F475168

General Info

Members Datasets Scaffolds Average Seq Length
686 233 686 237

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100494182|Ga0070661_1004941822
Length 249
Sequence MNDKPLFGKLALVTGASRGIGAATAEALAKAGAHVILVARSSAALEEIEERIHQAGGSATIAPLDLTEGEGVGKLAAAVAARWEKLDILMLNAAMLGSLSPVQDIDAKEYARLLTLNVSANQALIAAFDPMLRKAQGDVVAVTSSVGHVPRAFWGAYGSSKAALENLLLTYADETQTVGKIRVHVIDPGATRTRMRALAFPGEEPEDVKPPEVVAGFILERLLSDAPTGEMVRVNGRGLRSDASSDTTT

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
159 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 4.08
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005791 3300001904 Bacteria 2087
2 JGI24740J21852_10019537 3300001979 Bacteria 2385
3 JGI24739J22299_10003131 3300001989 Bacteria 6310
4 JGI24737J22298_10004000 3300001990 Bacteria 5158
5 JGI24737J22298_10021171 3300001990 Bacteria 2074
6 JGI24737J22298_10054431 3300001990 Bacteria 1211
7 JGI24743J22301_10017318 3300001991 Bacteria 1352
8 JGI24738J21930_10001952 3300002075 Bacteria 5560
9 JGI25150J39212_1000285 3300002774 Bacteria 26336
10 JGI25153J46596_10000044 3300003215 Bacteria 154263
11 Ga0055525_1000051 3300003759 Bacteria 240942
12 Ga0055536_1035025 3300003781 Bacteria 1261
13 Ga0055530_10012785 3300003791 Bacteria 2906
14 Ga0055530_10027885 3300003791 Bacteria 1534
15 Ga0055540_1004324 3300003792 Bacteria 6462
16 Ga0055531_10032146 3300003794 Bacteria 1720
17 Ga0055531_10033121 3300003794 Bacteria 1671
18 Ga0065715_10104714 3300005293 Bacteria 2905
19 Ga0070658_10000379 3300005327 Bacteria 38762
20 Ga0070658_10000850 3300005327 Bacteria 26066
21 Ga0070658_10017653 3300005327 Bacteria 5708
22 Ga0070658_10060472 3300005327 Bacteria 3085
23 Ga0070658_10202894 3300005327 Bacteria 1673
24 Ga0070658_10292838 3300005327 Bacteria 1387
25 Ga0070658_10471029 3300005327 Bacteria 1083
26 Ga0070658_10473420 3300005327 Bacteria 1080
27 Ga0070676_10033934 3300005328 Bacteria 2928
28 Ga0070676_10081352 3300005328 Bacteria 1966
29 Ga0070683_100001218 3300005329 Bacteria 19546
30 Ga0070683_100014840 3300005329 Bacteria 6829
31 Ga0070683_100146333 3300005329 Bacteria 2239
32 Ga0070683_100369281 3300005329 Bacteria 1367
33 Ga0070683_100370875 3300005329 Bacteria 1363
34 Ga0070690_100018174 3300005330 Bacteria 4241
35 Ga0070670_100015317 3300005331 Bacteria 6585
36 Ga0070670_100232323 3300005331 Bacteria 1605
37 Ga0070670_100233788 3300005331 Bacteria 1600
38 Ga0070670_100322921 3300005331 Bacteria 1353
39 Ga0070670_100353881 3300005331 Bacteria 1290
40 Ga0070677_10055072 3300005333 Bacteria 1622
41 Ga0070666_10000555 3300005335 Bacteria 22543
42 Ga0070666_10000788 3300005335 Bacteria 19216
43 Ga0070666_10003797 3300005335 Bacteria 9162
44 Ga0070666_10134273 3300005335 Bacteria 1721
45 Ga0070680_100000600 3300005336 Bacteria 24915
46 Ga0070680_100191965 3300005336 Bacteria 1721
47 Ga0070680_100235000 3300005336 Bacteria 1548
48 Ga0070680_100238700 3300005336 Bacteria 1536
49 Ga0070680_100633744 3300005336 Bacteria 918
50 Ga0068868_100000211 3300005338 Bacteria 39269
51 Ga0068868_100011949 3300005338 Bacteria 6334
52 Ga0070660_100001859 3300005339 Bacteria 14533
53 Ga0070660_100002066 3300005339 Bacteria 13865
54 Ga0070660_100014573 3300005339 Bacteria 5670
55 Ga0070660_100031328 3300005339 Bacteria 3993
56 Ga0070660_100033386 3300005339 Bacteria 3880
57 Ga0070660_100037874 3300005339 Bacteria 3657
58 Ga0070660_100064368 3300005339 Bacteria 2852
59 Ga0070660_100074313 3300005339 Bacteria 2659
60 Ga0070660_100077617 3300005339 Bacteria 2603
61 Ga0070660_100188524 3300005339 Bacteria 1670
62 Ga0070660_100306520 3300005339 Bacteria 1303
63 Ga0070660_100402887 3300005339 Bacteria 1131
64 Ga0070660_100533921 3300005339 Bacteria 978
65 Ga0070689_100079995 3300005340 Bacteria 2565
66 Ga0070687_100048833 3300005343 Bacteria 2178
67 Ga0070661_100011344 3300005344 Bacteria 6210
68 Ga0070661_100333617 3300005344 Bacteria 1186
69 Ga0070661_100494182 3300005344 Bacteria 979
70 Ga0070661_100600262 3300005344 Bacteria 890
71 Ga0070661_100665251 3300005344 Bacteria 846
72 Ga0070692_10013735 3300005345 Bacteria 3783
73 Ga0070692_10042744 3300005345 Bacteria 2328
74 Ga0070668_100084106 3300005347 Bacteria 2499
75 Ga0070668_100448989 3300005347 Bacteria 1108
76 Ga0070668_100692893 3300005347 Bacteria 898
77 Ga0070669_100036110 3300005353 Bacteria 3580
78 Ga0070669_100036391 3300005353 Bacteria 3567
79 Ga0070669_100047337 3300005353 Bacteria 3137
80 Ga0070675_100017003 3300005354 Bacteria 5779
81 Ga0070675_100093783 3300005354 Bacteria 2518
82 Ga0070675_100138612 3300005354 Bacteria 2078
83 Ga0070671_100008209 3300005355 Bacteria 8356
84 Ga0070671_100011218 3300005355 Bacteria 7196
85 Ga0070671_100036176 3300005355 Bacteria 4093
86 Ga0070671_100101520 3300005355 Bacteria 2414
87 Ga0070674_100000748 3300005356 Bacteria 16655
88 Ga0070674_100033523 3300005356 Bacteria 3420
89 Ga0070674_100069808 3300005356 Bacteria 2480
90 Ga0070674_100134949 3300005356 Bacteria 1845
91 Ga0070673_100007938 3300005364 Bacteria 7036
92 Ga0070673_100044036 3300005364 Bacteria 3453
93 Ga0070673_100123390 3300005364 Bacteria 2164
94 Ga0070673_100282530 3300005364 Bacteria 1456
95 Ga0070673_100548490 3300005364 Bacteria 1050
96 Ga0070659_100024266 3300005366 Bacteria 4648
97 Ga0070659_100057384 3300005366 Bacteria 3070
98 Ga0070659_100078933 3300005366 Bacteria 2627
99 Ga0070659_100080262 3300005366 Bacteria 2604
100 Ga0070659_100087124 3300005366 Bacteria 2500
101 Ga0070659_100188514 3300005366 Bacteria 1694
102 Ga0070667_100001014 3300005367 Bacteria 25719
103 Ga0070667_100003689 3300005367 Bacteria 13031
104 Ga0070667_100005056 3300005367 Bacteria 11037
105 Ga0070667_100018198 3300005367 Bacteria 5825
106 Ga0070667_100613747 3300005367 Bacteria 1003
107 Ga0070713_100014792 3300005436 Bacteria 5807
108 Ga0070713_100238374 3300005436 Bacteria 1656
109 Ga0070663_100001179 3300005455 Bacteria 14386
110 Ga0070663_100020888 3300005455 Bacteria 4342
111 Ga0070663_100272338 3300005455 Bacteria 1346
112 Ga0070663_100443191 3300005455 Bacteria 1069
113 Ga0070663_100549921 3300005455 Bacteria 965
114 Ga0070678_100065818 3300005456 Bacteria 2692
115 Ga0070678_100196689 3300005456 Bacteria 1661
116 Ga0070662_100004894 3300005457 Bacteria 8502
117 Ga0070662_100008268 3300005457 Bacteria 6777
118 Ga0070662_100009507 3300005457 Bacteria 6359
119 Ga0070662_100021117 3300005457 Bacteria 4443
120 Ga0070662_100153785 3300005457 Bacteria 1794
121 Ga0070662_100219374 3300005457 Bacteria 1517
122 Ga0070681_10103530 3300005458 Bacteria 2791
123 Ga0068867_100145558 3300005459 Bacteria 1856
124 Ga0068867_100203179 3300005459 Bacteria 1587
125 Ga0070679_100075000 3300005530 Bacteria 3373
126 Ga0070679_100111295 3300005530 Bacteria 2724
127 Ga0070679_100129217 3300005530 Bacteria 2508
128 Ga0070684_100648527 3300005535 Bacteria 983
129 Ga0068853_100018513 3300005539 Bacteria 5767
130 Ga0070672_100010078 3300005543 Bacteria 6543
131 Ga0070672_100222162 3300005543 Bacteria 1585
132 Ga0070672_100230499 3300005543 Bacteria 1556
133 Ga0070686_100075696 3300005544 Bacteria 2214
134 Ga0070665_100000044 3300005548 Bacteria 276702
135 Ga0070665_100003221 3300005548 Bacteria 17544
136 Ga0070665_100106428 3300005548 Bacteria 2807
137 Ga0070665_100797092 3300005548 Bacteria 958
138 Ga0068855_100000300 3300005563 Bacteria 61687
139 Ga0070664_100006228 3300005564 Bacteria 9635
140 Ga0070664_100008802 3300005564 Bacteria 8178
141 Ga0070664_100082623 3300005564 Bacteria 2770
142 Ga0068857_100021293 3300005577 Bacteria 5708
143 Ga0068857_100025988 3300005577 Bacteria 5157
144 Ga0068854_100000728 3300005578 Bacteria 19507
145 Ga0068854_100277704 3300005578 Bacteria 1347
146 Ga0068856_100004105 3300005614 Bacteria 14555
147 Ga0068856_100028489 3300005614 Bacteria 5454
