F475336

General Info

Members Datasets Scaffolds Average Seq Length
688 604 282 217

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10024415|Ga0307513_100244154
Length 247
Sequence MFDNLPEFISTILDGLGLTLAATLGGIAISAVLSFVFGLAMLSGSRIVRVVARIYVEIWRGTSEVVQLFWIFFVLPVLVGYQIVPLMAGIVVLGLNFGAYGAEIVRGAIQAVPRAQYEGAIALSLTPAQRMRRVILPQALVEMVPPFNNLFIQLLKGSALLTMITVPEMTNQARNVLMDLYTGQAGLIWTVLLVFYLLLSVLITFGMKFLERRAARIVGRGPSQAARDRGLAIAVEAGAGRGGGFPT

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
19 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
25 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
26 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
27 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
28 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
29 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
30 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
31 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
32 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
33 2516143018 Ensifer sp. BR816 Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
37 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
38 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
39 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
40 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
41 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
42 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
43 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
44 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
45 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
46 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
47 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
48 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
49 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
50 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
51 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
52 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
53 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
54 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
55 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
56 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
57 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
58 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
59 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
60 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
61 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
62 2643221557 Ensifer sp. Root558 Isolate Unclassified
63 2643221594 Achromobacter sp. Root170 Isolate Unclassified
64 2643221607 Rhizobium sp. Root73 Isolate Unclassified
65 2643221610 Ensifer sp. Root74 Isolate Unclassified
66 2643221618 Ensifer sp. Root231 Isolate Unclassified
67 2643221626 Ensifer sp. Root31 Isolate Unclassified
68 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
69 2643221655 Ensifer sp. Root1252 Isolate Unclassified
70 2643221659 Ensifer sp. Root127 Isolate Unclassified
71 2643221668 Ensifer sp. Root423 Isolate Unclassified
72 2643221675 Ensifer sp. Root1298 Isolate Unclassified
73 2643221680 Ensifer sp. Root1312 Isolate Unclassified
74 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
75 2643221688 Rhizobium sp. Root482 Isolate Unclassified
76 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
77 2643221698 Ensifer sp. Root142 Isolate Unclassified
78 2643221712 Ensifer sp. Root258 Isolate Unclassified
79 2643221726 Ensifer sp. Root954 Isolate Unclassified
80 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
81 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
82 2718217882 Rhizobium sp. N741 Isolate Nodule
83 2718217927 Rhizobium sp. N324 Isolate Nodule
84 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
85 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
86 2718218009 Rhizobium sp. N561 Isolate Nodule
87 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
88 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
89 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
90 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
91 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
92 2718218363 Rhizobium sp. N113 Isolate Nodule
93 2718218365 Rhizobium sp. N731 Isolate Nodule
94 2718218366 Rhizobium sp. N621 Isolate Nodule
95 2718218423 Rhizobium sp. N941 Isolate Nodule
96 2721755514 Rhizobium sp. N6212 Isolate Nodule
97 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
98 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
99 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
100 2721755809 Rhizobium sp. N541 Isolate Nodule
101 2721755810 Rhizobium sp. N871 Isolate Nodule
102 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
103 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
104 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
105 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
106 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
107 2728369365 Rhizobium sp. N1341 Isolate Nodule
108 2728369397 Rhizobium sp. N1314 Isolate Nodule
109 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
110 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
111 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
112 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
113 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
114 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
115 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
116 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
117 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
118 2791355256 Rhizobium sp. M10 Isolate Nodule
119 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
120 2791355262 Rhizobium sp. M1 Isolate Nodule
121 2791355264 Rhizobium sp. S9 Isolate Nodule
122 2791355265 Rhizobium sp. H4 Isolate Nodule
123 2791355266 Rhizobium sp. L43 Isolate Nodule
124 2791355267 Rhizobium sp. L18 Isolate Nodule
125 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
126 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
127 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
128 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
129 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
130 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
131 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
132 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
133 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
134 2802429633 Rhizobium anhuiense J3 Isolate Nodule
135 2802429634 Rhizobium anhuiense S10 Isolate Nodule
136 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
137 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
138 2802429637 Rhizobium anhuiense C15 Isolate Nodule
139 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
140 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
141 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
142 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
143 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
144 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
145 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
146 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
147 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
148 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
149 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
150 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
151 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
152 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
153 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
154 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
155 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
156 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
157 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
158 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
159 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
160 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
161 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
162 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
163 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
164 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
165 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
166 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
167 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
168 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
169 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
170 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
171 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
172 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
173 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
174 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
175 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
176 2844163670 Ensifer sp. 1H6 Isolate Unclassified
177 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
178 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
179 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
180 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
181 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
182 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
183 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
184 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
185 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
186 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
187 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
188 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
189 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
190 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
191 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
192 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
193 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
194 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
195 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
196 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
197 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
198 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
199 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
200 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
201 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
202 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
203 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
