330
1053 Ga0157371_10767091
1054 Ga0157371_11512697
1055 Ga0157374_11164180
1056 Ga0157374_12037175
1057 Ga0157378_10067466
1058 Ga0157378_10195641
1059 Ga0157378_10389404
1060 Ga0157378_10499404
1061 Ga0157378_10752960
1062 Ga0157378_13059888
1063 Ga0163162_10051878
1064 Ga0163162_10107384
1065 Ga0163162_10126179
1066 Ga0163162_11188511
1067 Ga0163162_11302984
1068 Ga0163162_11933624
1069 Ga0163162_13188191
1070 Ga0157372_10085250
1071 Ga0157372_12207994
1072 Ga0157375_10040923
1073 Ga0157375_10830733
1074 Ga0157375_11102887
1075 Ga0157375_11416552
1076 Ga0163163_10010566
1077 Ga0163163_10015016
1078 Ga0163163_11324782
1079 Ga0163163_12343113
1080 Ga0157380_10018165
1081 Ga0157380_10082799
1082 Ga0157380_10601209
1083 Ga0157380_11962817
1084 Ga0157380_13036029
1085 Ga0157380_13244752
1086 Ga0157380_13448627
1087 Ga0157377_10095159
1088 Ga0157377_10119305
1089 Ga0157377_10454664
1090 Ga0157379_10290017
1091 Ga0157379_11568252
1092 Ga0157379_11903512
1093 Ga0157376_10356182
1094 Ga0163161_10059003
1095 Ga0163161_10520725
1096 Ga0163161_11631698
1097 Ga0206356_10795272
1098 Ga0224712_10088254
1099 Ga0207697_10243444
1100 Ga0207696_1212458
1101 Ga0207653_10018301
1102 Ga0207653_10104352
1103 Ga0207642_10728195
1104 Ga0207710_10422088
1105 Ga0207688_10116907
1106 Ga0207680_10691343
1107 Ga0207647_10519844
1108 Ga0207685_10000007
1109 Ga0207699_10616239
1110 Ga0207645_10023283
1111 Ga0207645_10063619
1112 Ga0207645_10280490
1113 Ga0207645_10557272
1114 Ga0207643_10112346
1115 Ga0207684_10097969
1116 Ga0207684_10234963
1117 Ga0207684_10587071
1118 Ga0207684_11425878
1119 Ga0207654_10111100
1120 Ga0207654_10559734
1121 Ga0207654_10961973
1122 Ga0207654_11282614
1123 Ga0207707_10062209
1124 Ga0207695_10786075
1125 Ga0207671_10281857
1126 Ga0207693_11383701
1127 Ga0207660_10091640
1128 Ga0207660_10097925
1129 Ga0207660_11038822
1130 Ga0207662_10360495
1131 Ga0207662_10555912
1132 Ga0207657_10335312
1133 Ga0207652_10357876
1134 Ga0207646_10118884
1135 Ga0207646_10125109
1136 Ga0207646_10182807
1137 Ga0207646_10574847
1138 Ga0207646_11424154
1139 Ga0207681_10177557
1140 Ga0207681_10539618
1141 Ga0207681_11156740
1142 Ga0207694_10016329
1143 Ga0207694_10816230
1144 Ga0207650_10028689
1145 Ga0207650_11100229
1146 Ga0207659_10007776
1147 Ga0207659_10901255
1148 Ga0207687_11140840
1149 Ga0207690_10683911
1150 Ga0207690_10918473
1151 Ga0207706_10111982
1152 Ga0207706_10119851
1153 Ga0207686_10207187
1154 Ga0207686_11001627
1155 Ga0207709_10145612
1156 Ga0207709_10181629
1157 Ga0207709_10262310
1158 Ga0207709_10567504
1159 Ga0207670_10834876
1160 Ga0207670_11604837
1161 Ga0207669_11096016
1162 Ga0207704_10963391
1163 Ga0207665_10000027
1164 Ga0207665_10150106
1165 Ga0207665_10236497
1166 Ga0207665_11542031
1167 Ga0207691_10416952
1168 Ga0207691_11123632
1169 Ga0207691_11198528
1170 Ga0207711_10070567
1171 Ga0207711_10175042
1172 Ga0207711_10798499
1173 Ga0207711_11389723
1174 Ga0207689_10042341
1175 Ga0207689_10929882
1176 Ga0207689_11048625
1177 Ga0207689_11448394
1178 Ga0207679_11419918
1179 Ga0207667_10954120
1180 Ga0207667_11578928
1181 Ga0207651_10218131
1182 Ga0207651_10326010
1183 Ga0207651_10539783
1184 Ga0207651_10573445