148 Ga0068856_100030135 3300005614 Bacteria 5303
149 Ga0068856_100066022 3300005614 Bacteria 3575
150 Ga0068856_100135622 3300005614 Bacteria 2466
151 Ga0068856_100145541 3300005614 Unclassified 2377
152 Ga0068856_100252822 3300005614 Bacteria 1777
153 Ga0068852_100093936 3300005616 Bacteria 2689
154 Ga0068852_100659547 3300005616 Bacteria 1054
155 Ga0068859_100064821 3300005617 Bacteria 3686
156 Ga0068859_100115375 3300005617 Bacteria 2750
157 Ga0068864_100282586 3300005618 Bacteria 1549
158 Ga0068864_100494293 3300005618 Bacteria 1176
159 Ga0068866_10033567 3300005718 Bacteria 2491
160 Ga0068861_100202619 3300005719 Bacteria 1667
161 Ga0068851_10032450 3300005834 Bacteria 2599
162 Ga0068851_10069902 3300005834 Bacteria 1815
163 Ga0068851_10097261 3300005834 Bacteria 1558
164 Ga0068870_10330320 3300005840 Bacteria 972
165 Ga0068863_100161988 3300005841 Bacteria 2143
166 Ga0068863_100166116 3300005841 Bacteria 2116
167 Ga0068858_100004134 3300005842 Bacteria 14284
168 Ga0068858_100101070 3300005842 Bacteria 2689
169 Ga0068860_100206806 3300005843 Bacteria 1904
170 Ga0068862_100056641 3300005844 Bacteria 3359
171 Ga0068862_100186131 3300005844 Bacteria 1866
172 Ga0081539_10023788 3300005985 Bacteria 3999
173 Ga0070717_10002352 3300006028 Bacteria 13323
174 Ga0070717_10311119 3300006028 Bacteria 1402
175 Ga0075369_10062208 3300006186 Bacteria 1630
176 Ga0075366_10011090 3300006195 Bacteria 5078
177 Ga0097621_100036752 3300006237 Bacteria 3919
178 Ga0097621_100048429 3300006237 Bacteria 3448
179 Ga0097621_100186068 3300006237 Bacteria 1796
180 Ga0068871_100026164 3300006358 Bacteria 4550
181 Ga0068865_100017616 3300006881 Bacteria 4597
182 Ga0068865_100039821 3300006881 Bacteria 3189
183 Ga0097620_100064824 3300006931 Bacteria 3686
184 Ga0097620_100115367 3300006931 Bacteria 2750
185 Ga0105240_10008636 3300009093 Bacteria 14555
186 Ga0105240_10109400 3300009093 Bacteria 3347
187 Ga0105240_10207308 3300009093 Bacteria 2293
188 Ga0111539_10259093 3300009094 Bacteria 2025
189 Ga0111539_10583676 3300009094 Bacteria 1302
190 Ga0105245_10135945 3300009098 Bacteria 2310
191 Ga0105243_10000038 3300009148 Bacteria 174351
192 Ga0105243_10040865 3300009148 Bacteria 3625
193 Ga0105243_10078506 3300009148 Bacteria 2688
194 Ga0105242_10003245 3300009176 Bacteria 12685
195 Ga0105248_10000442 3300009177 Bacteria 47089
196 Ga0105248_10003885 3300009177 Bacteria 16517
197 Ga0105248_10042951 3300009177 Bacteria 5069
198 Ga0105248_10184947 3300009177 Bacteria 2348
199 Ga0105248_10452542 3300009177 Bacteria 1447
200 Ga0105237_10734784 3300009545 Bacteria 993
201 Ga0105238_10004331 3300009551 Bacteria 14084
202 Ga0105238_10111619 3300009551 Bacteria 2714
203 Ga0105239_10097099 3300010375 Bacteria 3256
204 Ga0105239_10189608 3300010375 Bacteria 2302
205 Ga0105239_10500934 3300010375 Bacteria 1381
206 Ga0105246_10337381 3300011119 Bacteria 1230
207 Ga0157373_10009132 3300013100 Bacteria 7332
208 Ga0157373_10010212 3300013100 Bacteria 6916
209 Ga0157373_10020611 3300013100 Bacteria 4790
210 Ga0157373_10028202 3300013100 Bacteria 4051
211 Ga0157371_10003905 3300013102 Bacteria 13277
212 Ga0157371_10030406 3300013102 Bacteria 3897
213 Ga0157371_10041019 3300013102 Bacteria 3304
214 Ga0157371_10092407 3300013102 Bacteria 2144
215 Ga0157371_10139705 3300013102 Bacteria 1725
216 Ga0157371_10225805 3300013102 Bacteria 1345
217 Ga0157371_10273084 3300013102 Bacteria 1220
218 Ga0157371_10388972 3300013102 Bacteria 1019
219 Ga0157370_10076239 3300013104 Bacteria 3159
220 Ga0157370_10131571 3300013104 Bacteria 2334
221 Ga0157370_10264547 3300013104 Bacteria 1589
222 Ga0157370_10576355 3300013104 Bacteria 1031
223 Ga0157369_10001743 3300013105 Bacteria 26402
224 Ga0157369_10008003 3300013105 Bacteria 12139
225 Ga0157369_10012108 3300013105 Bacteria 9794
226 Ga0157369_10032646 3300013105 Bacteria 5723
227 Ga0157369_10146486 3300013105 Bacteria 2497
228 Ga0157369_10268978 3300013105 Bacteria 1777
229 Ga0157374_10003127 3300013296 Bacteria 13908
230 Ga0157374_10113722 3300013296 Bacteria 2605
231 Ga0157374_10149969 3300013296 Bacteria 2266
232 Ga0157374_10162164 3300013296 Bacteria 2177
233 Ga0157378_10104322 3300013297 Bacteria 2591
234 Ga0157378_10160910 3300013297 Bacteria 2099
235 Ga0157372_10066311 3300013307 Bacteria 4055
236 Ga0157372_10077125 3300013307 Bacteria 3763
237 Ga0157372_10153558 3300013307 Bacteria 2658
238 Ga0157375_10296300 3300013308 Bacteria 1781
239 Ga0157375_10445469 3300013308 Bacteria 1460
240 Ga0163163_10022654 3300014325 Bacteria 5953
241 Ga0163163_10060370 3300014325 Bacteria 3754
242 Ga0157377_10315766 3300014745 Bacteria 1036
243 Ga0157377_10446535 3300014745 Bacteria 892
244 Ga0157379_10095548 3300014968 Bacteria 2667
245 Ga0157379_10690849 3300014968 Bacteria 957
246 Ga0157376_10161811 3300014969 Bacteria 2030
247 Ga0157376_10241116 3300014969 Bacteria 1684
248 Ga0163161_10001335 3300017792 Bacteria 18330
249 Ga0213875_10039040 3300021388 Bacteria 2237
250 Ga0209563_100019 3300025230 Bacteria 697828
251 Ga0207425_1000026 3300025245 Bacteria 301303
252 Ga0209676_1018236 3300025292 Bacteria 2454
253 Ga0209025_1000726 3300025294 Bacteria 55863
254 Ga0209758_1000004 3300025297 Bacteria 1375322
255 Ga0209050_1000001 3300025298 Bacteria 3563507
256 Ga0209050_1005087 3300025298 Bacteria 8478
257 Ga0209051_1000793 3300025303 Bacteria 33269
258 Ga0209051_1016432 3300025303 Bacteria 3348
259 Ga0209257_1000617 3300025304 Bacteria 57694
260 Ga0209257_1000633 3300025304 Bacteria 56365
261 Ga0207697_10074595 3300025315 Bacteria 1425
262 Ga0207656_10033586 3300025321 Bacteria 2138
263 Ga0207682_10004604 3300025893 Bacteria 5741
264 Ga0207682_10047348 3300025893 Bacteria 1770
265 Ga0207680_10001223 3300025903 Bacteria 12131
266 Ga0207680_10001981 3300025903 Bacteria 9583
267 Ga0207680_10138489 3300025903 Bacteria 1611
268 Ga0207680_10284722 3300025903 Bacteria 1149
269 Ga0207647_10005192 3300025904 Bacteria 9581
270 Ga0207647_10026990 3300025904 Bacteria 3748
271 Ga0207647_10107202 3300025904 Bacteria 1653
272 Ga0207645_10015870 3300025907 Bacteria 4990
273 Ga0207645_10026228 3300025907 Bacteria 3766
274 Ga0207645_10077456 3300025907 Bacteria 2130
275 Ga0207645_10080726 3300025907 Bacteria 2085
276 Ga0207643_10312897 3300025908 Bacteria 979
277 Ga0207705_10000060 3300025909 Bacteria 152576
278 Ga0207705_10000429 3300025909 Bacteria 36649
279 Ga0207705_10000779 3300025909 Bacteria 26154
280 Ga0207705_10003393 3300025909 Bacteria 12111
281 Ga0207705_10006538 3300025909 Bacteria 8634
282 Ga0207705_10010399 3300025909 Bacteria 6766
283 Ga0207705_10028693 3300025909 Bacteria 3966
284 Ga0207705_10051177 3300025909 Bacteria 2973
285 Ga0207705_10051439 3300025909 Bacteria 2965
286 Ga0207705_10070261 3300025909 Bacteria 2537
287 Ga0207705_10178370 3300025909 Bacteria 1602
288 Ga0207705_10345107 3300025909 Bacteria 1146
289 Ga0207707_10195711 3300025912 Bacteria 1763
290 Ga0207707_10477744 3300025912 Bacteria 1065
291 Ga0207695_10001996 3300025913 Bacteria 31509
292 Ga0207695_10024085 3300025913 Bacteria 6859
293 Ga0207660_10083358 3300025917 Bacteria 2354
294 Ga0207660_10450550 3300025917 Bacteria 1041
295 Ga0207662_10070400 3300025918 Bacteria 2116
296 Ga0207657_10000631 3300025919 Bacteria 37345
297 Ga0207657_10004219 3300025919 Bacteria 15225
298 Ga0207657_10004392 3300025919 Bacteria 14921
299 Ga0207657_10004601 3300025919 Bacteria 14580
300 Ga0207657_10005022 3300025919 Bacteria 13885
301 Ga0207657_10044515 3300025919 Bacteria 3901
302 Ga0207657_10066869 3300025919 Bacteria 3058
303 Ga0207657_10087648 3300025919 Bacteria 2604
304 Ga0207649_10000702 3300025920 Bacteria 21959
305 Ga0207649_10160693 3300025920 Bacteria 1556
306 Ga0207649_10238501 3300025920 Bacteria 1304