204 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
205 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
206 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
207 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
208 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
209 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
210 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
211 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
212 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
213 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
214 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
215 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
216 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
217 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
218 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
219 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
220 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
221 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
222 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
223 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
224 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
225 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
226 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
227 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
228 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
229 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
230 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
231 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
232 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
233 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
234 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
235 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
236 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
237 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
238 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
239 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
240 2933599457 Rhizobium phaseoli M3 Isolate Nodule
241 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
242 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
243 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
244 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
245 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
246 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
247 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
248 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
249 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
250 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
251 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
252 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
253 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
254 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
255 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
256 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
257 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
258 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
259 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
260 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
261 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
262 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
263 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
264 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
265 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
266 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
267 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
268 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
269 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
270 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
271 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
272 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
273 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
274 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
275 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
276 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
277 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
278 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
279 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
280 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
281 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
282 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
283 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
284 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
285 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
286 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
287 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
288 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
289 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
290 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
291 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
292 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
293 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
294 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
295 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
296 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
297 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
298 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
299 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
300 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
301 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
302 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
303 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
304 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
305 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
306 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
307 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
308 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
309 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
310 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
311 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
312 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
313 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
314 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
315 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
316 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
317 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
318 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
319 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
320 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
321 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
322 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
323 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
324 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
325 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
326 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
327 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
328 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
329 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
330 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
331 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
332 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
333 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
334 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
335 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
336 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
337 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
338 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
339 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
340 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
341 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
342 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
343 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
344 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
345 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
346 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
347 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
348 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
349 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
350 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
351 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
352 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
353 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
354 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
355 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
356 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
357 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
358 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
359 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
360 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
361 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
362 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
363 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
364 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
365 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
366 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
367 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
368 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
369 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
370 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
371 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
372 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
373 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
374 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
375 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
376 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
377 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
378 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
379 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
380 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
381 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
382 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
383 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
384 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