1185 Ga0207712_10004949
1186 Ga0207712_10874675
1187 Ga0207712_11760733
1188 Ga0207640_10174049
1189 Ga0207640_10269994
1190 Ga0207640_10444673
1191 Ga0207640_10486585
1192 Ga0207677_11193918
1193 Ga0207677_12086353
1194 Ga0207703_10309133
1195 Ga0207703_10320190
1196 Ga0207703_11684350
1197 Ga0207639_10589608
1198 Ga0207639_11146220
1199 Ga0207639_11531307
1200 Ga0207708_10032428
1201 Ga0207708_10070807
1202 Ga0207708_10073240
1203 Ga0207708_10074864
1204 Ga0207708_10100425
1205 Ga0207641_10083393
1206 Ga0207641_10257386
1207 Ga0207641_10599224
1208 Ga0207641_10769283
1209 Ga0207641_11344983
1210 Ga0207641_12536084
1211 Ga0207648_10013172
1212 Ga0207648_10165174
1213 Ga0207648_10260150
1214 Ga0207676_10058504
1215 Ga0207676_10406935
1216 Ga0207676_10554227
1217 Ga0207676_10835913
1218 Ga0207674_11250069
1219 Ga0207674_11405503
1220 Ga0207675_100018226
1221 Ga0207675_100020909
1222 Ga0207675_100021724
1223 Ga0207675_100240448
1224 Ga0207675_101361702
1225 Ga0207683_10163119
1226 Ga0207683_10651487
1227 Ga0207698_10042550
1228 Ga0207698_10228074
1229 Ga0207698_10358026
1230 Ga0207428_10047689
1231 Ga0207428_10213705
1232 Ga0207428_10214186
1233 Ga0207428_10296683
1234 Ga0268265_10121144
1235 Ga0268265_10202221
1236 Ga0268265_11555613
1237 Ga0268265_11577044
1238 Ga0268265_12454400
1239 Ga0268264_10095773
1240 Ga0268264_10541893
1241 Ga0268264_10976673
1242 Ga0268264_11180401
1243 Ga0268264_11781431
1244 Ga0307408_101913940
1245 Ga0307408_102232441
1246 Ga0307405_10069266
1247 Ga0316577_10566204
1248 Ga0307406_11386737
1249 Ga0307409_101844220
1250 Ga0307411_10247230
1251 Ga0316580_10088811
1252 Ga0316580_10212763
1253 Ga0373950_0040238
1254 Ga0373938_0179662
1255 Ga0373929_0139750
1256 Ga0373941_0016682
1257 Ga0373942_0031051
1258 Ga0373942_0171742
1259 Ga0373962_0142907
1260 Ga0373937_0120758
1261 Ga0316584_0257294
1262 Ga0316584_0438854
1263 Ga0395900_0096483
1264 Ga0395905_0521357
1265 Ga0242420_006388
1266 Ga0439453_0118018
1267 Ga0439462_0029334
1268 Ga0439435_0038456
1269 Ga0439459_0201919
1270 Ga0439464_0018013
1271 Ga0451577_0253363
1272 Ga0451577_0292434
1273 Ga0451577_0411504
1274 Ga0451577_1315952
1275 Ga0451577_1711051
1276 Ga0453683_0219145
1277 Ga0453683_0415709
1278 Ga0453684_0138565
1279 Ga0453684_0153737
1280 Ga0453684_0845718
1281 Ga0451576_0489938
1282 Ga0495642_0452997
1283 Ga0495598_0091398
1284 Ga0495598_0093293
1285 Ga0495656_0806459
1286 Ga0495659_0021572
1287 Ga0495588_0737605
1288 Ga0495658_0055556
1289 Ga0495669_0318757
1290 Ga0495636_0268142
1291 Ga0495636_0499790
1292 Ga0496100_1243793
1293 Ga0496102_0312060
1294 Ga0496102_0921702
1295 Ga0496102_1809219
1296 Ga0496104_0236235
1297 Ga0496104_1444340
1298 Ga0496109_0647793
1299 Ga0496112_0179879
1300 Ga0496112_0219977
1301 Ga0496112_0283087
1302 Ga0496112_1317414
1303 Ga0496113_0340294
1304 Ga0496113_0426009
1305 Ga0501067_0762209
1306 Ga0501072_0911556
1307 Ga0501075_1086888
1308 Ga0501076_0485604
1309 Ga0501261_082944
1310 Ga0501080_0532346
1311 nmdc:mga05p37_11722_c1
1312 nmdc:mga05p37_1244937_c1
1313 nmdc:mga05p37_1247257_c1
1314 nmdc:mga05p37_160062_c2
1315 nmdc:mga05p37_38076_c1
1316 nmdc:mga05p37_399790_c1
1317 nmdc:mga05p37_612338_c2
1318 nmdc:mga05p37_637424_c1