307 Ga0207652_10187523 3300025921 Bacteria 1860
308 Ga0207652_10580523 3300025921 Bacteria 1006
309 Ga0207652_10863604 3300025921 Bacteria 801
310 Ga0207681_10028101 3300025923 Bacteria 3642
311 Ga0207681_10033974 3300025923 Bacteria 3349
312 Ga0207681_10038492 3300025923 Bacteria 3169
313 Ga0207694_10015718 3300025924 Bacteria 5709
314 Ga0207650_10003954 3300025925 Bacteria 10140
315 Ga0207650_10122814 3300025925 Bacteria 2024
316 Ga0207650_10196151 3300025925 Bacteria 1615
317 Ga0207650_10226637 3300025925 Bacteria 1506
318 Ga0207650_10656957 3300025925 Bacteria 884
319 Ga0207659_10009997 3300025926 Bacteria 5944
320 Ga0207659_10070580 3300025926 Bacteria 2548
321 Ga0207659_10291642 3300025926 Bacteria 1337
322 Ga0207700_10006689 3300025928 Bacteria 6994
323 Ga0207644_10000616 3300025931 Bacteria 22668
324 Ga0207644_10003692 3300025931 Bacteria 9927
325 Ga0207644_10060563 3300025931 Bacteria 2739
326 Ga0207644_10106241 3300025931 Bacteria 2116
327 Ga0207644_10150553 3300025931 Bacteria 1800
328 Ga0207644_10311361 3300025931 Bacteria 1271
329 Ga0207690_10076032 3300025932 Bacteria 2330
330 Ga0207690_10095443 3300025932 Bacteria 2112
331 Ga0207690_10120416 3300025932 Bacteria 1905
332 Ga0207690_10120550 3300025932 Bacteria 1904
333 Ga0207690_10297025 3300025932 Bacteria 1263
334 Ga0207690_10329131 3300025932 Bacteria 1203
335 Ga0207690_10389072 3300025932 Bacteria 1110
336 Ga0207706_10000479 3300025933 Bacteria 42802
337 Ga0207706_10002783 3300025933 Bacteria 16997
338 Ga0207706_10038708 3300025933 Bacteria 4230
339 Ga0207706_10040986 3300025933 Bacteria 4105
340 Ga0207706_10045794 3300025933 Bacteria 3874
341 Ga0207706_10066417 3300025933 Bacteria 3174
342 Ga0207706_10153509 3300025933 Bacteria 2025
343 Ga0207706_10250007 3300025933 Bacteria 1549
344 Ga0207706_10257700 3300025933 Bacteria 1523
345 Ga0207706_10456867 3300025933 Bacteria 1104
346 Ga0207709_10000031 3300025935 Bacteria 329046
347 Ga0207709_10011963 3300025935 Bacteria 4784
348 Ga0207669_10002114 3300025937 Bacteria 8422
349 Ga0207669_10032531 3300025937 Bacteria 2930
350 Ga0207669_10034651 3300025937 Bacteria 2863
351 Ga0207669_10053893 3300025937 Bacteria 2426
352 Ga0207704_10013390 3300025938 Bacteria 4102
353 Ga0207704_10457906 3300025938 Bacteria 1019
354 Ga0207691_10008185 3300025940 Bacteria 10041
355 Ga0207691_10015613 3300025940 Bacteria 7219
356 Ga0207691_10171780 3300025940 Bacteria 1898
357 Ga0207711_10000526 3300025941 Bacteria 39259
358 Ga0207711_10002857 3300025941 Bacteria 15139
359 Ga0207711_10308580 3300025941 Bacteria 1460
360 Ga0207661_10015344 3300025944 Bacteria 5635
361 Ga0207661_10476366 3300025944 Bacteria 1139
362 Ga0207679_10004129 3300025945 Bacteria 9019
363 Ga0207679_10028047 3300025945 Bacteria 3902
364 Ga0207679_10148717 3300025945 Bacteria 1903
365 Ga0207679_10485370 3300025945 Bacteria 1101
366 Ga0207667_10000187 3300025949 Bacteria 90766
367 Ga0207667_10047524 3300025949 Bacteria 4542
368 Ga0207667_10230028 3300025949 Bacteria 1899
369 Ga0207667_10441964 3300025949 Bacteria 1322
370 Ga0207651_10001053 3300025960 Bacteria 12220
371 Ga0207651_10109559 3300025960 Bacteria 2069
372 Ga0207651_10434429 3300025960 Bacteria 1123
373 Ga0207668_10217452 3300025972 Bacteria 1532
374 Ga0207668_10533687 3300025972 Bacteria 1014
375 Ga0207640_10000830 3300025981 Bacteria 17599
376 Ga0207640_10021319 3300025981 Bacteria 3861
377 Ga0207658_10001939 3300025986 Bacteria 15445
378 Ga0207658_10017829 3300025986 Bacteria 4892
379 Ga0207658_10046725 3300025986 Bacteria 3163
380 Ga0207658_10101906 3300025986 Bacteria 2251
381 Ga0207658_10105929 3300025986 Bacteria 2212
382 Ga0207677_10001135 3300026023 Bacteria 14530
383 Ga0207677_10001443 3300026023 Bacteria 12627
384 Ga0207703_10002018 3300026035 Bacteria 17909
385 Ga0207703_10002744 3300026035 Bacteria 15084
386 Ga0207639_10149300 3300026041 Bacteria 1956
387 Ga0207678_10002632 3300026067 Bacteria 16348
388 Ga0207678_10003960 3300026067 Bacteria 13321
389 Ga0207678_10016075 3300026067 Bacteria 6571
390 Ga0207678_10138649 3300026067 Bacteria 2076
391 Ga0207678_10365789 3300026067 Bacteria 1245
392 Ga0207702_10022091 3300026078 Bacteria 5271
393 Ga0207702_10150514 3300026078 Bacteria 2116
394 Ga0207641_10084623 3300026088 Bacteria 2761
395 Ga0207641_10111335 3300026088 Bacteria 2427
396 Ga0207641_10195067 3300026088 Bacteria 1863
397 Ga0207648_10005222 3300026089 Bacteria 13134
398 Ga0207648_10671450 3300026089 Bacteria 959
399 Ga0207676_10036937 3300026095 Bacteria 3719
400 Ga0207676_10172957 3300026095 Bacteria 1883
401 Ga0207676_10422001 3300026095 Bacteria 1251
402 Ga0207674_10010957 3300026116 Bacteria 10204
403 Ga0207674_10013241 3300026116 Bacteria 9166
404 Ga0207675_100181159 3300026118 Bacteria 2017
405 Ga0207683_10120822 3300026121 Bacteria 2351
406 Ga0207698_10009005 3300026142 Bacteria 6339
407 Ga0207698_10010670 3300026142 Bacteria 5922
408 Ga0207698_10119154 3300026142 Bacteria 2230
409 Ga0207698_10476135 3300026142 Bacteria 1210
410 Ga0207698_10511774 3300026142 Bacteria 1170
411 Ga0209983_1025505 3300027665 Bacteria 1247
412 Ga0209971_1022315 3300027682 Bacteria 1507
413 Ga0209974_10001664 3300027876 Bacteria 8047
414 Ga0209974_10020793 3300027876 Bacteria 2175
415 Ga0209974_10061469 3300027876 Bacteria 1271
416 Ga0268266_10000002 3300028379 Bacteria 3059047
417 Ga0268266_10007662 3300028379 Bacteria 9706
418 Ga0268266_10076820 3300028379 Bacteria 2903
419 Ga0268266_10428874 3300028379 Bacteria 1254
420 Ga0268265_10020526 3300028380 Bacteria 4611
421 Ga0268265_10026561 3300028380 Bacteria 4121
422 Ga0307517_10022167 3300028786 Bacteria 7973
423 Ga0307517_10022587 3300028786 Bacteria 7876
424 Ga0316183_1201056 3300030742 Bacteria 1577
425 Ga0316182_1043585 3300030745 Bacteria 2309
426 Ga0307408_100005051 3300031548 Bacteria 8852
427 Ga0307408_100018438 3300031548 Bacteria 4685
428 Ga0307408_100058940 3300031548 Bacteria 2793
429 Ga0307408_100072671 3300031548 Bacteria 2547
430 Ga0307408_100083961 3300031548 Bacteria 2387
431 Ga0307408_100650732 3300031548 Bacteria 942
432 Ga0307405_10008142 3300031731 Bacteria 5297
433 Ga0307405_10102656 3300031731 Bacteria 1921
434 Ga0307405_10105492 3300031731 Bacteria 1898
435 Ga0307413_10001109 3300031824 Bacteria 9841
436 Ga0307413_10003856 3300031824 Bacteria 6404
437 Ga0307413_10003892 3300031824 Bacteria 6385
438 Ga0307413_10017918 3300031824 Bacteria 3701
439 Ga0307413_10042672 3300031824 Bacteria 2667
440 Ga0307413_10149107 3300031824 Bacteria 1627
441 Ga0307413_10310922 3300031824 Bacteria 1199
442 Ga0307413_10324467 3300031824 Bacteria 1177
443 Ga0307413_10337151 3300031824 Bacteria 1158
444 Ga0307413_10652382 3300031824 Bacteria 868
445 Ga0307410_10005778 3300031852 Bacteria 6595
446 Ga0307410_10008421 3300031852 Bacteria 5717
447 Ga0307410_10012417 3300031852 Bacteria 4925
448 Ga0307410_10042354 3300031852 Bacteria 3009
449 Ga0307410_10046935 3300031852 Bacteria 2884
450 Ga0307410_10061682 3300031852 Bacteria 2566
451 Ga0307410_10118517 3300031852 Bacteria 1926
452 Ga0307410_10183245 3300031852 Bacteria 1587
453 Ga0307406_10005891 3300031901 Bacteria 6726
454 Ga0307406_10011121 3300031901 Bacteria 5099
455 Ga0307406_10030437 3300031901 Bacteria 3278
456 Ga0307406_10287446 3300031901 Bacteria 1257
457 Ga0307407_10020959 3300031903 Bacteria 3360
458 Ga0307407_10112853 3300031903 Bacteria 1709
459 Ga0307407_10122080 3300031903 Bacteria 1653
460 Ga0307407_10166545 3300031903 Bacteria 1447
461 Ga0307407_10199643 3300031903 Bacteria 1339
462 Ga0307407_10223930 3300031903 Bacteria 1273
463 Ga0307412_10022884 3300031911 Bacteria 3837
464 Ga0307412_10062139 3300031911 Bacteria 2513
465 Ga0307412_10246262 3300031911 Bacteria 1385
466 Ga0307412_10318091 3300031911 Bacteria 1237
467 Ga0307412_10328498 3300031911 Bacteria 1220