385 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
386 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
387 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
388 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
389 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
390 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
391 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
392 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
393 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
394 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
395 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
396 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
397 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
398 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
399 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
400 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
401 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
402 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
403 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
404 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
405 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
406 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
407 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
408 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
409 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
410 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
412 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
413 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
414 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
415 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
417 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
418 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
423 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
424 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
426 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
427 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
428 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
429 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
430 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
431 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
432 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
433 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
434 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
435 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
436 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
437 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
438 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
439 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
440 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
441 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
442 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
443 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
444 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
445 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
446 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
447 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
448 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
449 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
450 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
451 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
452 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
453 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
454 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
457 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
458 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
459 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
460 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
461 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
462 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
463 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
464 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
465 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
466 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
467 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
468 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
469 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
470 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
471 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
472 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
473 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
474 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
475 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
476 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
477 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
478 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
479 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
480 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
481 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
482 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
483 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
484 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
485 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
486 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
487 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
488 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
489 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
490 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
491 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
492 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
493 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
494 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
495 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
496 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
497 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
498 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
499 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
500 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
501 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
502 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
503 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
504 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
505 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
506 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
507 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
508 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
509 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
510 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
511 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
512 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
513 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
514 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
515 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
516 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
517 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
518 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
519 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
520 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
521 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
522 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
523 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
524 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
525 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
526 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
527 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
528 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
529 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
530 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
531 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
532 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
533 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
534 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
535 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
536 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
537 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
538 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
539 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
545 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
546 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
547 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
548 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
549 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
550 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
551 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
552 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
554 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
555 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
556 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
557 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
558 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
559 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
562 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
563 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
564 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
565 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
566 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
567 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
568 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
569 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
570 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
571 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
572 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
573 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
574 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
575 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
576 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
577 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
578 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
579 8005275841 Rhizobium sp. N4311 Isolate Nodule
580 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
581 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
582 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
583 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