1319 nmdc:mga05p37_66922_c1
1320 nmdc:mga05p37_73731_c1
1321 nmdc:mga05p37_810868_c1
1322 nmdc:mga05p37_982557_c1
1323 nmdc:mga09592_281261_c1
1324 nmdc:mga09592_28277_c1
1325 nmdc:mga09592_598591_c1
1326 nmdc:mga0qj67_51729_c1
1327 nmdc:mga06r32_1249498_c1
1328 nmdc:mga06r32_1448088_c1
1329 nmdc:mga06r32_34221_c1
1330 nmdc:mga08y16_1721017_c1
1331 nmdc:mga08y16_191778_c1
1332 nmdc:mga08y16_374219_c1
1333 nmdc:mga08y16_588348_c1
1334 nmdc:mga08y16_82959_c1
1335 nmdc:mga0n895_1185560_c1
1336 nmdc:mga0n895_1616239_c1
1337 nmdc:mga0n895_238672_c1
1338 nmdc:mga0n895_339749_c1
1339 nmdc:mga0n895_34985_c1
1340 nmdc:mga0n895_52_c1
1341 nmdc:mga0n895_59931_c1
1342 nmdc:mga0n895_685949_c1
1343 nmdc:mga0rr50_15_c1
1344 nmdc:mga0rr50_224363_c1
1345 nmdc:mga0rr50_3201_c1
1346 nmdc:mga0rr50_352055_c1
1347 nmdc:mga0rr50_380263_c1
1348 nmdc:mga08x19_335721_c1
1349 nmdc:mga08x19_35415_c1
1350 nmdc:mga08x19_43287_c1
1351 nmdc:mga08x19_609_c1
1352 nmdc:mga08x19_67783_c1
1353 nmdc:mga08x19_751295_c1
1354 nmdc:mga08x19_792624_c1
1355 nmdc:mga0a205_123864_c1
1356 nmdc:mga0a205_17793_c1
1357 nmdc:mga0a205_18048_c1
1358 nmdc:mga0a205_220727_c1
1359 nmdc:mga0a205_225072_c1
1360 nmdc:mga0a205_281880_c1
1361 nmdc:mga0a205_31567_c1
1362 nmdc:mga0a205_340635_c1
1363 nmdc:mga0a205_736833_c1
1364 nmdc:mga0a205_762361_c1
1365 nmdc:mga0a205_902747_c1
1366 nmdc:mga0a205_996211_c1
1367 Ga0501084_0874877
1368 Ga0590071_000131
1369 Ga0590074_001836
1370 Ga0590075_000277
1371 Ga0590075_017194
1372 Ga0590077_000835
1373 Ga0590077_014718
1374 Ga0587077_049070
1375 Ga0587091_209913
1376 Ga0587067_083026
1377 Ga0587111_0083471
1378 Ga0530510_1230013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qoj-assembly1.cif.gz_B-2 crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction. 0.9079 60 105
1qoj-assembly1.cif.gz_B-2 crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction. 0.8737 60 105
2a8v-assembly2.cif.gz_B rho transcription termination factor/rna complex 0.8638 4 49
3v1b-assembly1.cif.gz_B crystal structure of de novo designed mid1-apo2 0.8242 60 105
3v1b-assembly1.cif.gz_B crystal structure of de novo designed mid1-apo2 0.7345 60 105
ID Description Score Start End Superfamily
3v1eA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9567 65 104 4.10.860.20
2rklD00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9429 61 100 1.20.5.420
1yzmA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9241 63 107 4.10.860.20
2yxyA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Hypothetical protein YfhH domain 0.914 57 99 1.10.287.880
1yzmA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.8881 63 107 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A7S3KYZ9-F1-model_v4 Uncharacterized protein 0.7666 2 52
AF-A0A2V8CBM1-F1-model_v4 Uncharacterized protein 0.6835 25 107
AF-A0A1G9SXD2-F1-model_v4 Protein-arginine kinase activator protein McsA 0.6556 38 104 GO:0005507
GO:0008270
GO:0016301
GO:0046870
GO:0050897
GO:1990169
GO:1990170
AF-A0A6N8BLB4-F1-model_v4 UVR domain-containing protein 0.6549 38 104 GO:0005507
GO:0008270
GO:0046870
GO:0050897
GO:1990169
GO:1990170
AF-A0A2V8CBM1-F1-model_v4 Uncharacterized protein 0.6538 25 107

Map