468 Ga0307409_100010810 3300031995 Bacteria 5706
469 Ga0307409_100029005 3300031995 Bacteria 3953
470 Ga0307409_100030515 3300031995 Bacteria 3874
471 Ga0307409_100031412 3300031995 Bacteria 3832
472 Ga0307409_100175326 3300031995 Bacteria 1892
473 Ga0307409_100294960 3300031995 Bacteria 1505
474 Ga0307409_100473405 3300031995 Bacteria 1214
475 Ga0307409_100530263 3300031995 Bacteria 1152
476 Ga0307409_100563629 3300031995 Bacteria 1120
477 Ga0307409_100646404 3300031995 Bacteria 1051
478 Ga0307416_100013083 3300032002 Bacteria 5626
479 Ga0307416_100072582 3300032002 Bacteria 2865
480 Ga0307416_100101581 3300032002 Bacteria 2505
481 Ga0307416_100362859 3300032002 Bacteria 1471
482 Ga0307416_100961959 3300032002 Bacteria 956
483 Ga0307414_10014565 3300032004 Bacteria 4720
484 Ga0307414_10018498 3300032004 Bacteria 4292
485 Ga0307414_10024261 3300032004 Bacteria 3865
486 Ga0307414_10032075 3300032004 Bacteria 3455
487 Ga0307414_10051350 3300032004 Bacteria 2862
488 Ga0307414_10057266 3300032004 Bacteria 2739
489 Ga0307414_10105146 3300032004 Bacteria 2134
490 Ga0307414_10114095 3300032004 Bacteria 2064
491 Ga0307414_10270341 3300032004 Bacteria 1423
492 Ga0307411_10001594 3300032005 Bacteria 9418
493 Ga0307411_10006301 3300032005 Bacteria 5924
494 Ga0307411_10012113 3300032005 Bacteria 4687
495 Ga0307411_10049123 3300032005 Bacteria 2739
496 Ga0307411_10061029 3300032005 Bacteria 2507
497 Ga0307411_10131723 3300032005 Bacteria 1828
498 Ga0307411_10151765 3300032005 Bacteria 1722
499 Ga0307411_10155053 3300032005 Bacteria 1707
500 Ga0307411_10324951 3300032005 Bacteria 1244
501 Ga0307411_10680636 3300032005 Bacteria 894
502 Ga0307415_100002637 3300032126 Bacteria 8939
503 Ga0307415_100008661 3300032126 Bacteria 5656
504 Ga0307415_100012704 3300032126 Bacteria 4880
505 Ga0307415_100062131 3300032126 Bacteria 2589
506 Ga0307415_100079876 3300032126 Bacteria 2332
507 Ga0307415_100135105 3300032126 Bacteria 1874
508 Ga0307415_100151259 3300032126 Bacteria 1787
509 Ga0307415_100157115 3300032126 Bacteria 1757
510 Ga0307415_100161090 3300032126 Bacteria 1739
511 Ga0307415_100237428 3300032126 Bacteria 1472
512 Ga0307415_100435260 3300032126 Bacteria 1129
513 Ga0307415_100440177 3300032126 Bacteria 1124
514 Ga0373938_0053078 3300034957 Bacteria 931
515 Ga0373923_0068276 3300035111 Bacteria 1522
516 Ga0373939_0051434 3300035114 Bacteria 1281
517 Ga0373931_0075600 3300035691 Bacteria 1848
518 Ga0373935_0627991 3300035692 Bacteria 787
519 Ga0395899_0000112 3300037312 Bacteria 138389
520 Ga0395899_0000416 3300037312 Bacteria 49361
521 Ga0395899_0004509 3300037312 Bacteria 10857
522 Ga0395899_0006041 3300037312 Bacteria 9401
523 Ga0395899_0011706 3300037312 Bacteria 6715
524 Ga0395899_0046336 3300037312 Bacteria 3238
525 Ga0395899_0078148 3300037312 Bacteria 2412
526 Ga0395899_0116335 3300037312 Bacteria 1918
527 Ga0395899_0185596 3300037312 Bacteria 1457
528 Ga0395899_0225264 3300037312 Bacteria 1297
529 Ga0395899_0265781 3300037312 Bacteria 1172
530 Ga0395900_0000126 3300037418 Bacteria 127586
531 Ga0395900_0012046 3300037418 Bacteria 8840
532 Ga0395900_0033578 3300037418 Bacteria 5280
533 Ga0395900_0067116 3300037418 Bacteria 3685
534 Ga0395900_0075135 3300037418 Bacteria 3473
535 Ga0395900_0081617 3300037418 Bacteria 3322
536 Ga0395900_0086448 3300037418 Bacteria 3222
537 Ga0395900_0121484 3300037418 Bacteria 2679
538 Ga0395900_0163883 3300037418 Bacteria 2266
539 Ga0395900_0164250 3300037418 Bacteria 2263
540 Ga0395900_0220048 3300037418 Bacteria 1914
541 Ga0395900_0251151 3300037418 Bacteria 1770
542 Ga0395900_0272079 3300037418 Bacteria 1688
543 Ga0395900_0353061 3300037418 Bacteria 1443
544 Ga0395900_0383674 3300037418 Bacteria 1372
545 Ga0395900_0424389 3300037418 Bacteria 1290
546 Ga0395900_0745332 3300037418 Bacteria 910
547 Ga0395898_0002752 3300037466 Bacteria 20261
548 Ga0395898_0004549 3300037466 Bacteria 15138
549 Ga0395898_0007693 3300037466 Bacteria 11440
550 Ga0395898_0015887 3300037466 Bacteria 7713
551 Ga0395898_0023552 3300037466 Bacteria 6220
552 Ga0395898_0038075 3300037466 Bacteria 4768
553 Ga0395898_0086016 3300037466 Bacteria 3030
554 Ga0395898_0138627 3300037466 Bacteria 2329
555 Ga0395898_0148137 3300037466 Bacteria 2246
556 Ga0395898_0300187 3300037466 Bacteria 1532
557 Ga0395898_0468829 3300037466 Bacteria 1198
558 Ga0395898_0514898 3300037466 Bacteria 1138
559 Ga0395898_0680098 3300037466 Unclassified 971
560 Ga0395905_0001949 3300037471 Bacteria 23650
561 Ga0395905_0002085 3300037471 Bacteria 22730
562 Ga0395905_0002354 3300037471 Bacteria 21056
563 Ga0395905_0004344 3300037471 Bacteria 14757
564 Ga0395905_0006447 3300037471 Bacteria 11813
565 Ga0395905_0023342 3300037471 Bacteria 5847
566 Ga0395905_0059803 3300037471 Bacteria 3562
567 Ga0395905_0062683 3300037471 Bacteria 3477
568 Ga0395905_0071127 3300037471 Bacteria 3262
569 Ga0395905_0089442 3300037471 Bacteria 2886
570 Ga0395905_0169949 3300037471 Bacteria 2048
571 Ga0395905_0199777 3300037471 Bacteria 1874
572 Ga0395905_0245036 3300037471 Bacteria 1674
573 Ga0395905_0282647 3300037471 Bacteria 1545
574 Ga0395905_0354439 3300037471 Bacteria 1359
575 Ga0395905_0651032 3300037471 Bacteria 955
576 Ga0436364_1467667 3300037853 Bacteria 13726
577 Ga0395901_0000249 3300038443 Bacteria 66993
578 Ga0395901_0019953 3300038443 Bacteria 6858
579 Ga0395901_0024645 3300038443 Bacteria 6177
580 Ga0395901_0036995 3300038443 Bacteria 5047
581 Ga0395901_0043000 3300038443 Bacteria 4686
582 Ga0395901_0045097 3300038443 Bacteria 4574
583 Ga0395901_0056704 3300038443 Bacteria 4075
584 Ga0395901_0061025 3300038443 Bacteria 3924
585 Ga0395901_0079393 3300038443 Bacteria 3426
586 Ga0395901_0120186 3300038443 Bacteria 2761
587 Ga0395901_0193330 3300038443 Unclassified 2134
588 Ga0395901_0231156 3300038443 Bacteria 1930
589 Ga0395901_0245020 3300038443 Bacteria 1868
590 Ga0395901_0260179 3300038443 Bacteria 1806
591 Ga0395901_0260622 3300038443 Bacteria 1804
592 Ga0395901_0286477 3300038443 Bacteria 1710
593 Ga0439437_001938 3300042000 Bacteria 2200
594 Ga0439432_016256 3300042006 Bacteria 2506
595 Ga0439432_108353 3300042006 Bacteria 828
596 Ga0439455_0002616 3300042012 Bacteria 3305
597 Ga0450895_007553 3300042132 Bacteria 901
598 Ga0450906_014645 3300042145 Bacteria 1434
599 Ga0439458_0000679 3300042157 Bacteria 8779
600 Ga0439458_0009670 3300042157 Bacteria 2148
601 Ga0451577_0474463 3300042876 Bacteria 1136
602 Ga0466969_0001359 3300044656 Bacteria 13195
603 Ga0466966_0000001 3300044684 Bacteria 410376
604 Ga0466966_0217631 3300044684 Bacteria 1153
605 Ga0466961_0004065 3300044693 Bacteria 9161
606 Ga0466961_0044556 3300044693 Bacteria 2839
607 Ga0466961_0117927 3300044693 Bacteria 1667
608 Ga0466963_0032241 3300044694 Bacteria 3391
609 Ga0466963_0040516 3300044694 Bacteria 3053
610 Ga0466963_0165159 3300044694 Bacteria 1542
611 Ga0466963_0262409 3300044694 Bacteria 1213
612 Ga0466971_0004819 3300044719 Bacteria 5840
613 Ga0466971_0043076 3300044719 Bacteria 2028
614 Ga0466970_0002777 3300044765 Bacteria 8446
615 Ga0466957_0001016 3300044842 Bacteria 14449
616 Ga0466957_0028790 3300044842 Bacteria 3309
617 Ga0466957_0042385 3300044842 Bacteria 2754
618 Ga0466957_0063940 3300044842 Bacteria 2263
619 Ga0466957_0127568 3300044842 Bacteria 1627
620 Ga0466959_0098283 3300045049 Bacteria 2097
621 Ga0466959_0148018 3300045049 Bacteria 1656
622 Ga0466959_0215057 3300045049 Bacteria 1335
623 Ga0466958_0019300 3300045836 Bacteria 3967
624 Ga0466958_0035396 3300045836 Bacteria 2983
625 Ga0466958_0237934 3300045836 Bacteria 1163
626 Ga0466958_0271492 3300045836 Bacteria 1086
627 Ga0466958_0317337 3300045836 Bacteria 1001
628 Ga0466967_0006319 3300045976 Bacteria 8365
629 Ga0466967_0022899 3300045976 Bacteria 5108