584 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
585 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
586 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
587 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
588 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
589 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
590 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
591 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
592 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
593 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
594 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
595 8018176218 Rhizobium sp. N122 Isolate Nodule
596 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
597 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
598 8024501048 Rhizobium sp. H4 Isolate Nodule
599 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
600 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
601 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
602 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
603 8056382006 Rhizobium croatiense 13T Isolate Nodule
604 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.99
Metatranscriptomes 0
Isolates 59.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 50.73
Rhizoplane 1.74
Rhizosphere 23.69
Stem 0
Stem Tuber 0
Unclassified 13.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10005696 3300003187 Bacteria 6394
2 rootH2_10039980 3300003320 Bacteria 2592
3 rootH1_10044850 3300003323 Bacteria 2968
4 JGI25160J50197_1001143 3300003354 Bacteria 13576
5 JGI25161J50226_1007798 3300003374 Bacteria 1730
6 Ga0055529_1000683 3300003763 Bacteria 23311
7 Ga0055526_1002351 3300003771 Bacteria 12849
8 Ga0055526_1046410 3300003771 Bacteria 1029
9 Ga0055524_1000517 3300003775 Bacteria 29782
10 Ga0055524_1002854 3300003775 Bacteria 8665
11 Ga0055524_1007706 3300003775 Bacteria 4546
12 Ga0055528_1000982 3300003790 Bacteria 18925
13 Ga0055528_1013213 3300003790 Bacteria 3147
14 Ga0055540_1000096 3300003792 Bacteria 96969
15 Ga0055540_1004097 3300003792 Bacteria 6750
16 Ga0055540_1007276 3300003792 Bacteria 4216
17 Ga0055531_10053546 3300003794 Bacteria 1041
18 Ga0065165_1005520 3300005262 Bacteria 7067
19 Ga0065704_10194511 3300005289 Bacteria 1171
20 Ga0070680_100067434 3300005336 Bacteria 2935
21 Ga0070671_100013519 3300005355 Bacteria 6582
22 Ga0068863_100001682 3300005841 Bacteria 21896
23 Ga0068862_100004591 3300005844 Bacteria 11636
24 Ga0081540_1000664 3300005983 Bacteria 32418
25 Ga0075365_10000808 3300006038 Bacteria 12863
26 Ga0075368_10041594 3300006042 Bacteria 1806
27 Ga0075364_10006271 3300006051 Bacteria 6979
28 Ga0075364_10008042 3300006051 Bacteria 6289
29 Ga0075364_10009352 3300006051 Bacteria 5874
30 Ga0075364_10036068 3300006051 Bacteria 3197
31 Ga0075364_10140890 3300006051 Bacteria 1622
32 Ga0075362_10002642 3300006177 Bacteria 6081
33 Ga0075366_10001529 3300006195 Bacteria 11567
34 Ga0075370_10003493 3300006353 Bacteria 7489
35 Ga0105247_10057365 3300009101 Bacteria 2407
36 Ga0123342_1024877 3300009766 Bacteria 3686
37 Ga0105239_11428250 3300010375 Bacteria 799
38 Ga0157326_1008495 3300012513 Bacteria 1121
39 Ga0171463_1012 3300013249 Bacteria 176554
40 Ga0157379_10041012 3300014968 Bacteria 4132
41 Ga0183363_1193 3300015690 Bacteria 12837
42 Ga0214544_1000018 3300021320 Bacteria 187095
43 Ga0214542_1001937 3300021321 Bacteria 42815
44 Ga0214542_1024565 3300021321 Bacteria 3341
45 Ga0214542_1037892 3300021321 Bacteria 1352
46 Ga0214543_1000012 3300021327 Bacteria 338982
47 Ga0214543_1000042 3300021327 Bacteria 164433
48 Ga0214543_1000162 3300021327 Bacteria 96261
49 Ga0228711_1002155 3300022739 Bacteria 29954
50 Ga0228710_1002282 3300022740 Bacteria 30071
51 Ga0209455_1000503 3300025272 Bacteria 28146
52 Ga0209673_1000105 3300025273 Bacteria 186267
53 Ga0209673_1002092 3300025273 Bacteria 15006
54 Ga0209130_1013856 3300025284 Bacteria 2048
55 Ga0209564_1000913 3300025295 Bacteria 38633
56 Ga0209564_1001922 3300025295 Bacteria 18544
57 Ga0209564_1032182 3300025295 Bacteria 1584
58 Ga0209758_1000380 3300025297 Bacteria 77252
59 Ga0209050_1003406 3300025298 Bacteria 11784
60 Ga0209256_1000260 3300025299 Bacteria 93956
61 Ga0209256_1000281 3300025299 Bacteria 89636
62 Ga0209256_1001129 3300025299 Bacteria 30423
63 Ga0209256_1002297 3300025299 Bacteria 16069
64 Ga0207426_1000350 3300025302 Bacteria 84510
65 Ga0209051_1000027 3300025303 Bacteria 412172
66 Ga0209051_1001030 3300025303 Bacteria 26476
67 Ga0209051_1023350 3300025303 Bacteria 2574
68 Ga0209257_1001771 3300025304 Bacteria 23907
69 Ga0209257_1011780 3300025304 Bacteria 4152
70 Ga0207644_10010531 3300025931 Bacteria 6095
71 Ga0207641_10004926 3300026088 Bacteria 11470
72 Ga0209281_1000655 3300027111 Bacteria 37203
73 Ga0209281_1000789 3300027111 Bacteria 29982
74 Ga0209282_1000216 3300027666 Bacteria 30081
75 Ga0268266_10436754 3300028379 Bacteria 1243
76 Ga0307515_10000121 3300028794 Bacteria 188657
77 Ga0307515_10070741 3300028794 Bacteria 4743
78 Ga0307515_10202033 3300028794 Bacteria 1860
79 Ga0307513_10024415 3300031456 Bacteria 7033
80 Ga0307513_10163080 3300031456 Bacteria 2118
81 Ga0307513_10488593 3300031456 Bacteria 950
82 Ga0307405_10313770 3300031731 Bacteria 1195
83 Ga0307406_10101787 3300031901 Bacteria 1958
84 Ga0315914_1002167 3300031967 Bacteria 30071
85 Ga0307416_100237577 3300032002 Bacteria 1763
86 Ga0307414_10310820 3300032004 Bacteria 1337
87 Ga0315913_1000874 3300033430 Bacteria 30079
88 Ga0315915_1001277 3300033464 Bacteria 30071
89 Ga0395905_0000157 3300037471 Bacteria 112004
90 Ga0395905_0003131 3300037471 Bacteria 17831
91 Ga0400483_182281 3300039062 Bacteria 1833
92 Ga0439436_0025457 3300041404 Bacteria 1738
93 Ga0439436_0154682 3300041404 Bacteria 647
94 Ga0439439_0034147 3300041406 Bacteria 1304
95 Ga0439466_0100521 3300041411 Bacteria 902
96 Ga0439465_0003152 3300041413 Bacteria 5385
97 Ga0439465_0024355 3300041413 Bacteria 1907
98 Ga0451835_1258197 3300041492 Bacteria 1068
99 Ga0451841_0078269 3300041498 Bacteria 1891
100 Ga0451851_0389910 3300041507 Bacteria 980
101 Ga0451855_1395754 3300041511 Bacteria 631
102 Ga0451853_2152199 3300041512 Bacteria 1740
103 Ga0439449_0065659 3300042007 Bacteria 1338
104 Ga0450907_014384 3300042146 Bacteria 1321
105 Ga0439434_0148717 3300042435 Bacteria 775
106 Ga0466958_0128555 3300045836 Bacteria 1590
107 Ga0466967_0226497 3300045976 Bacteria 1779
108 Ga0466967_0247429 3300045976 Bacteria 1702
109 Ga0495617_018024 3300046452 Bacteria 2387
110 Ga0495592_0000229 3300046454 Bacteria 48485
111 Ga0495590_0029931 3300046457 Bacteria 1908
112 Ga0495591_000101 3300046458 Bacteria 99240
113 Ga0495629_0000561 3300046459 Bacteria 30335
114 Ga0495638_0000163 3300046460 Bacteria 103363
115 Ga0495638_0008099 3300046460 Bacteria 7473
116 Ga0495638_0013770 3300046460 Bacteria 5491
117 Ga0495638_0023236 3300046460 Bacteria 4058
118 Ga0495638_0194310 3300046460 Bacteria 1150
119 Ga0495638_0277412 3300046460 Bacteria 912
120 Ga0495641_0133854 3300046461 Bacteria 1107
121 Ga0495651_0000730 3300046462 Bacteria 25378
122 Ga0495653_0009573 3300046463 Bacteria 7924
123 Ga0495580_0000681 3300046472 Bacteria 28955
124 Ga0495605_0012887 3300046474 Bacteria 4627
125 Ga0495662_0018963 3300046476 Bacteria 3329
126 Ga0495664_0021184 3300046477 Bacteria 3755
127 Ga0495585_0015817 3300046492 Bacteria 4380
128 Ga0495585_0154128 3300046492 Bacteria 1196
129 Ga0495596_0000146 3300046500 Bacteria 48977
130 Ga0495583_0000449 3300046506 Bacteria 61654
131 Ga0495583_0064561 3300046506 Bacteria 1624
132 Ga0495583_0066549 3300046506 Bacteria 1594
133 Ga0495606_0002598 3300046507 Bacteria 20659
134 Ga0495608_0000241 3300046511 Bacteria 39695
135 Ga0495616_0038823 3300046513 Bacteria 2442
136 Ga0495618_0001966 3300046514 Bacteria 13476
137 Ga0495620_0064666 3300046515 Bacteria 1512
138 Ga0495628_0005725 3300046516 Bacteria 10886
139 Ga0495630_0000147 3300046517 Bacteria 54656
140 Ga0495631_0010810 3300046518 Bacteria 4509
141 Ga0495632_0007429 3300046519 Bacteria 6881
142 Ga0495648_0000164 3300046524 Bacteria 78546
143 Ga0495648_0013155 3300046524 Bacteria 6134
144 Ga0495648_0016222 3300046524 Bacteria 5374
145 Ga0495666_0000107 3300046526 Bacteria 33827
146 Ga0495652_0006343 3300046529 Bacteria 11014
147 Ga0495654_0000553 3300046530 Bacteria 30194
148 Ga0495665_0000827 3300046531 Bacteria 16201
149 Ga0495640_0000282 3300046533 Bacteria 34895
150 Ga0495586_0012956 3300046535 Bacteria 4420
151 Ga0495587_0002606 3300046536 Bacteria 12040
152 Ga0495609_0015374 3300046538 Bacteria 3583
153 Ga0495597_0032186 3300046542 Bacteria 2381
154 Ga0495667_0016834 3300046559 Bacteria 4937
155 Ga0495656_0139403 3300046615 Bacteria 1162
156 Ga0495668_0004281 3300046616 Bacteria 10239
157 Ga0495668_0146819 3300046616 Bacteria 1291
158 Ga0495634_0001199 3300046642 Bacteria 23908
159 Ga0495611_0014527 3300046648 Bacteria 3365
160 Ga0495625_0008338 3300046660 Bacteria 8850
161 Ga0495625_0038721 3300046660 Bacteria 3488
162 Ga0495625_0154478 3300046660 Bacteria 1541
163 Ga0495635_0000218 3300046663 Bacteria 36175
164 Ga0495661_0000818 3300046665 Bacteria 29194
165 Ga0495599_0001820 3300046678 Bacteria 12374
166 Ga0495623_0000895 3300046679 Bacteria 20191
167 Ga0495646_0000372 3300046680 Bacteria 23306
168 Ga0495613_0000353 3300046689 Bacteria 40648
169 Ga0495624_0000869 3300046690 Bacteria 23955
170 Ga0495671_0009578 3300046692 Bacteria 5408
171 Ga0495649_0000211 3300046694 Bacteria 51291
172 Ga0495649_0021376 3300046694 Bacteria 3626
173 Ga0495589_0000213 3300046794 Bacteria 49333
174 Ga0495600_0004656 3300046809 Bacteria 8221
175 Ga0495660_0050092 3300046810 Bacteria 2277
176 Ga0495581_0021845 3300047315 Bacteria 3709
177 Ga0495604_0004103 3300047317 Bacteria 11572
178 Ga0495674_0032747 3300047319 Bacteria 4711
179 Ga0495672_0001856 3300047320 Bacteria 20144
180 Ga0495672_0034279 3300047320 Bacteria 3138
181 Ga0495676_0016763 3300047321 Bacteria 6489
182 Ga0495680_0026038 3300047322 Bacteria 4830
183 Ga0495683_0000435 3300047323 Bacteria 33153
184 Ga0495683_0029434 3300047323 Bacteria 2807
185 Ga0495683_0128221 3300047323 Bacteria 1199
186 Ga0495675_0000151 3300047444 Bacteria 48734
187 Ga0495679_000093 3300047446 Bacteria 81614
188 Ga0495673_0002198 3300047469 Bacteria 14112
189 Ga0495673_0002375 3300047469 Bacteria 13348
190 Ga0495593_0000123 3300047673 Bacteria 37582
191 Ga0495602_0006996 3300048088 Bacteria 11842
192 Ga0495614_0000139 3300048089 Bacteria 25932
193 Ga0495626_0000623 3300048091 Bacteria 34507