630 Ga0466967_0034090 3300045976 Bacteria 4317
631 Ga0466967_0179801 3300045976 Bacteria 1995
632 Ga0495650_0085781 3300046471 Bacteria 1206
633 Ga0495584_0025603 3300046491 Bacteria 2991
634 Ga0495583_0004082 3300046506 Bacteria 10715
635 Ga0495606_0001775 3300046507 Bacteria 27610
636 Ga0495643_0002032 3300046522 Bacteria 16834
637 Ga0495643_0023693 3300046522 Bacteria 3487
638 Ga0495598_0137298 3300046537 Bacteria 843
639 Ga0495609_0138534 3300046538 Bacteria 1039
640 Ga0495597_0069201 3300046542 Bacteria 1524
641 Ga0495668_0000007 3300046616 Bacteria 552902
642 Ga0495668_0048011 3300046616 Bacteria 2369
643 Ga0495611_0026312 3300046648 Bacteria 2538
644 Ga0495625_0000167 3300046660 Bacteria 102783
645 Ga0495625_0089733 3300046660 Bacteria 2127
646 Ga0495669_0000110 3300046684 Bacteria 52962
647 Ga0495669_0094186 3300046684 Bacteria 1386
648 Ga0495670_0102076 3300046691 Bacteria 1478
649 Ga0495687_000178 3300047443 Bacteria 93234
650 Ga0496101_0049454 3300048904 Bacteria 3024
651 Ga0496101_0093823 3300048904 Bacteria 2236
652 Ga0496102_0150383 3300048905 Bacteria 2187
653 Ga0496103_0214143 3300048906 Bacteria 1239
654 Ga0496103_0517714 3300048906 Bacteria 763
655 Ga0496104_0128694 3300048907 Bacteria 2432
656 Ga0496105_0084391 3300048908 Bacteria 2624
657 Ga0496105_0112299 3300048908 Bacteria 2249
658 Ga0496106_0066213 3300048909 Bacteria 2751
659 Ga0496106_0129690 3300048909 Bacteria 1977
660 Ga0496107_0015391 3300048910 Bacteria 5360
661 Ga0496107_0071527 3300048910 Bacteria 2520
662 Ga0496107_0408690 3300048910 Bacteria 1009
663 Ga0496107_0479089 3300048910 Bacteria 923
664 Ga0496108_0105817 3300048911 Bacteria 2402
665 Ga0496108_0188003 3300048911 Bacteria 1789
666 Ga0496108_0454371 3300048911 Bacteria 1119
667 Ga0496110_0046380 3300048913 Bacteria 3802
668 Ga0496110_0110014 3300048913 Bacteria 2475
669 Ga0496110_0295173 3300048913 Bacteria 1476
670 Ga0496112_0000602 3300048915 Bacteria 24773
671 Ga0496112_0048688 3300048915 Bacteria 4154
672 Ga0496112_0645636 3300048915 Bacteria 988
673 Ga0496113_0147461 3300048916 Bacteria 1854
674 Ga0496113_0181783 3300048916 Bacteria 1667
675 Ga0496114_0012266 3300048917 Bacteria 6858
676 Ga0496114_0028053 3300048917 Bacteria 4617
677 Ga0496114_0510746 3300048917 Bacteria 1063
678 Ga0496122_0020198 3300048925 Bacteria 6036
679 Ga0496123_0016388 3300048926 Bacteria 6021
680 Ga0496125_0000638 3300048928 Bacteria 58580
681 Ga0500610_0002234 3300053079 Bacteria 7021
682 Ga0500658_0003570 3300053134 Bacteria 5871
683 Ga0500645_000011 3300053730 Bacteria 169616
684 Ga0500645_000864 3300053730 Bacteria 17683
685 Ga0500596_000559 3300053735 Bacteria 7070
686 Ga0466962_0006762 3300061719 Bacteria 5501

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100145541 Ga0068856_1001455412 178
2 3300013102 Ga0157371_10273084 Ga0157371_102730842 178
3 3300013105 Ga0157369_10032646 Ga0157369_100326463 178
4 3300005327 Ga0070658_10000379 Ga0070658_1000037916 193
5 3300005339 Ga0070660_100014573 Ga0070660_1000145734 193
6 3300005345 Ga0070692_10042744 Ga0070692_100427442 193
7 3300013104 Ga0157370_10264547 Ga0157370_102645472 193
8 3300025909 Ga0207705_10003393 Ga0207705_100033932 193
9 3300025919 Ga0207657_10000631 Ga0207657_1000063126 193
10 3300031911 Ga0307412_10318091 Ga0307412_103180912 193
11 3300031995 Ga0307409_100473405 Ga0307409_1004734051 193
12 3300032126 Ga0307415_100062131 Ga0307415_1000621313 193
13 3300037312 Ga0395899_0000112 Ga0395899_0000112_114921_115637 193
14 3300037418 Ga0395900_0000126 Ga0395900_0000126_30608_31324 193
15 3300037466 Ga0395898_0004549 Ga0395898_0004549_12739_13455 193
16 3300037471 Ga0395905_0089442 Ga0395905_0089442_1411_2127 193
17 3300038443 Ga0395901_0000249 Ga0395901_0000249_30588_31304 193
18 3300045976 Ga0466967_0006319 Ga0466967_0006319_3648_4364 194
19 3300002774 JGI25150J39212_1000285 JGI25150J39212_100028523 201
20 3300003215 JGI25153J46596_10000044 JGI25153J46596_1000004481 201
21 3300003759 Ga0055525_1000051 Ga0055525_1000051184 201
22 3300003781 Ga0055536_1035025 Ga0055536_10350251 201
23 3300003791 Ga0055530_10012785 Ga0055530_100127852 201
24 3300003791 Ga0055530_10027885 Ga0055530_100278852 201
25 3300003792 Ga0055540_1004324 Ga0055540_10043245 201
26 3300003794 Ga0055531_10032146 Ga0055531_100321462 201
27 3300003794 Ga0055531_10033121 Ga0055531_100331212 201
28 3300005354 Ga0070675_100093783 Ga0070675_1000937832 201
29 3300005356 Ga0070674_100000748 Ga0070674_10000074811 201
30 3300005457 Ga0070662_100219374 Ga0070662_1002193742 201
31 3300005548 Ga0070665_100000044 Ga0070665_100000044221 201
32 3300005548 Ga0070665_100106428 Ga0070665_1001064285 201
33 3300006186 Ga0075369_10062208 Ga0075369_100622082 201
34 3300006195 Ga0075366_10011090 Ga0075366_100110905 201
35 3300009148 Ga0105243_10000038 Ga0105243_100000382 201
36 3300014969 Ga0157376_10241116 Ga0157376_102411162 201
37 3300025230 Ga0209563_100019 Ga0209563_100019322 201
38 3300025245 Ga0207425_1000026 Ga0207425_1000026176 201
39 3300025292 Ga0209676_1018236 Ga0209676_10182362 201
40 3300025294 Ga0209025_1000726 Ga0209025_100072625 201
41 3300025297 Ga0209758_1000004 Ga0209758_10000041118 201
42 3300025298 Ga0209050_1000001 Ga0209050_10000013114 201
43 3300025298 Ga0209050_1005087 Ga0209050_10050878 201
44 3300025303 Ga0209051_1000793 Ga0209051_100079315 201
45 3300025303 Ga0209051_1016432 Ga0209051_10164322 201
46 3300025304 Ga0209257_1000617 Ga0209257_100061717 201
47 3300025304 Ga0209257_1000633 Ga0209257_100063317 201
48 3300025907 Ga0207645_10077456 Ga0207645_100774563 201
49 3300025933 Ga0207706_10066417 Ga0207706_100664171 201
50 3300025933 Ga0207706_10250007 Ga0207706_102500072 201
51 3300025933 Ga0207706_10257700 Ga0207706_102577002 201
52 3300025935 Ga0207709_10000031 Ga0207709_10000031281 201
53 3300025937 Ga0207669_10002114 Ga0207669_100021148 201
54 3300025945 Ga0207679_10485370 Ga0207679_104853702 201
55 3300025972 Ga0207668_10217452 Ga0207668_102174522 201
56 3300027876 Ga0209974_10020793 Ga0209974_100207932 201
57 3300028379 Ga0268266_10000002 Ga0268266_100000022110 201
58 3300028379 Ga0268266_10076820 Ga0268266_100768202 201
59 3300028786 Ga0307517_10022167 Ga0307517_100221677 201
60 3300028786 Ga0307517_10022587 Ga0307517_100225873 201
61 3300031548 Ga0307408_100072671 Ga0307408_1000726712 201
62 3300031852 Ga0307410_10046935 Ga0307410_100469352 201
63 3300031901 Ga0307406_10030437 Ga0307406_100304372 201
64 3300031901 Ga0307406_10287446 Ga0307406_102874462 201
65 3300032002 Ga0307416_100101581 Ga0307416_1001015812 201
66 3300032004 Ga0307414_10024261 Ga0307414_100242614 201
67 3300032126 Ga0307415_100135105 Ga0307415_1001351052 201
68 3300037312 Ga0395899_0225264 Ga0395899_0225264_282_989 201
69 3300038443 Ga0395901_0061025 Ga0395901_0061025_1726_2433 201
70 3300046471 Ga0495650_0085781 Ga0495650_0085781_110_811 201
71 3300046491 Ga0495584_0025603 Ga0495584_0025603_639_1346 201
72 3300046506 Ga0495583_0004082 Ga0495583_0004082_8427_9134 201
73 3300046507 Ga0495606_0001775 Ga0495606_0001775_25339_26046 201
74 3300046522 Ga0495643_0002032 Ga0495643_0002032_13069_13776 201
75 3300046522 Ga0495643_0023693 Ga0495643_0023693_2733_3440 201
76 3300046538 Ga0495609_0138534 Ga0495609_0138534_321_1028 201
77 3300046542 Ga0495597_0069201 Ga0495597_0069201_761_1468 201
78 3300046616 Ga0495668_0000007 Ga0495668_0000007_52242_52949 201
79 3300046648 Ga0495611_0026312 Ga0495611_0026312_1283_1990 201
80 3300046660 Ga0495625_0000167 Ga0495625_0000167_68904_69611 201
81 3300046660 Ga0495625_0089733 Ga0495625_0089733_1077_1784 201
82 3300046684 Ga0495669_0000110 Ga0495669_0000110_39341_40048 201
83 3300047443 Ga0495687_000178 Ga0495687_000178_40561_41268 201
84 3300048906 Ga0496103_0214143 Ga0496103_0214143_149_862 201
85 3300048916 Ga0496113_0181783 Ga0496113_0181783_620_1327 201
86 3300048917 Ga0496114_0028053 Ga0496114_0028053_1582_2289 201
87 3300048925 Ga0496122_0020198 Ga0496122_0020198_4222_4929 201
88 3300048926 Ga0496123_0016388 Ga0496123_0016388_2556_3263 201
89 3300048928 Ga0496125_0000638 Ga0496125_0000638_14117_14824 201
90 3300053079 Ga0500610_0002234 Ga0500610_0002234_2526_3233 201
91 3300053730 Ga0500645_000011 Ga0500645_000011_115050_115757 201
92 3300053730 Ga0500645_000864 Ga0500645_000864_13146_13856 201
93 3300053735 Ga0500596_000559 Ga0500596_000559_4213_4920 201
94 3300001989 JGI24739J22299_10003131 JGI24739J22299_100031314 202
95 3300001990 JGI24737J22298_10021171 JGI24737J22298_100211712 202
96 3300001990 JGI24737J22298_10054431 JGI24737J22298_100544312 202
97 3300001991 JGI24743J22301_10017318 JGI24743J22301_100173183 202
98 3300002075 JGI24738J21930_10001952 JGI24738J21930_100019522 202
99 3300005293 Ga0065715_10104714 Ga0065715_101047142 202
100 3300005327 Ga0070658_10000850 Ga0070658_1000085019 202
101 3300005327 Ga0070658_10017653 Ga0070658_100176536 202
102 3300005327 Ga0070658_10060472 Ga0070658_100604722 202
103 3300005327 Ga0070658_10202894 Ga0070658_102028942 202
104 3300005327 Ga0070658_10471029 Ga0070658_104710292 202
105 3300005327 Ga0070658_10473420 Ga0070658_104734201 202
106 3300005328 Ga0070676_10033934 Ga0070676_100339342 202
107 3300005328 Ga0070676_10081352 Ga0070676_100813522 202
108 3300005329 Ga0070683_100001218 Ga0070683_1000012184 202
109 3300005329 Ga0070683_100014840 Ga0070683_1000148404 202
110 3300005329 Ga0070683_100146333 Ga0070683_1001463332 202
111 3300005329 Ga0070683_100369281 Ga0070683_1003692811 202
112 3300005329 Ga0070683_100370875 Ga0070683_1003708751 202
113 3300005330 Ga0070690_100018174 Ga0070690_1000181742 202
114 3300005331 Ga0070670_100015317 Ga0070670_1000153174 202
115 3300005331 Ga0070670_100232323 Ga0070670_1002323232 202
116 3300005331 Ga0070670_100233788 Ga0070670_1002337882 202
117 3300005331 Ga0070670_100322921 Ga0070670_1003229212 202
118 3300005331 Ga0070670_100353881 Ga0070670_1003538812 202
119 3300005333 Ga0070677_10055072 Ga0070677_100550722 202
120 3300005335 Ga0070666_10000555 Ga0070666_1000055515 202
121 3300005335 Ga0070666_10000788 Ga0070666_1000078816 202
122 3300005335 Ga0070666_10003797 Ga0070666_100037972 202
123 3300005335 Ga0070666_10134273 Ga0070666_101342731 202
124 3300005336 Ga0070680_100000600 Ga0070680_1000006007 202
125 3300005336 Ga0070680_100191965 Ga0070680_1001919652 202
126 3300005336 Ga0070680_100235000 Ga0070680_1002350002 202
127 3300005336 Ga0070680_100238700 Ga0070680_1002387001 202
128 3300005336 Ga0070680_100633744 Ga0070680_1006337441 202
129 3300005338 Ga0068868_100000211 Ga0068868_10000021137 202
130 3300005338 Ga0068868_100011949 Ga0068868_1000119492 202
131 3300005339 Ga0070660_100001859 Ga0070660_1000018596 202
132 3300005339 Ga0070660_100002066 Ga0070660_1000020665 202
133 3300005339 Ga0070660_100031328 Ga0070660_1000313283 202
134 3300005339 Ga0070660_100033386 Ga0070660_1000333863 202
135 3300005339 Ga0070660_100037874 Ga0070660_1000378742 202
136 3300005339 Ga0070660_100064368 Ga0070660_1000643682 202
137 3300005339 Ga0070660_100074313 Ga0070660_1000743135 202
138 3300005339 Ga0070660_100188524 Ga0070660_1001885242 202
139 3300005339 Ga0070660_100306520 Ga0070660_1003065201 202
140 3300005339 Ga0070660_100402887 Ga0070660_1004028872 202
141 3300005339 Ga0070660_100533921 Ga0070660_1005339211 202
142 3300005340 Ga0070689_100079995 Ga0070689_1000799953 202
143 3300005343 Ga0070687_100048833 Ga0070687_1000488332 202
144 3300005344 Ga0070661_100011344 Ga0070661_1000113445 202
145 3300005344 Ga0070661_100333617 Ga0070661_1003336171 202
146 3300005344 Ga0070661_100600262 Ga0070661_1006002621 202
147 3300005344 Ga0070661_100665251 Ga0070661_1006652511 202
148 3300005345 Ga0070692_10013735 Ga0070692_100137352 202
149 3300005347 Ga0070668_100084106 Ga0070668_1000841063 202
150 3300005347 Ga0070668_100448989 Ga0070668_1004489891 202
151 3300005347 Ga0070668_100692893 Ga0070668_1006928931 202
152 3300005353 Ga0070669_100036110 Ga0070669_1000361102 202
153 3300005353 Ga0070669_100036391 Ga0070669_1000363912 202
154 3300005353 Ga0070669_100047337 Ga0070669_1000473372 202
155 3300005354 Ga0070675_100017003 Ga0070675_1000170034 202
156 3300005354 Ga0070675_100138612 Ga0070675_1001386122 202
157 3300005355 Ga0070671_100008209 Ga0070671_1000082094 202
158 3300005355 Ga0070671_100011218 Ga0070671_1000112185 202
159 3300005355 Ga0070671_100036176 Ga0070671_1000361762 202
160 3300005355 Ga0070671_100101520 Ga0070671_1001015202 202
161 3300005356 Ga0070674_100033523 Ga0070674_1000335233 202
162 3300005356 Ga0070674_100069808 Ga0070674_1000698082 202
163 3300005356 Ga0070674_100134949 Ga0070674_1001349492 202
164 3300005364 Ga0070673_100007938 Ga0070673_1000079383 202
165 3300005364 Ga0070673_100044036 Ga0070673_1000440361 202
166 3300005364 Ga0070673_100123390 Ga0070673_1001233901 202
167 3300005364 Ga0070673_100282530 Ga0070673_1002825302 202
168 3300005364 Ga0070673_100548490 Ga0070673_1005484902 202
169 3300005366 Ga0070659_100024266 Ga0070659_1000242664 202
170 3300005366 Ga0070659_100057384 Ga0070659_1000573843 202
171 3300005366 Ga0070659_100078933 Ga0070659_1000789332 202
172 3300005366 Ga0070659_100080262 Ga0070659_1000802623 202
173 3300005366 Ga0070659_100087124 Ga0070659_1000871242 202
174 3300005366 Ga0070659_100188514 Ga0070659_1001885141 202
175 3300005367 Ga0070667_100001014 Ga0070667_10000101415 202
176 3300005367 Ga0070667_100003689 Ga0070667_10000368911 202
177 3300005367 Ga0070667_100005056 Ga0070667_1000050565 202
178 3300005367 Ga0070667_100018198 Ga0070667_1000181981 202
179 3300005367 Ga0070667_100613747 Ga0070667_1006137472 202
180 3300005436 Ga0070713_100014792 Ga0070713_1000147921 202
181 3300005455 Ga0070663_100001179 Ga0070663_1000011799 202
182 3300005455 Ga0070663_100272338 Ga0070663_1002723381 202
183 3300005455 Ga0070663_100443191 Ga0070663_1004431911 202
184 3300005455 Ga0070663_100549921 Ga0070663_1005499211 202
185 3300005456 Ga0070678_100065818 Ga0070678_1000658182 202
186 3300005456 Ga0070678_100196689 Ga0070678_1001966892 202
187 3300005457 Ga0070662_100004894 Ga0070662_1000048948 202
188 3300005457 Ga0070662_100008268 Ga0070662_1000082685 202
189 3300005457 Ga0070662_100009507 Ga0070662_1000095072 202
190 3300005457 Ga0070662_100021117 Ga0070662_1000211175 202
191 3300005458 Ga0070681_10103530 Ga0070681_101035302 202
192 3300005459 Ga0068867_100145558 Ga0068867_1001455582 202
193 3300005459 Ga0068867_100203179 Ga0068867_1002031792 202
194 3300005530 Ga0070679_100075000 Ga0070679_1000750002 202
195 3300005530 Ga0070679_100129217 Ga0070679_1001292173 202
196 3300005535 Ga0070684_100648527 Ga0070684_1006485271 202
197 3300005539 Ga0068853_100018513 Ga0068853_1000185135 202
198 3300005543 Ga0070672_100010078 Ga0070672_1000100783 202
199 3300005543 Ga0070672_100222162 Ga0070672_1002221622 202
200 3300005543 Ga0070672_100230499 Ga0070672_1002304992 202
201 3300005544 Ga0070686_100075696 Ga0070686_1000756962 202
202 3300005548 Ga0070665_100003221 Ga0070665_1000032218 202
203 3300005548 Ga0070665_100797092 Ga0070665_1007970921 202
204 3300005563 Ga0068855_100000300 Ga0068855_10000030064 202
205 3300005564 Ga0070664_100006228 Ga0070664_1000062287 202
206 3300005564 Ga0070664_100008802 Ga0070664_1000088022 202
207 3300005564 Ga0070664_100082623 Ga0070664_1000826231 202
208 3300005577 Ga0068857_100021293 Ga0068857_1000212936 202
209 3300005577 Ga0068857_100025988 Ga0068857_1000259882 202
210 3300005578 Ga0068854_100000728 Ga0068854_10000072810 202
211 3300005578 Ga0068854_100277704 Ga0068854_1002777041 202
212 3300005614 Ga0068856_100028489 Ga0068856_1000284894 202