194 Ga0495626_0091521 3300048091 Bacteria 1337
195 Ga0496100_0011869 3300048903 Bacteria 4973
196 Ga0496101_0001230 3300048904 Bacteria 15327
197 Ga0496102_0000030 3300048905 Bacteria 221326
198 Ga0496103_0000068 3300048906 Bacteria 121996
199 Ga0496104_0142888 3300048907 Bacteria 2299
200 Ga0496105_0023939 3300048908 Bacteria 4960
201 Ga0496107_0352649 3300048910 Bacteria 1095
202 Ga0496109_0213226 3300048912 Bacteria 1816
203 Ga0496111_0320724 3300048914 Bacteria 1148
204 Ga0496116_0000152 3300048919 Bacteria 141311
205 Ga0496116_0098478 3300048919 Bacteria 1754
206 Ga0496116_0157969 3300048919 Unclassified 1248
207 Ga0496117_0000059 3300048920 Bacteria 260163
208 Ga0496118_0000061 3300048921 Bacteria 220889
209 Ga0496119_0000431 3300048922 Bacteria 57748
210 Ga0496120_0005138 3300048923 Bacteria 10575
211 Ga0496120_0020033 3300048923 Bacteria 4262
212 Ga0496121_0000174 3300048924 Bacteria 143186
213 Ga0496121_0007649 3300048924 Bacteria 12978
214 Ga0496121_0089367 3300048924 Bacteria 2412
215 Ga0496122_0047492 3300048925 Bacteria 3314
216 Ga0496122_0284068 3300048925 Unclassified 902
217 Ga0496123_0065207 3300048926 Bacteria 2316
218 Ga0496124_0000036 3300048927 Bacteria 318032
219 Ga0496124_0027824 3300048927 Bacteria 5066
220 Ga0496124_0059283 3300048927 Bacteria 3216
221 Ga0496125_0000093 3300048928 Bacteria 210896
222 Ga0496125_0000292 3300048928 Bacteria 98599
223 Ga0496125_0124168 3300048928 Bacteria 1833
224 Ga0496126_0000213 3300048929 Bacteria 128366
225 Ga0496126_0503450 3300048929 Bacteria 967
226 Ga0495678_021209 3300049459 Bacteria 2864
227 Ga0495682_0000499 3300049460 Bacteria 27163
228 Ga0495682_0002037 3300049460 Bacteria 9921
229 Ga0495682_0041118 3300049460 Bacteria 1695
230 Ga0501033_0119062 3300049570 Bacteria 1917
231 Ga0501034_0006800 3300049571 Bacteria 12232
232 Ga0501034_0101292 3300049571 Bacteria 2874
233 Ga0501034_0196729 3300049571 Bacteria 1975
234 Ga0501036_0161103 3300049572 Bacteria 1892
235 Ga0501037_0026919 3300049573 Bacteria 4248
236 Ga0501037_0551708 3300049573 Bacteria 778
237 Ga0501038_0140136 3300049574 Bacteria 1979
238 Ga0501043_0048042 3300049579 Bacteria 3355
239 Ga0501069_0057301 3300049585 Bacteria 2171
240 Ga0501069_0109020 3300049585 Bacteria 1576
241 Ga0501070_0004351 3300049586 Bacteria 12177
242 Ga0501070_0025986 3300049586 Bacteria 4912
243 Ga0501070_0597300 3300049586 Bacteria 880
244 Ga0501072_0476087 3300049588 Bacteria 988
245 Ga0501074_0043608 3300049590 Bacteria 3247
246 Ga0501076_0283990 3300049592 Bacteria 1356
247 Ga0501202_070714 3300049652 Bacteria 804
248 Ga0501080_0038950 3300049742 Bacteria 4436
249 Ga0501035_0071459 3300049822 Bacteria 3072
250 Ga0501035_0235513 3300049822 Bacteria 1559
251 Ga0501035_0341724 3300049822 Bacteria 1254
252 Ga0501044_0055951 3300049823 Bacteria 4050
253 Ga0501044_0313997 3300049823 Bacteria 1493
254 nmdc:mga03683_2599_c1 3300050489 Bacteria 5637
255 nmdc:mga00v17_123288_c1 3300050491 Bacteria 1652
256 nmdc:mga00v17_15855_c1 3300050491 Bacteria 4239
257 nmdc:mga00v17_238387_c1 3300050491 Bacteria 1179
258 nmdc:mga00v17_47863_c1 3300050491 Bacteria 2590
259 nmdc:mga00v17_49367_c1 3300050491 Bacteria 2553
260 nmdc:mga00v17_4957_c1 3300050491 Bacteria 6117
261 nmdc:mga0yw44_40411_c1 3300050492 Bacteria 2771
262 nmdc:mga0k408_15225_c1 3300050493 Bacteria 4250
263 nmdc:mga0k408_460092_c1 3300050493 Bacteria 755
264 nmdc:mga07m45_5702_c1 3300050496 Bacteria 6227
265 nmdc:mga0sz30_7116_c2 3300050516 Bacteria 3619
266 Ga0500578_0451004 3300053086 Bacteria 732
267 Ga0500644_0073379 3300053088 Bacteria 1239
268 Ga0500557_002795 3300053105 Bacteria 3300
269 Ga0500569_030380 3300053109 Bacteria 1511
270 Ga0500594_0001612 3300053118 Bacteria 4905
271 Ga0500594_0132027 3300053118 Bacteria 792
272 Ga0500642_0007323 3300053130 Bacteria 3701
273 Ga0500642_0079526 3300053130 Bacteria 1503
274 Ga0500658_0000932 3300053134 Bacteria 11919
275 Ga0500658_0003225 3300053134 Bacteria 6199
276 Ga0500568_0000210 3300053139 Bacteria 50927
277 Ga0500577_0020677 3300053142 Bacteria 2158
278 Ga0500577_0091198 3300053142 Bacteria 1232
279 Ga0500604_0011514 3300053151 Bacteria 2376
280 Ga0500616_0002480 3300053153 Bacteria 15299
281 Ga0500622_0082992 3300053156 Bacteria 1602
282 Ga0500609_001377 3300053731 Bacteria 3560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_1395754 Ga0451855_1395754_48_620 164
2 3300005844 Ga0068862_100004591 Ga0068862_1000045918 177
3 3300031456 Ga0307513_10163080 Ga0307513_101630802 179
4 3300053130 Ga0500642_0007323 Ga0500642_0007323_714_1436 179
5 3300053134 Ga0500658_0003225 Ga0500658_0003225_4442_5164 179
6 3300049586 Ga0501070_0597300 Ga0501070_0597300_58_783 183
7 3300049571 Ga0501034_0101292 Ga0501034_0101292_915_1640 185
8 3300049573 Ga0501037_0026919 Ga0501037_0026919_1703_2428 185
9 3300049823 Ga0501044_0313997 Ga0501044_0313997_738_1463 185
10 3300049742 Ga0501080_0038950 Ga0501080_0038950_2837_3463 186
11 3300049822 Ga0501035_0341724 Ga0501035_0341724_259_984 186
12 iso_pu_bacteria 8004395343 8004397303 189
13 3300053088 Ga0500644_0073379 Ga0500644_0073379_30_758 190
14 3300053130 Ga0500642_0079526 Ga0500642_0079526_310_1038 190
15 3300053142 Ga0500577_0020677 Ga0500577_0020677_800_1528 190
16 3300053151 Ga0500604_0011514 Ga0500604_0011514_466_1194 190
17 3300046460 Ga0495638_0194310 Ga0495638_0194310_197_919 191
18 3300050491 nmdc:mga00v17_47863_c1 nmdc:mga00v17_47863_c1_1184_1825 191
19 3300050491 nmdc:mga00v17_49367_c1 nmdc:mga00v17_49367_c1_431_1072 191
20 3300053156 Ga0500622_0082992 Ga0500622_0082992_23_721 191
21 3300041404 Ga0439436_0154682 Ga0439436_0154682_34_624 196
22 3300049586 Ga0501070_0025986 Ga0501070_0025986_2996_3721 199
23 3300049592 Ga0501076_0283990 Ga0501076_0283990_529_1254 199
24 3300049823 Ga0501044_0055951 Ga0501044_0055951_3386_4012 199
25 iso_pu_bacteria 2977971508 2977979596 199
26 3300037471 Ga0395905_0003131 Ga0395905_0003131_10907_11566 200
27 3300045976 Ga0466967_0247429 Ga0466967_0247429_853_1566 200
28 3300022739 Ga0228711_1002155 Ga0228711_10021557 202
29 3300022740 Ga0228710_1002282 Ga0228710_10022828 202
30 3300027111 Ga0209281_1000789 Ga0209281_100078923 202
31 3300027666 Ga0209282_1000216 Ga0209282_100021623 202
32 3300031967 Ga0315914_1002167 Ga0315914_100216723 202
33 3300033430 Ga0315913_1000874 Ga0315913_100087423 202
34 3300033464 Ga0315915_1001277 Ga0315915_100127723 202
35 3300037471 Ga0395905_0000157 Ga0395905_0000157_24826_25485 203
36 3300049573 Ga0501037_0551708 Ga0501037_0551708_155_766 203
37 3300003763 Ga0055529_1000683 Ga0055529_100068321 204
38 3300025272 Ga0209455_1000503 Ga0209455_100050322 204
39 3300049822 Ga0501035_0071459 Ga0501035_0071459_925_1599 204
40 3300005336 Ga0070680_100067434 Ga0070680_1000674343 205
41 3300005355 Ga0070671_100013519 Ga0070671_1000135194 207
42 3300025931 Ga0207644_10010531 Ga0207644_100105312 207
43 iso_pu_bacteria 2857542790 2857546911 209
44 3300049822 Ga0501035_0235513 Ga0501035_0235513_720_1445 210
45 3300053105 Ga0500557_002795 Ga0500557_002795_22_654 210
46 3300053731 Ga0500609_001377 Ga0500609_001377_31_765 210
47 3300049588 Ga0501072_0476087 Ga0501072_0476087_323_961 212
48 3300006051 Ga0075364_10008042 Ga0075364_100080422 213
49 3300006051 Ga0075364_10036068 Ga0075364_100360684 213
50 3300048924 Ga0496121_0089367 Ga0496121_0089367_772_1413 213
51 3300048927 Ga0496124_0000036 Ga0496124_0000036_174491_175171 213
52 3300049585 Ga0501069_0057301 Ga0501069_0057301_622_1284 213
53 3300049586 Ga0501070_0004351 Ga0501070_0004351_5825_6487 213
54 3300049590 Ga0501074_0043608 Ga0501074_0043608_637_1299 213
55 3300050491 nmdc:mga00v17_123288_c1 nmdc:mga00v17_123288_c1_599_1240 213
56 iso_pu_bacteria 2643221594 2643981712 213
57 iso_pu_bacteria 2929138655 2929143839 213
58 iso_pu_bacteria 2834578030 2834578497 214
59 iso_pu_bacteria 2899259804 2899260165 214
60 iso_pu_bacteria 8056207758 8056211788 214
61 iso_pu_bacteria 2509276021 2509390738 215
62 iso_pu_bacteria 2509276033 2509442049 215
63 iso_pu_bacteria 2510065019 2510136346 215
64 iso_pu_bacteria 2510065045 2510248512 215
65 iso_pu_bacteria 2510065057 2510302957 215
66 iso_pu_bacteria 2510461076 2510892638 215
67 iso_pu_bacteria 2511231027 2511389458 215
68 iso_pu_bacteria 2511231052 2511496949 215
69 iso_pu_bacteria 2512047086 2512529388 215
70 iso_pu_bacteria 2512875026 2512969032 215
71 iso_pu_bacteria 2513237084 2513568643 215
72 iso_pu_bacteria 2513237086 2513583390 215
73 iso_pu_bacteria 2513237089 2513607014 215
74 iso_pu_bacteria 2513237091 2513614936 215
75 iso_pu_bacteria 2513237093 2513630495 215
76 iso_pu_bacteria 2513237103 2513711257 215
77 iso_pu_bacteria 2513237138 2513869981 215
78 iso_pu_bacteria 2513237140 2513883944 215
79 iso_pu_bacteria 2513237143 2513901610 215
80 iso_pu_bacteria 2513237144 2513914565 215
81 iso_pu_bacteria 2513237146 2513923927 215
82 iso_pu_bacteria 2513237156 2513987704 215
83 iso_pu_bacteria 2513237160 2514008832 215
84 iso_pu_bacteria 2513237162 2514018489 215
85 iso_pu_bacteria 2515075009 2515108709 215
86 iso_pu_bacteria 2515154107 2515612188 215
87 iso_pu_bacteria 2515154113 2515632573 215
88 iso_pu_bacteria 2515154116 2515656576 215
89 iso_pu_bacteria 2515154122 2515684197 215
90 iso_pu_bacteria 2515154134 2515738192 215
91 iso_pu_bacteria 2516143018 2516208232 215
92 iso_pu_bacteria 2516653046 2516895821 215
93 iso_pu_bacteria 2516653077 2517040642 215
94 iso_pu_bacteria 2517093000 2517098271 215
95 iso_pu_bacteria 2517287029 2517409766 215
96 iso_pu_bacteria 2517487022 2517566215 215
97 iso_pu_bacteria 2524023207 2524449177 215
98 iso_pu_bacteria 2529292951 2530648917 215
99 iso_pu_bacteria 2551306084 2551678709 215
100 iso_pu_bacteria 2551306084 2551681947 215
101 iso_pu_bacteria 2551306085 2551683268 215
102 iso_pu_bacteria 2551306086 2551696710 215
103 iso_pu_bacteria 2551306087 2551699874 215
104 iso_pu_bacteria 2551306089 2551714127 215
105 iso_pu_bacteria 2551306090 2551716751 215
106 iso_pu_bacteria 2551306091 2551731400 215
107 iso_pu_bacteria 2551306092 2551739075 215
108 iso_pu_bacteria 2551306093 2551744250 215
109 iso_pu_bacteria 2582581283 2585169482 215
110 iso_pu_bacteria 2582581865 2585389236 215
111 iso_pu_bacteria 2585427526 2585530001 215
112 iso_pu_bacteria 2585427528 2585543464 215
113 iso_pu_bacteria 2585427593 2585841920 215
114 iso_pu_bacteria 2585427633 2585993718 215
115 iso_pu_bacteria 2585427634 2586004567 215
116 iso_pu_bacteria 2599185170 2599415969 215
117 iso_pu_bacteria 2599185352 2600195624 215
118 iso_pu_bacteria 2615840624 2616297845 215
119 iso_pu_bacteria 2643221557 2643809560 215