213 3300005614 Ga0068856_100030135 Ga0068856_1000301352 202
214 3300005614 Ga0068856_100066022 Ga0068856_1000660226 202
215 3300005614 Ga0068856_100135622 Ga0068856_1001356221 202
216 3300005614 Ga0068856_100252822 Ga0068856_1002528221 202
217 3300005616 Ga0068852_100093936 Ga0068852_1000939362 202
218 3300005616 Ga0068852_100659547 Ga0068852_1006595471 202
219 3300005617 Ga0068859_100064821 Ga0068859_1000648214 202
220 3300005617 Ga0068859_100115375 Ga0068859_1001153752 202
221 3300005618 Ga0068864_100282586 Ga0068864_1002825862 202
222 3300005618 Ga0068864_100494293 Ga0068864_1004942932 202
223 3300005718 Ga0068866_10033567 Ga0068866_100335672 202
224 3300005719 Ga0068861_100202619 Ga0068861_1002026192 202
225 3300005834 Ga0068851_10032450 Ga0068851_100324504 202
226 3300005834 Ga0068851_10069902 Ga0068851_100699023 202
227 3300005834 Ga0068851_10097261 Ga0068851_100972612 202
228 3300005840 Ga0068870_10330320 Ga0068870_103303202 202
229 3300005841 Ga0068863_100161988 Ga0068863_1001619882 202
230 3300005841 Ga0068863_100166116 Ga0068863_1001661162 202
231 3300005842 Ga0068858_100004134 Ga0068858_10000413414 202
232 3300005842 Ga0068858_100101070 Ga0068858_1001010702 202
233 3300005843 Ga0068860_100206806 Ga0068860_1002068062 202
234 3300005844 Ga0068862_100056641 Ga0068862_1000566413 202
235 3300005844 Ga0068862_100186131 Ga0068862_1001861312 202
236 3300005985 Ga0081539_10023788 Ga0081539_100237882 202
237 3300006028 Ga0070717_10002352 Ga0070717_1000235212 202
238 3300006028 Ga0070717_10311119 Ga0070717_103111191 202
239 3300006237 Ga0097621_100036752 Ga0097621_1000367522 202
240 3300006237 Ga0097621_100048429 Ga0097621_1000484292 202
241 3300006237 Ga0097621_100186068 Ga0097621_1001860682 202
242 3300006358 Ga0068871_100026164 Ga0068871_1000261644 202
243 3300006881 Ga0068865_100017616 Ga0068865_1000176163 202
244 3300006881 Ga0068865_100039821 Ga0068865_1000398212 202
245 3300006931 Ga0097620_100064824 Ga0097620_1000648244 202
246 3300006931 Ga0097620_100115367 Ga0097620_1001153672 202
247 3300009093 Ga0105240_10008636 Ga0105240_100086362 202
248 3300009093 Ga0105240_10109400 Ga0105240_101094006 202
249 3300009093 Ga0105240_10207308 Ga0105240_102073082 202
250 3300009094 Ga0111539_10259093 Ga0111539_102590932 202
251 3300009094 Ga0111539_10583676 Ga0111539_105836762 202
252 3300009098 Ga0105245_10135945 Ga0105245_101359452 202
253 3300009148 Ga0105243_10040865 Ga0105243_100408652 202
254 3300009148 Ga0105243_10078506 Ga0105243_100785063 202
255 3300009176 Ga0105242_10003245 Ga0105242_100032457 202
256 3300009177 Ga0105248_10000442 Ga0105248_1000044237 202
257 3300009177 Ga0105248_10003885 Ga0105248_100038857 202
258 3300009177 Ga0105248_10042951 Ga0105248_100429514 202
259 3300009177 Ga0105248_10184947 Ga0105248_101849473 202
260 3300009177 Ga0105248_10452542 Ga0105248_104525421 202
261 3300009545 Ga0105237_10734784 Ga0105237_107347841 202
262 3300009551 Ga0105238_10004331 Ga0105238_1000433116 202
263 3300009551 Ga0105238_10111619 Ga0105238_101116191 202
264 3300010375 Ga0105239_10097099 Ga0105239_100970993 202
265 3300010375 Ga0105239_10189608 Ga0105239_101896082 202
266 3300011119 Ga0105246_10337381 Ga0105246_103373812 202
267 3300013100 Ga0157373_10009132 Ga0157373_100091325 202
268 3300013100 Ga0157373_10010212 Ga0157373_100102125 202
269 3300013100 Ga0157373_10020611 Ga0157373_100206112 202
270 3300013102 Ga0157371_10003905 Ga0157371_100039057 202
271 3300013102 Ga0157371_10030406 Ga0157371_100304063 202
272 3300013102 Ga0157371_10041019 Ga0157371_100410193 202
273 3300013102 Ga0157371_10092407 Ga0157371_100924072 202
274 3300013102 Ga0157371_10139705 Ga0157371_101397052 202
275 3300013102 Ga0157371_10225805 Ga0157371_102258052 202
276 3300013102 Ga0157371_10388972 Ga0157371_103889721 202
277 3300013104 Ga0157370_10076239 Ga0157370_100762392 202
278 3300013104 Ga0157370_10131571 Ga0157370_101315712 202
279 3300013104 Ga0157370_10576355 Ga0157370_105763552 202
280 3300013105 Ga0157369_10001743 Ga0157369_100017438 202
281 3300013105 Ga0157369_10008003 Ga0157369_100080039 202
282 3300013105 Ga0157369_10012108 Ga0157369_100121086 202
283 3300013105 Ga0157369_10146486 Ga0157369_101464862 202
284 3300013105 Ga0157369_10268978 Ga0157369_102689781 202
285 3300013296 Ga0157374_10003127 Ga0157374_100031273 202
286 3300013296 Ga0157374_10113722 Ga0157374_101137222 202
287 3300013296 Ga0157374_10162164 Ga0157374_101621642 202
288 3300013297 Ga0157378_10104322 Ga0157378_101043221 202
289 3300013297 Ga0157378_10160910 Ga0157378_101609101 202
290 3300013307 Ga0157372_10066311 Ga0157372_100663112 202
291 3300013307 Ga0157372_10077125 Ga0157372_100771253 202
292 3300013308 Ga0157375_10296300 Ga0157375_102963002 202
293 3300013308 Ga0157375_10445469 Ga0157375_104454691 202
294 3300014325 Ga0163163_10022654 Ga0163163_100226542 202
295 3300014325 Ga0163163_10060370 Ga0163163_100603705 202
296 3300014745 Ga0157377_10315766 Ga0157377_103157661 202
297 3300014745 Ga0157377_10446535 Ga0157377_104465351 202
298 3300014968 Ga0157379_10095548 Ga0157379_100955482 202
299 3300014968 Ga0157379_10690849 Ga0157379_106908491 202
300 3300014969 Ga0157376_10161811 Ga0157376_101618112 202
301 3300017792 Ga0163161_10001335 Ga0163161_100013355 202
302 3300021388 Ga0213875_10039040 Ga0213875_100390402 202
303 3300025315 Ga0207697_10074595 Ga0207697_100745952 202
304 3300025321 Ga0207656_10033586 Ga0207656_100335862 202
305 3300025893 Ga0207682_10004604 Ga0207682_100046043 202
306 3300025893 Ga0207682_10047348 Ga0207682_100473482 202
307 3300025903 Ga0207680_10001223 Ga0207680_100012238 202
308 3300025903 Ga0207680_10001981 Ga0207680_100019818 202
309 3300025903 Ga0207680_10138489 Ga0207680_101384892 202
310 3300025903 Ga0207680_10284722 Ga0207680_102847222 202
311 3300025904 Ga0207647_10005192 Ga0207647_100051926 202
312 3300025904 Ga0207647_10026990 Ga0207647_100269902 202
313 3300025904 Ga0207647_10107202 Ga0207647_101072022 202
314 3300025907 Ga0207645_10015870 Ga0207645_100158704 202
315 3300025907 Ga0207645_10026228 Ga0207645_100262282 202
316 3300025907 Ga0207645_10080726 Ga0207645_100807262 202
317 3300025908 Ga0207643_10312897 Ga0207643_103128971 202
318 3300025909 Ga0207705_10000060 Ga0207705_1000006072 202
319 3300025909 Ga0207705_10000429 Ga0207705_1000042930 202
320 3300025909 Ga0207705_10000779 Ga0207705_100007797 202
321 3300025909 Ga0207705_10006538 Ga0207705_100065386 202
322 3300025909 Ga0207705_10010399 Ga0207705_100103994 202
323 3300025909 Ga0207705_10028693 Ga0207705_100286931 202
324 3300025909 Ga0207705_10051177 Ga0207705_100511772 202
325 3300025909 Ga0207705_10051439 Ga0207705_100514392 202
326 3300025909 Ga0207705_10070261 Ga0207705_100702612 202
327 3300025909 Ga0207705_10178370 Ga0207705_101783702 202
328 3300025909 Ga0207705_10345107 Ga0207705_103451072 202
329 3300025912 Ga0207707_10195711 Ga0207707_101957112 202
330 3300025912 Ga0207707_10477744 Ga0207707_104777442 202
331 3300025913 Ga0207695_10001996 Ga0207695_1000199617 202
332 3300025913 Ga0207695_10024085 Ga0207695_100240856 202
333 3300025917 Ga0207660_10083358 Ga0207660_100833582 202
334 3300025917 Ga0207660_10450550 Ga0207660_104505501 202
335 3300025918 Ga0207662_10070400 Ga0207662_100704002 202
336 3300025919 Ga0207657_10004219 Ga0207657_100042193 202
337 3300025919 Ga0207657_10004392 Ga0207657_100043929 202
338 3300025919 Ga0207657_10004601 Ga0207657_100046017 202
339 3300025919 Ga0207657_10005022 Ga0207657_100050227 202
340 3300025919 Ga0207657_10044515 Ga0207657_100445153 202
341 3300025919 Ga0207657_10066869 Ga0207657_100668693 202
342 3300025919 Ga0207657_10087648 Ga0207657_100876482 202
343 3300025920 Ga0207649_10000702 Ga0207649_100007028 202
344 3300025920 Ga0207649_10160693 Ga0207649_101606932 202