120 iso_pu_bacteria 2643221607 2644048911 215
121 iso_pu_bacteria 2643221610 2644066709 215
122 iso_pu_bacteria 2643221618 2644107102 215
123 iso_pu_bacteria 2643221626 2644147843 215
124 iso_pu_bacteria 2643221636 2644203689 215
125 iso_pu_bacteria 2643221655 2644311407 215
126 iso_pu_bacteria 2643221659 2644335116 215
127 iso_pu_bacteria 2643221668 2644375900 215
128 iso_pu_bacteria 2643221675 2644415078 215
129 iso_pu_bacteria 2643221680 2644451489 215
130 iso_pu_bacteria 2643221686 2644482878 215
131 iso_pu_bacteria 2643221688 2644494955 215
132 iso_pu_bacteria 2643221689 2644497624 215
133 iso_pu_bacteria 2643221698 2644543977 215
134 iso_pu_bacteria 2643221712 2644617082 215
135 iso_pu_bacteria 2643221726 2644693135 215
136 iso_pu_bacteria 2657244999 2657685148 215
137 iso_pu_bacteria 2690316117 2692319576 215
138 iso_pu_bacteria 2718217882 2719184680 215
139 iso_pu_bacteria 2718217927 2719389304 215
140 iso_pu_bacteria 2718217991 2719643061 215
141 iso_pu_bacteria 2718217997 2719668673 215
142 iso_pu_bacteria 2718218009 2719728700 215
143 iso_pu_bacteria 2718218199 2720489366 215
144 iso_pu_bacteria 2718218232 2720610040 215
145 iso_pu_bacteria 2718218233 2720617464 215
146 iso_pu_bacteria 2718218235 2720628610 215
147 iso_pu_bacteria 2718218269 2720772560 215
148 iso_pu_bacteria 2718218363 2721144391 215
149 iso_pu_bacteria 2718218365 2721156344 215
150 iso_pu_bacteria 2718218366 2721161761 215
151 iso_pu_bacteria 2718218423 2721402070 215
152 iso_pu_bacteria 2721755514 2722842906 215
153 iso_pu_bacteria 2721755685 2723569955 215
154 iso_pu_bacteria 2721755809 2724035903 215
155 iso_pu_bacteria 2721755810 2724041725 215
156 iso_pu_bacteria 2721755819 2724092589 215
157 iso_pu_bacteria 2721755822 2724101502 215
158 iso_pu_bacteria 2721755823 2724112972 215
159 iso_pu_bacteria 2724679232 2725949610 215
160 iso_pu_bacteria 2728369365 2730160795 215
161 iso_pu_bacteria 2728369397 2730295877 215
162 iso_pu_bacteria 2738541333 2739035359 215
163 iso_pu_bacteria 2765235802 2765465603 215
164 iso_pu_bacteria 2765235942 2766069102 215
165 iso_pu_bacteria 2767802442 2770197598 215
166 iso_pu_bacteria 2791355082 2792580923 215
167 iso_pu_bacteria 2791355091 2792619308 215
168 iso_pu_bacteria 2791355092 2792627081 215
169 iso_pu_bacteria 2791355094 2792639884 215
170 iso_pu_bacteria 2791355137 2792839211 215
171 iso_pu_bacteria 2791355256 2793297831 215
172 iso_pu_bacteria 2791355259 2793312615 215
173 iso_pu_bacteria 2791355262 2793337561 215
174 iso_pu_bacteria 2791355264 2793345570 215
175 iso_pu_bacteria 2791355265 2793354978 215
176 iso_pu_bacteria 2791355266 2793363718 215
177 iso_pu_bacteria 2791355267 2793370346 215
178 iso_pu_bacteria 2802428858 2802721847 215
179 iso_pu_bacteria 2802428859 2802728549 215
180 iso_pu_bacteria 2802428860 2802734593 215
181 iso_pu_bacteria 2802428861 2802741210 215
182 iso_pu_bacteria 2802428862 2802747493 215
183 iso_pu_bacteria 2802428863 2802754063 215
184 iso_pu_bacteria 2802429268 2804754402 215
185 iso_pu_bacteria 2802429605 2805927239 215
186 iso_pu_bacteria 2802429606 2805934333 215
187 iso_pu_bacteria 2802429633 2806048281 215
188 iso_pu_bacteria 2802429634 2806056066 215
189 iso_pu_bacteria 2802429635 2806062883 215
190 iso_pu_bacteria 2802429636 2806070487 215
191 iso_pu_bacteria 2802429637 2806077397 215
192 iso_pu_bacteria 2816332139 2816505113 215
193 iso_pu_bacteria 2837678835 2837679692 215
194 iso_pu_bacteria 2838022645 2838025307 215
195 iso_pu_bacteria 2838035591 2838036085 215
196 iso_pu_bacteria 2838068647 2838068660 215
197 iso_pu_bacteria 2838661181 2838667349 215
198 iso_pu_bacteria 2838668709 2838669446 215
199 iso_pu_bacteria 2838701080 2838701817 215
200 iso_pu_bacteria 2840764183 2840770469 215
201 iso_pu_bacteria 2841864319 2841865948 215
202 iso_pu_bacteria 2842110456 2842116371 215
203 iso_pu_bacteria 2842163707 2842164139 215
204 iso_pu_bacteria 2842192696 2842196086 215
205 iso_pu_bacteria 2842198810 2842200873 215
206 iso_pu_bacteria 2842205361 2842209745 215
207 iso_pu_bacteria 2842217011 2842219897 215
208 iso_pu_bacteria 2842250916 2842251759 215
209 iso_pu_bacteria 2842264693 2842264991 215
210 iso_pu_bacteria 2842278818 2842283199 215
211 iso_pu_bacteria 2842317721 2842320159 215
212 iso_pu_bacteria 2842341865 2842347687 215
213 iso_pu_bacteria 2842363717 2842364194 215
214 iso_pu_bacteria 2842395702 2842397192 215
215 iso_pu_bacteria 2842402390 2842405779 215
216 iso_pu_bacteria 2842409023 2842412362 215
217 iso_pu_bacteria 2842415677 2842419008 215
218 iso_pu_bacteria 2842422224 2842422806 215
219 iso_pu_bacteria 2842428310 2842428955 215
220 iso_pu_bacteria 2842434925 2842435569 215
221 iso_pu_bacteria 2842441272 2842441569 215
222 iso_pu_bacteria 2842454564 2842458047 215
223 iso_pu_bacteria 2842462802 2842463380 215
224 iso_pu_bacteria 2842469257 2842469899 215
225 iso_pu_bacteria 2842489311 2842489735 215
226 iso_pu_bacteria 2842495871 2842498221 215
227 iso_pu_bacteria 2842871566 2842872728 215
228 iso_pu_bacteria 2844163670 2844164353 215
229 iso_pu_bacteria 2847417321 2847421921 215
230 iso_pu_bacteria 2848992105 2848996686 215
231 iso_pu_bacteria 2854916844 2854917256 215
232 iso_pu_bacteria 2855825444 2855829362 215
233 iso_pu_bacteria 2855839649 2855844461 215
234 iso_pu_bacteria 2855872281 2855874956 215
235 iso_pu_bacteria 2857516855 2857517929 215
236 iso_pu_bacteria 2858800743 2858806078 215
237 iso_pu_bacteria 2885270888 2885273567 215
238 iso_pu_bacteria 2902682994 2902687443 215
239 iso_pu_bacteria 2904615490 2904625389 215
240 iso_pu_bacteria 2913295892 2913297160 215
241 iso_pu_bacteria 2915980308 2915985110 215
242 iso_pu_bacteria 2915986958 2915988119 215
243 iso_pu_bacteria 2915993759 2915993837 215
244 iso_pu_bacteria 2916000859 2916005460 215
245 iso_pu_bacteria 2916007675 2916008806 215
246 iso_pu_bacteria 2916014648 2916021508 215
247 iso_pu_bacteria 2916021584 2916021669 215
248 iso_pu_bacteria 2916028427 2916028520 215
249 iso_pu_bacteria 2916035215 2916037515 215
250 iso_pu_bacteria 2916041962 2916042021 215
251 iso_pu_bacteria 2916048683 2916048793 215
252 iso_pu_bacteria 2916055098 2916059857 215
253 iso_pu_bacteria 2916061851 2916067655 215
254 iso_pu_bacteria 2916068649 2916070627 215
255 iso_pu_bacteria 2916076590 2916077486 215
256 iso_pu_bacteria 2920822456 2920826485 215
257 iso_pu_bacteria 2921201388 2921205307 215
258 iso_pu_bacteria 2921208531 2921212097 215
259 iso_pu_bacteria 2921237296 2921237344 215
260 iso_pu_bacteria 2921244191 2921249233 215
261 iso_pu_bacteria 2921250672 2921256028 215
262 iso_pu_bacteria 2921257292 2921259452 215
263 iso_pu_bacteria 2921263974 2921268100 215
264 iso_pu_bacteria 2921282425 2921288652 215
265 iso_pu_bacteria 2921289301 2921295104 215
266 iso_pu_bacteria 2921296804 2921298005 215
267 iso_pu_bacteria 2923556063 2923562076 215
268 iso_pu_bacteria 2924144063 2924150433 215
269 iso_pu_bacteria 2924150972 2924157178 215
270 iso_pu_bacteria 2924158325 2924161711 215
271 iso_pu_bacteria 2924165586 2924171192 215
272 iso_pu_bacteria 2924172951 2924175033 215
273 iso_pu_bacteria 2924179722 2924182704 215
274 iso_pu_bacteria 2924186466 2924189127 215
275 iso_pu_bacteria 2924193448 2924196823 215
276 iso_pu_bacteria 2924200457 2924200547 215
277 iso_pu_bacteria 2924207177 2924212096 215
278 iso_pu_bacteria 2924214083 2924219273 215
279 iso_pu_bacteria 2924221636 2924223665 215
280 iso_pu_bacteria 2924228884 2924233394 215
281 iso_pu_bacteria 2928521798 2928523260 215
282 iso_pu_bacteria 2933016740 2933018384 215
283 iso_pu_bacteria 2933586486 2933592588 215
284 iso_pu_bacteria 2933599457 2933600278 215
285 iso_pu_bacteria 2935901341 2935903240 215
286 iso_pu_bacteria 2936367885 2936374465 215
287 iso_pu_bacteria 2936375103 2936378693 215
288 iso_pu_bacteria 2936996657 2936998411 215
289 iso_pu_bacteria 2937002841 2937003003 215
290 iso_pu_bacteria 2937009748 2937009852 215
291 iso_pu_bacteria 2937016420 2937019994 215
292 iso_pu_bacteria 2937023124 2937025170 215
293 iso_pu_bacteria 2937029754 2937034751 215
294 iso_pu_bacteria 2937036028 2937041699 215
295 iso_pu_bacteria 2937042894 2937049731 215
296 iso_pu_bacteria 2937049772 2937054570 215
297 iso_pu_bacteria 2937056579 2937058656 215
298 iso_pu_bacteria 2937063883 2937063932 215
299 iso_pu_bacteria 2937071275 2937077751 215
300 iso_pu_bacteria 2937078374 2937083426 215
301 iso_pu_bacteria 2937084907 2937090925 215
302 iso_pu_bacteria 2937091812 2937094412 215
303 iso_pu_bacteria 2937098957 2937101448 215
304 iso_pu_bacteria 2937106411 2937108034 215
305 iso_pu_bacteria 2937113482 2937115432 215
306 iso_pu_bacteria 2937119839 2937120079 215
307 iso_pu_bacteria 2937126314 2937128206 215
308 iso_pu_bacteria 2941499720 2941506555 215
309 iso_pu_bacteria 2954011201 2954015530 215
310 iso_pu_bacteria 2957375807 2957380910 215
311 iso_pu_bacteria 2957382221 2957382279 215
312 iso_pu_bacteria 2957388812 2957395512 215
313 iso_pu_bacteria 2957395598 2957397990 215
314 iso_pu_bacteria 2957402308 2957404275 215
315 iso_pu_bacteria 2957408893 2957414792 215
316 iso_pu_bacteria 2957415311 2957421126 215
317 iso_pu_bacteria 2957422303 2957429211 215
318 iso_pu_bacteria 2957430029 2957431338 215
319 iso_pu_bacteria 2957437181 2957442646 215
320 iso_pu_bacteria 2957443900 2957446003 215
321 iso_pu_bacteria 2957450854 2957451104 215
322 iso_pu_bacteria 2957457609 2957461737 215
323 iso_pu_bacteria 2957464669 2957465982 215
324 iso_pu_bacteria 2957471148 2957474531 215
325 iso_pu_bacteria 2957478035 2957483302 215
326 iso_pu_bacteria 2957484790 2957487706 215
327 iso_pu_bacteria 2957491536 2957496567 215
328 iso_pu_bacteria 2957498199 2957502005 215
329 iso_pu_bacteria 2957505466 2957505543 215
330 iso_pu_bacteria 2960584000 2960584071 215
331 iso_pu_bacteria 2960591022 2960596310 215
332 iso_pu_bacteria 2960597568 2960603088 215
333 iso_pu_bacteria 2960603979 2960604148 215
334 iso_pu_bacteria 2960610863 2960610952 215
335 iso_pu_bacteria 2960617483 2960622317 215
336 iso_pu_bacteria 2960624210 2960624377 215
337 iso_pu_bacteria 2960631154 2960636758 215
338 iso_pu_bacteria 2960637947 2960637973 215
339 iso_pu_bacteria 2960645483 2960649230 215
340 iso_pu_bacteria 2960652885 2960653288 215
341 iso_pu_bacteria 2960660292 2960663697 215
342 iso_pu_bacteria 2960667422 2960667518 215
343 iso_pu_bacteria 2960674078 2960676571 215
344 iso_pu_bacteria 2960680706 2960685925 215
345 iso_pu_bacteria 2964607997 2964611044 215
346 iso_pu_bacteria 2964615318 2964615473 215
347 iso_pu_bacteria 2964621998 2964628154 215
348 iso_pu_bacteria 2964628898 2964628974 215
349 iso_pu_bacteria 2964636051 2964636080 215
350 iso_pu_bacteria 2964643177 2964643424 215
351 iso_pu_bacteria 2964649959 2964653963 215
352 iso_pu_bacteria 2964656573 2964656676 215
353 iso_pu_bacteria 2964663802 2964664044 215
354 iso_pu_bacteria 2964670856 2964676041 215
355 iso_pu_bacteria 2964678106 2964682331 215
356 iso_pu_bacteria 2964685014 2964690722 215
357 iso_pu_bacteria 2964698721 2964698862 215
358 iso_pu_bacteria 2964705432 2964707576 215
359 iso_pu_bacteria 2964712639 2964717778 215
360 iso_pu_bacteria 2964719344 2964721799 215
361 iso_pu_bacteria 2967664464 2967664516 215
362 iso_pu_bacteria 2967671571 2967672451 215
363 iso_pu_bacteria 2967678726 2967683273 215
364 iso_pu_bacteria 2967686174 2967691853 215
365 iso_pu_bacteria 2967693043 2967698563 215
366 iso_pu_bacteria 2967699805 2967706189 215
367 iso_pu_bacteria 2967706974 2967713886 215
368 iso_pu_bacteria 2967714385 2967718636 215
369 iso_pu_bacteria 2967721400 2967723149 215
370 iso_pu_bacteria 2967728569 2967734007 215
371 iso_pu_bacteria 2967735183 2967737456 215
372 iso_pu_bacteria 2967742019 2967748061 215
373 iso_pu_bacteria 2967748971 2967749220 215
374 iso_pu_bacteria 2967755722 2967755972 215
375 iso_pu_bacteria 2967762386 2967762525 215
376 iso_pu_bacteria 2967769361 2967769411 215
377 iso_pu_bacteria 2967775926 2967778390 215
378 iso_pu_bacteria 2970019648 2970019706 215
379 iso_pu_bacteria 2970026789 2970027020 215
380 iso_pu_bacteria 2970033650 2970033899 215
381 iso_pu_bacteria 2970040964 2970044080 215
382 iso_pu_bacteria 2970047711 2970051044 215
383 iso_pu_bacteria 2970054988 2970058373 215
384 iso_pu_bacteria 2970061556 2970065187 215
385 iso_pu_bacteria 2970068827 2970075862 215
386 iso_pu_bacteria 2970076120 2970077967 215
387 iso_pu_bacteria 2970082768 2970084507 215
388 iso_pu_bacteria 2970088815 2970091864 215
389 iso_pu_bacteria 2970095765 2970097712 215
390 iso_pu_bacteria 2970102677 2970102927 215
391 iso_pu_bacteria 2970109326 2970111380 215
392 iso_pu_bacteria 2970116247 2970119012 215
393 iso_pu_bacteria 2970122695 2970129304 215
394 iso_pu_bacteria 2970129317 2970135374 215
395 iso_pu_bacteria 2970136068 2970143505 215
396 iso_pu_bacteria 2970143518 2970149646 215
397 iso_pu_bacteria 2970149975 2970152173 215
398 iso_pu_bacteria 2970156795 2970160104 215
399 iso_pu_bacteria 2970164137 2970164812 215
400 iso_pu_bacteria 2970170962 2970171228 215
401 iso_pu_bacteria 2970177841 2970179975 215
402 iso_pu_bacteria 2970184632 2970191439 215
403 iso_pu_bacteria 2970191845 2970195066 215
404 iso_pu_bacteria 2977516862 2977521737 215
405 iso_pu_bacteria 2977523885 2977525826 215
406 iso_pu_bacteria 2977530762 2977536635 215
407 iso_pu_bacteria 2977537788 2977539881 215
408 iso_pu_bacteria 2977544691 2977550996 215
409 iso_pu_bacteria 2977551784 2977556199 215
410 iso_pu_bacteria 2977558990 2977559106 215
411 iso_pu_bacteria 2977565890 2977566036 215
412 iso_pu_bacteria 2977572785 2977574547 215
413 iso_pu_bacteria 2977579622 2977584985 215
414 iso_pu_bacteria 2989349275 2989353594 215
415 iso_pu_bacteria 2989771324 2989774823 215
416 iso_pu_bacteria 2996310559 2996312236 215
417 iso_pu_bacteria 643692032 643824179 215
418 iso_pu_bacteria 648276728 648735473 215
419 iso_pu_bacteria 8003992118 8003996985 215
420 iso_pu_bacteria 8003999396 8004004684 215
421 iso_pu_bacteria 8005275841 8005277647 215
422 iso_pu_bacteria 8005282627 8005288498 215
423 iso_pu_bacteria 8005289223 8005290490 215
424 iso_pu_bacteria 8005301065 8005301091 215
425 iso_pu_bacteria 8005307578 8005308009 215
426 iso_pu_bacteria 8005376324 8005379730 215
427 iso_pu_bacteria 8005430974 8005431416 215
428 iso_pu_bacteria 8005460587 8005467117 215
429 iso_pu_bacteria 8005570704 8005571603 215
430 iso_pu_bacteria 8005619151 8005624064 215
431 iso_pu_bacteria 8005626139 8005629329 215
432 iso_pu_bacteria 8005688590 8005689095 215
433 iso_pu_bacteria 8005695170 8005697820 215
434 iso_pu_bacteria 8018127388 8018132116 215
435 iso_pu_bacteria 8018176218 8018180514 215
436 iso_pu_bacteria 8023680758 8023681826 215
437 iso_pu_bacteria 8024479707 8024482326 215
438 iso_pu_bacteria 8024501048 8024507262 215
439 iso_pu_bacteria 8049293176 8049297279 215
440 iso_pu_bacteria 8054472261 8054475043 215
441 iso_pu_bacteria 8056375014 8056377879 215
442 iso_pu_bacteria 8056382006 8056382545 215
443 iso_pu_bacteria 8057874678 8057878177 215
444 3300041411 Ga0439466_0100521 Ga0439466_0100521_107_868 216
445 3300049585 Ga0501069_0109020 Ga0501069_0109020_536_1189 216
446 iso_pu_bacteria 2582581306 2585268573 216
447 iso_pu_bacteria 2863067949 2863070863 216
448 3300006051 Ga0075364_10006271 Ga0075364_100062718 217
449 3300048914 Ga0496111_0320724 Ga0496111_0320724_113_784 217
450 3300048919 Ga0496116_0098478 Ga0496116_0098478_196_867 217
451 3300048919 Ga0496116_0157969 Ga0496116_0157969_554_1225 217
452 3300048923 Ga0496120_0005138 Ga0496120_0005138_1002_1673 217
453 3300048924 Ga0496121_0000174 Ga0496121_0000174_65589_66260 217
454 3300048925 Ga0496122_0284068 Ga0496122_0284068_113_784 217
455 3300048926 Ga0496123_0065207 Ga0496123_0065207_1403_2074 217
456 3300048927 Ga0496124_0059283 Ga0496124_0059283_2480_3151 217
457 3300048928 Ga0496125_0000093 Ga0496125_0000093_182125_182796 217
458 3300048928 Ga0496125_0000292 Ga0496125_0000292_10729_11400 217
459 3300048929 Ga0496126_0503450 Ga0496126_0503450_24_695 217
460 3300050491 nmdc:mga00v17_15855_c1 nmdc:mga00v17_15855_c1_272_943 217
461 iso_pu_bacteria 639633055 639644821 217
462 3300049571 Ga0501034_0006800 Ga0501034_0006800_5650_6309 218
463 iso_pu_bacteria 2870782633 2870783843 218
464 3300003187 JGI25151J46595_10005696 JGI25151J46595_100056964 219
465 3300003320 rootH2_10039980 rootH2_100399803 219
466 3300003323 rootH1_10044850 rootH1_100448502 219
467 3300003354 JGI25160J50197_1001143 JGI25160J50197_10011435 219
468 3300003374 JGI25161J50226_1007798 JGI25161J50226_10077983 219
469 3300003771 Ga0055526_1002351 Ga0055526_10023517 219
470 3300003771 Ga0055526_1046410 Ga0055526_10464101 219
471 3300003775 Ga0055524_1000517 Ga0055524_100051712 219
472 3300003775 Ga0055524_1002854 Ga0055524_10028548 219
473 3300003775 Ga0055524_1007706 Ga0055524_10077064 219
474 3300003790 Ga0055528_1000982 Ga0055528_10009824 219
475 3300003790 Ga0055528_1013213 Ga0055528_10132132 219
476 3300003792 Ga0055540_1000096 Ga0055540_100009680 219
477 3300003792 Ga0055540_1004097 Ga0055540_10040977 219
478 3300003792 Ga0055540_1007276 Ga0055540_10072762 219
479 3300003794 Ga0055531_10053546 Ga0055531_100535461 219
480 3300005262 Ga0065165_1005520 Ga0065165_10055205 219
481 3300005289 Ga0065704_10194511 Ga0065704_101945112 219
482 3300005841 Ga0068863_100001682 Ga0068863_1000016825 219
483 3300005983 Ga0081540_1000664 Ga0081540_100066412 219
484 3300006038 Ga0075365_10000808 Ga0075365_1000080810 219
485 3300006042 Ga0075368_10041594 Ga0075368_100415941 219
486 3300006051 Ga0075364_10009352 Ga0075364_100093525 219
487 3300006051 Ga0075364_10140890 Ga0075364_101408902 219
488 3300006177 Ga0075362_10002642 Ga0075362_100026422 219
489 3300006195 Ga0075366_10001529 Ga0075366_100015298 219
490 3300006353 Ga0075370_10003493 Ga0075370_100034935 219
491 3300009101 Ga0105247_10057365 Ga0105247_100573652 219
492 3300009766 Ga0123342_1024877 Ga0123342_10248774 219
493 3300010375 Ga0105239_11428250 Ga0105239_114282501 219
494 3300012513 Ga0157326_1008495 Ga0157326_10084951 219
495 3300013249 Ga0171463_1012 Ga0171463_101288 219
496 3300014968 Ga0157379_10041012 Ga0157379_100410123 219
497 3300015690 Ga0183363_1193 Ga0183363_11939 219
498 3300021320 Ga0214544_1000018 Ga0214544_100001810 219
499 3300021321 Ga0214542_1001937 Ga0214542_100193726 219
500 3300021321 Ga0214542_1024565 Ga0214542_10245653 219
501 3300021321 Ga0214542_1037892 Ga0214542_10378922 219
502 3300021327 Ga0214543_1000012 Ga0214543_100001263 219
503 3300021327 Ga0214543_1000042 Ga0214543_100004219 219
504 3300021327 Ga0214543_1000162 Ga0214543_100016211 219
505 3300025273 Ga0209673_1000105 Ga0209673_100010561 219
506 3300025273 Ga0209673_1002092 Ga0209673_10020929 219
507 3300025284 Ga0209130_1013856 Ga0209130_10138562 219
508 3300025295 Ga0209564_1000913 Ga0209564_100091329 219
509 3300025295 Ga0209564_1001922 Ga0209564_10019229 219
510 3300025295 Ga0209564_1032182 Ga0209564_10321822 219
511 3300025297 Ga0209758_1000380 Ga0209758_100038058 219
512 3300025298 Ga0209050_1003406 Ga0209050_10034063 219
513 3300025299 Ga0209256_1000260 Ga0209256_100026022 219
514 3300025299 Ga0209256_1000281 Ga0209256_100028164 219
515 3300025299 Ga0209256_1001129 Ga0209256_100112911 219
516 3300025299 Ga0209256_1002297 Ga0209256_10022978 219
517 3300025302 Ga0207426_1000350 Ga0207426_100035011 219
518 3300025303 Ga0209051_1000027 Ga0209051_100002783 219
519 3300025303 Ga0209051_1001030 Ga0209051_100103010 219
520 3300025303 Ga0209051_1023350 Ga0209051_10233503 219
521 3300025304 Ga0209257_1001771 Ga0209257_10017712 219
522 3300025304 Ga0209257_1011780 Ga0209257_10117803 219
523 3300026088 Ga0207641_10004926 Ga0207641_100049269 219
524 3300027111 Ga0209281_1000655 Ga0209281_100065513 219
525 3300028379 Ga0268266_10436754 Ga0268266_104367542 219
526 3300028794 Ga0307515_10000121 Ga0307515_1000012156 219
527 3300028794 Ga0307515_10070741 Ga0307515_100707414 219
528 3300028794 Ga0307515_10202033 Ga0307515_102020333 219
529 3300031456 Ga0307513_10024415 Ga0307513_100244154 219
530 3300031456 Ga0307513_10488593 Ga0307513_104885932 219
531 3300031731 Ga0307405_10313770 Ga0307405_103137702 219
532 3300031901 Ga0307406_10101787 Ga0307406_101017872 219
533 3300032002 Ga0307416_100237577 Ga0307416_1002375773 219
534 3300032004 Ga0307414_10310820 Ga0307414_103108202 219
535 3300039062 Ga0400483_182281 Ga0400483_182281_696_1355 219
536 3300041404 Ga0439436_0025457 Ga0439436_0025457_578_1237 219
537 3300041406 Ga0439439_0034147 Ga0439439_0034147_529_1188 219
538 3300041413 Ga0439465_0003152 Ga0439465_0003152_4199_4858 219
539 3300041413 Ga0439465_0024355 Ga0439465_0024355_677_1336 219
540 3300041492 Ga0451835_1258197 Ga0451835_1258197_52_711 219
541 3300041498 Ga0451841_0078269 Ga0451841_0078269_425_1084 219
542 3300041507 Ga0451851_0389910 Ga0451851_0389910_15_674 219
543 3300041512 Ga0451853_2152199 Ga0451853_2152199_501_1160 219
544 3300042007 Ga0439449_0065659 Ga0439449_0065659_359_1018 219
545 3300042146 Ga0450907_014384 Ga0450907_014384_264_923 219
546 3300042435 Ga0439434_0148717 Ga0439434_0148717_39_698 219
547 3300045836 Ga0466958_0128555 Ga0466958_0128555_96_767 219
548 3300045976 Ga0466967_0226497 Ga0466967_0226497_303_974 219
549 3300046452 Ga0495617_018024 Ga0495617_018024_66_725 219
550 3300046454 Ga0495592_0000229 Ga0495592_0000229_30723_31382 219
551 3300046457 Ga0495590_0029931 Ga0495590_0029931_109_768 219
552 3300046458 Ga0495591_000101 Ga0495591_000101_73816_74475 219
553 3300046459 Ga0495629_0000561 Ga0495629_0000561_4758_5417 219
554 3300046460 Ga0495638_0000163 Ga0495638_0000163_24257_24916 219
555 3300046460 Ga0495638_0008099 Ga0495638_0008099_2594_3253 219
556 3300046460 Ga0495638_0013770 Ga0495638_0013770_381_1040 219
557 3300046460 Ga0495638_0023236 Ga0495638_0023236_2114_2773 219
558 3300046460 Ga0495638_0277412 Ga0495638_0277412_228_887 219
559 3300046461 Ga0495641_0133854 Ga0495641_0133854_426_1085 219
560 3300046462 Ga0495651_0000730 Ga0495651_0000730_18542_19201 219
561 3300046463 Ga0495653_0009573 Ga0495653_0009573_2308_2967 219
562 3300046472 Ga0495580_0000681 Ga0495580_0000681_11285_11944 219
563 3300046474 Ga0495605_0012887 Ga0495605_0012887_3232_3891 219
564 3300046476 Ga0495662_0018963 Ga0495662_0018963_2134_2793 219
565 3300046477 Ga0495664_0021184 Ga0495664_0021184_1248_1907 219
566 3300046492 Ga0495585_0015817 Ga0495585_0015817_1041_1700 219
567 3300046492 Ga0495585_0154128 Ga0495585_0154128_83_742 219
568 3300046500 Ga0495596_0000146 Ga0495596_0000146_23148_23807 219
569 3300046506 Ga0495583_0000449 Ga0495583_0000449_20691_21350 219
570 3300046506 Ga0495583_0064561 Ga0495583_0064561_854_1513 219
571 3300046506 Ga0495583_0066549 Ga0495583_0066549_473_1132 219
572 3300046507 Ga0495606_0002598 Ga0495606_0002598_3483_4142 219
573 3300046511 Ga0495608_0000241 Ga0495608_0000241_9883_10542 219
574 3300046513 Ga0495616_0038823 Ga0495616_0038823_752_1411 219
575 3300046514 Ga0495618_0001966 Ga0495618_0001966_4996_5655 219
576 3300046515 Ga0495620_0064666 Ga0495620_0064666_833_1492 219
577 3300046516 Ga0495628_0005725 Ga0495628_0005725_7787_8446 219
578 3300046517 Ga0495630_0000147 Ga0495630_0000147_28971_29630 219
579 3300046518 Ga0495631_0010810 Ga0495631_0010810_2971_3630 219
580 3300046519 Ga0495632_0007429 Ga0495632_0007429_634_1293 219
581 3300046524 Ga0495648_0000164 Ga0495648_0000164_52969_53628 219
582 3300046524 Ga0495648_0013155 Ga0495648_0013155_3497_4156 219
583 3300046524 Ga0495648_0016222 Ga0495648_0016222_2202_2861 219
584 3300046526 Ga0495666_0000107 Ga0495666_0000107_13346_14005 219
585 3300046529 Ga0495652_0006343 Ga0495652_0006343_7915_8574 219
586 3300046530 Ga0495654_0000553 Ga0495654_0000553_10340_10999 219
587 3300046531 Ga0495665_0000827 Ga0495665_0000827_5766_6425 219
588 3300046533 Ga0495640_0000282 Ga0495640_0000282_25197_25856 219
589 3300046535 Ga0495586_0012956 Ga0495586_0012956_116_775 219
590 3300046536 Ga0495587_0002606 Ga0495587_0002606_6607_7266 219
591 3300046538 Ga0495609_0015374 Ga0495609_0015374_1864_2523 219
592 3300046542 Ga0495597_0032186 Ga0495597_0032186_1579_2238 219
593 3300046559 Ga0495667_0016834 Ga0495667_0016834_984_1643 219
594 3300046615 Ga0495656_0139403 Ga0495656_0139403_426_1085 219
595 3300046616 Ga0495668_0004281 Ga0495668_0004281_5820_6479 219
596 3300046616 Ga0495668_0146819 Ga0495668_0146819_494_1153 219
597 3300046642 Ga0495634_0001199 Ga0495634_0001199_2150_2809 219
598 3300046648 Ga0495611_0014527 Ga0495611_0014527_1001_1660 219
599 3300046660 Ga0495625_0008338 Ga0495625_0008338_6219_6878 219
600 3300046660 Ga0495625_0038721 Ga0495625_0038721_831_1490 219
601 3300046660 Ga0495625_0154478 Ga0495625_0154478_105_764 219
602 3300046663 Ga0495635_0000218 Ga0495635_0000218_28242_28901 219
603 3300046665 Ga0495661_0000818 Ga0495661_0000818_4669_5328 219
604 3300046678 Ga0495599_0001820 Ga0495599_0001820_6741_7400 219
605 3300046679 Ga0495623_0000895 Ga0495623_0000895_7877_8536 219
606 3300046680 Ga0495646_0000372 Ga0495646_0000372_5024_5683 219
607 3300046689 Ga0495613_0000353 Ga0495613_0000353_25117_25776 219
608 3300046690 Ga0495624_0000869 Ga0495624_0000869_292_951 219
609 3300046692 Ga0495671_0009578 Ga0495671_0009578_3410_4069 219
610 3300046694 Ga0495649_0000211 Ga0495649_0000211_29969_30628 219
611 3300046694 Ga0495649_0021376 Ga0495649_0021376_714_1373 219
612 3300046794 Ga0495589_0000213 Ga0495589_0000213_22818_23477 219
613 3300046809 Ga0495600_0004656 Ga0495600_0004656_1866_2525 219
614 3300046810 Ga0495660_0050092 Ga0495660_0050092_580_1239 219
615 3300047315 Ga0495581_0021845 Ga0495581_0021845_815_1474 219
616 3300047317 Ga0495604_0004103 Ga0495604_0004103_2150_2809 219
617 3300047319 Ga0495674_0032747 Ga0495674_0032747_292_951 219
618 3300047320 Ga0495672_0001856 Ga0495672_0001856_15903_16562 219
619 3300047320 Ga0495672_0034279 Ga0495672_0034279_1021_1680 219
620 3300047321 Ga0495676_0016763 Ga0495676_0016763_165_824 219
621 3300047322 Ga0495680_0026038 Ga0495680_0026038_420_1079 219
622 3300047323 Ga0495683_0000435 Ga0495683_0000435_6711_7370 219
623 3300047323 Ga0495683_0029434 Ga0495683_0029434_1518_2177 219
624 3300047323 Ga0495683_0128221 Ga0495683_0128221_298_957 219
625 3300047444 Ga0495675_0000151 Ga0495675_0000151_23116_23775 219
626 3300047446 Ga0495679_000093 Ga0495679_000093_25942_26601 219
627 3300047469 Ga0495673_0002198 Ga0495673_0002198_5570_6229 219
628 3300047469 Ga0495673_0002375 Ga0495673_0002375_5799_6458 219
629 3300047673 Ga0495593_0000123 Ga0495593_0000123_11762_12421 219
630 3300048088 Ga0495602_0006996 Ga0495602_0006996_3761_4420 219
631 3300048089 Ga0495614_0000139 Ga0495614_0000139_330_989 219
632 3300048091 Ga0495626_0000623 Ga0495626_0000623_19186_19845 219
633 3300048091 Ga0495626_0091521 Ga0495626_0091521_282_941 219
634 3300048903 Ga0496100_0011869 Ga0496100_0011869_4111_4806 219
635 3300048904 Ga0496101_0001230 Ga0496101_0001230_7578_8273 219
636 3300048905 Ga0496102_0000030 Ga0496102_0000030_148427_149122 219
637 3300048906 Ga0496103_0000068 Ga0496103_0000068_84988_85683 219
638 3300048907 Ga0496104_0142888 Ga0496104_0142888_481_1176 219
639 3300048908 Ga0496105_0023939 Ga0496105_0023939_2774_3469 219
640 3300048910 Ga0496107_0352649 Ga0496107_0352649_73_768 219
641 3300048912 Ga0496109_0213226 Ga0496109_0213226_1013_1708 219
642 3300048919 Ga0496116_0000152 Ga0496116_0000152_78041_78736 219
643 3300048920 Ga0496117_0000059 Ga0496117_0000059_187330_188025 219
644 3300048921 Ga0496118_0000061 Ga0496118_0000061_148045_148740 219
645 3300048922 Ga0496119_0000431 Ga0496119_0000431_38247_38942 219
646 3300048923 Ga0496120_0020033 Ga0496120_0020033_1695_2390 219
647 3300048924 Ga0496121_0007649 Ga0496121_0007649_6057_6752 219
648 3300048925 Ga0496122_0047492 Ga0496122_0047492_186_845 219
649 3300048927 Ga0496124_0027824 Ga0496124_0027824_2716_3411 219
650 3300048928 Ga0496125_0124168 Ga0496125_0124168_826_1521 219
651 3300048929 Ga0496126_0000213 Ga0496126_0000213_55455_56150 219
652 3300049459 Ga0495678_021209 Ga0495678_021209_447_1106 219
653 3300049460 Ga0495682_0000499 Ga0495682_0000499_5814_6473 219
654 3300049460 Ga0495682_0002037 Ga0495682_0002037_3535_4194 219
655 3300049460 Ga0495682_0041118 Ga0495682_0041118_819_1478 219
656 3300049570 Ga0501033_0119062 Ga0501033_0119062_54_713 219
657 3300049571 Ga0501034_0196729 Ga0501034_0196729_732_1391 219
658 3300049572 Ga0501036_0161103 Ga0501036_0161103_1039_1698 219
659 3300049574 Ga0501038_0140136 Ga0501038_0140136_907_1566 219
660 3300049579 Ga0501043_0048042 Ga0501043_0048042_1965_2624 219
661 3300049652 Ga0501202_070714 Ga0501202_070714_70_729 219
662 3300050489 nmdc:mga03683_2599_c1 nmdc:mga03683_2599_c1_3203_3862 219
663 3300050491 nmdc:mga00v17_238387_c1 nmdc:mga00v17_238387_c1_189_848 219
664 3300050491 nmdc:mga00v17_4957_c1 nmdc:mga00v17_4957_c1_2529_3188 219
665 3300050492 nmdc:mga0yw44_40411_c1 nmdc:mga0yw44_40411_c1_94_753 219
666 3300050493 nmdc:mga0k408_15225_c1 nmdc:mga0k408_15225_c1_2282_2941 219
667 3300050493 nmdc:mga0k408_460092_c1 nmdc:mga0k408_460092_c1_69_728 219
668 3300050496 nmdc:mga07m45_5702_c1 nmdc:mga07m45_5702_c1_912_1571 219
669 3300050516 nmdc:mga0sz30_7116_c2 nmdc:mga0sz30_7116_c2_2493_3152 219
670 3300053086 Ga0500578_0451004 Ga0500578_0451004_22_681 219
671 3300053109 Ga0500569_030380 Ga0500569_030380_721_1380 219
672 3300053118 Ga0500594_0001612 Ga0500594_0001612_1074_1733 219
673 3300053118 Ga0500594_0132027 Ga0500594_0132027_55_714 219
674 3300053134 Ga0500658_0000932 Ga0500658_0000932_4146_4805 219
675 3300053139 Ga0500568_0000210 Ga0500568_0000210_20586_21245 219
676 3300053142 Ga0500577_0091198 Ga0500577_0091198_520_1179 219
677 3300053153 Ga0500616_0002480 Ga0500616_0002480_637_1296 219
678 iso_pu_bacteria 2508501122 2509110661 219
679 iso_pu_bacteria 2509276019 2509377482 219
680 iso_pu_bacteria 2558860100 2558865016 219
681 iso_pu_bacteria 2721755556 2723029999 219
682 iso_pu_bacteria 2721755684 2723564404 219
683 iso_pu_bacteria 2728369352 2730110532 219
684 iso_pu_bacteria 2850079185 2850084734 219
685 iso_pu_bacteria 2904578770 2904583167 219
686 iso_pu_bacteria 2919119836 2919123816 219
687 iso_pu_bacteria 8005497431 8005502913 219
688 iso_pu_bacteria 8005668836 8005674343 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

216

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8844 4 208
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8468 4 208
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8264 10 209
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.8113 10 201
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8112 8 209
ID Description Score Start End Superfamily
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9495 78 209 1.10.3720.10
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9365 7 209 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9297 6 210 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9286 6 212 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9225 11 210 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A853ACP7-F1-model_v4 Polar amino acid transport system permease protein 0.9799 6 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A7G9NUD2-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuC 0.9756 7 215 GO:0006865
GO:0022857
GO:0043190
AF-A0A5C5V8I1-F1-model_v4 Inner membrane amino-acid ABC transporter permease protein YecS 0.9744 8 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A7U9KXX8-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuC 0.9742 6 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A7W4JQA3-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuC 0.974 1 210 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
87.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map