345 3300025920 Ga0207649_10238501 Ga0207649_102385012 202
346 3300025921 Ga0207652_10187523 Ga0207652_101875232 202
347 3300025921 Ga0207652_10863604 Ga0207652_108636041 202
348 3300025923 Ga0207681_10028101 Ga0207681_100281013 202
349 3300025923 Ga0207681_10033974 Ga0207681_100339742 202
350 3300025923 Ga0207681_10038492 Ga0207681_100384923 202
351 3300025924 Ga0207694_10015718 Ga0207694_100157182 202
352 3300025925 Ga0207650_10003954 Ga0207650_100039548 202
353 3300025925 Ga0207650_10122814 Ga0207650_101228142 202
354 3300025925 Ga0207650_10196151 Ga0207650_101961513 202
355 3300025925 Ga0207650_10226637 Ga0207650_102266372 202
356 3300025925 Ga0207650_10656957 Ga0207650_106569571 202
357 3300025926 Ga0207659_10009997 Ga0207659_100099972 202
358 3300025926 Ga0207659_10291642 Ga0207659_102916421 202
359 3300025928 Ga0207700_10006689 Ga0207700_100066895 202
360 3300025931 Ga0207644_10000616 Ga0207644_100006162 202
361 3300025931 Ga0207644_10003692 Ga0207644_100036925 202
362 3300025931 Ga0207644_10060563 Ga0207644_100605633 202
363 3300025931 Ga0207644_10106241 Ga0207644_101062412 202
364 3300025931 Ga0207644_10150553 Ga0207644_101505532 202
365 3300025931 Ga0207644_10311361 Ga0207644_103113612 202
366 3300025932 Ga0207690_10076032 Ga0207690_100760322 202
367 3300025932 Ga0207690_10095443 Ga0207690_100954434 202
368 3300025932 Ga0207690_10120416 Ga0207690_101204162 202
369 3300025932 Ga0207690_10120550 Ga0207690_101205504 202
370 3300025932 Ga0207690_10297025 Ga0207690_102970252 202
371 3300025932 Ga0207690_10329131 Ga0207690_103291312 202
372 3300025932 Ga0207690_10389072 Ga0207690_103890722 202
373 3300025933 Ga0207706_10000479 Ga0207706_1000047930 202
374 3300025933 Ga0207706_10002783 Ga0207706_100027835 202
375 3300025933 Ga0207706_10038708 Ga0207706_100387082 202
376 3300025933 Ga0207706_10040986 Ga0207706_100409864 202
377 3300025933 Ga0207706_10045794 Ga0207706_100457943 202
378 3300025933 Ga0207706_10456867 Ga0207706_104568672 202
379 3300025935 Ga0207709_10011963 Ga0207709_100119632 202
380 3300025937 Ga0207669_10032531 Ga0207669_100325313 202
381 3300025937 Ga0207669_10034651 Ga0207669_100346512 202
382 3300025937 Ga0207669_10053893 Ga0207669_100538932 202
383 3300025938 Ga0207704_10013390 Ga0207704_100133903 202
384 3300025938 Ga0207704_10457906 Ga0207704_104579061 202
385 3300025940 Ga0207691_10008185 Ga0207691_100081855 202
386 3300025940 Ga0207691_10015613 Ga0207691_100156132 202
387 3300025940 Ga0207691_10171780 Ga0207691_101717802 202
388 3300025941 Ga0207711_10000526 Ga0207711_100005268 202
389 3300025941 Ga0207711_10002857 Ga0207711_1000285715 202
390 3300025941 Ga0207711_10308580 Ga0207711_103085802 202
391 3300025944 Ga0207661_10015344 Ga0207661_100153443 202
392 3300025944 Ga0207661_10476366 Ga0207661_104763662 202
393 3300025945 Ga0207679_10004129 Ga0207679_100041294 202
394 3300025945 Ga0207679_10028047 Ga0207679_100280475 202
395 3300025945 Ga0207679_10148717 Ga0207679_101487172 202
396 3300025949 Ga0207667_10000187 Ga0207667_1000018771 202
397 3300025949 Ga0207667_10047524 Ga0207667_100475242 202
398 3300025949 Ga0207667_10230028 Ga0207667_102300283 202
399 3300025960 Ga0207651_10001053 Ga0207651_1000105310 202
400 3300025960 Ga0207651_10109559 Ga0207651_101095594 202
401 3300025960 Ga0207651_10434429 Ga0207651_104344292 202
402 3300025972 Ga0207668_10533687 Ga0207668_105336872 202
403 3300025981 Ga0207640_10000830 Ga0207640_1000083015 202
404 3300025981 Ga0207640_10021319 Ga0207640_100213193 202
405 3300025986 Ga0207658_10001939 Ga0207658_1000193911 202
406 3300025986 Ga0207658_10017829 Ga0207658_100178293 202
407 3300025986 Ga0207658_10046725 Ga0207658_100467252 202
408 3300025986 Ga0207658_10101906 Ga0207658_101019062 202
409 3300025986 Ga0207658_10105929 Ga0207658_101059292 202
410 3300026023 Ga0207677_10001135 Ga0207677_100011359 202
411 3300026023 Ga0207677_10001443 Ga0207677_1000144311 202
412 3300026035 Ga0207703_10002018 Ga0207703_100020185 202
413 3300026035 Ga0207703_10002744 Ga0207703_100027446 202
414 3300026041 Ga0207639_10149300 Ga0207639_101493002 202
415 3300026067 Ga0207678_10002632 Ga0207678_100026328 202
416 3300026067 Ga0207678_10003960 Ga0207678_100039608 202
417 3300026067 Ga0207678_10016075 Ga0207678_100160756 202
418 3300026067 Ga0207678_10138649 Ga0207678_101386492 202
419 3300026078 Ga0207702_10022091 Ga0207702_100220912 202
420 3300026078 Ga0207702_10150514 Ga0207702_101505143 202
421 3300026088 Ga0207641_10084623 Ga0207641_100846233 202
422 3300026088 Ga0207641_10111335 Ga0207641_101113352 202
423 3300026088 Ga0207641_10195067 Ga0207641_101950671 202
424 3300026089 Ga0207648_10005222 Ga0207648_1000522215 202
425 3300026089 Ga0207648_10671450 Ga0207648_106714502 202
426 3300026095 Ga0207676_10036937 Ga0207676_100369374 202
427 3300026095 Ga0207676_10172957 Ga0207676_101729572 202
428 3300026095 Ga0207676_10422001 Ga0207676_104220012 202
429 3300026116 Ga0207674_10010957 Ga0207674_100109573 202
430 3300026116 Ga0207674_10013241 Ga0207674_100132412 202
431 3300026118 Ga0207675_100181159 Ga0207675_1001811592 202
432 3300026121 Ga0207683_10120822 Ga0207683_101208222 202
433 3300026142 Ga0207698_10009005 Ga0207698_100090051 202
434 3300026142 Ga0207698_10119154 Ga0207698_101191542 202
435 3300026142 Ga0207698_10476135 Ga0207698_104761353 202
436 3300026142 Ga0207698_10511774 Ga0207698_105117742 202
437 3300027665 Ga0209983_1025505 Ga0209983_10255052 202
438 3300027682 Ga0209971_1022315 Ga0209971_10223153 202
439 3300027876 Ga0209974_10001664 Ga0209974_100016645 202
440 3300027876 Ga0209974_10061469 Ga0209974_100614692 202
441 3300028379 Ga0268266_10007662 Ga0268266_100076625 202
442 3300028379 Ga0268266_10428874 Ga0268266_104288741 202
443 3300028380 Ga0268265_10020526 Ga0268265_100205262 202
444 3300028380 Ga0268265_10026561 Ga0268265_100265613 202
445 3300030742 Ga0316183_1201056 Ga0316183_12010562 202
446 3300030745 Ga0316182_1043585 Ga0316182_10435852 202
447 3300031548 Ga0307408_100005051 Ga0307408_1000050517 202
448 3300031548 Ga0307408_100018438 Ga0307408_1000184384 202
449 3300031548 Ga0307408_100058940 Ga0307408_1000589402 202
450 3300031548 Ga0307408_100650732 Ga0307408_1006507321 202
451 3300031731 Ga0307405_10008142 Ga0307405_100081422 202
452 3300031731 Ga0307405_10102656 Ga0307405_101026563 202
453 3300031731 Ga0307405_10105492 Ga0307405_101054923 202
454 3300031824 Ga0307413_10001109 Ga0307413_100011096 202
455 3300031824 Ga0307413_10003856 Ga0307413_100038565 202
456 3300031824 Ga0307413_10003892 Ga0307413_100038924 202
457 3300031824 Ga0307413_10017918 Ga0307413_100179182 202
458 3300031824 Ga0307413_10149107 Ga0307413_101491072 202
459 3300031824 Ga0307413_10310922 Ga0307413_103109222 202
460 3300031824 Ga0307413_10324467 Ga0307413_103244671 202
461 3300031824 Ga0307413_10337151 Ga0307413_103371512 202
462 3300031824 Ga0307413_10652382 Ga0307413_106523821 202
463 3300031852 Ga0307410_10005778 Ga0307410_100057785 202
464 3300031852 Ga0307410_10008421 Ga0307410_100084214 202
465 3300031852 Ga0307410_10012417 Ga0307410_100124172 202
466 3300031852 Ga0307410_10042354 Ga0307410_100423543 202
467 3300031852 Ga0307410_10061682 Ga0307410_100616822 202
468 3300031852 Ga0307410_10118517 Ga0307410_101185172 202
469 3300031852 Ga0307410_10183245 Ga0307410_101832452 202
470 3300031901 Ga0307406_10005891 Ga0307406_100058913 202
471 3300031901 Ga0307406_10011121 Ga0307406_100111213 202
472 3300031903 Ga0307407_10020959 Ga0307407_100209592 202
473 3300031903 Ga0307407_10112853 Ga0307407_101128531 202
474 3300031903 Ga0307407_10122080 Ga0307407_101220803 202
475 3300031903 Ga0307407_10166545 Ga0307407_101665451 202
476 3300031903 Ga0307407_10199643 Ga0307407_101996432 202
477 3300031903 Ga0307407_10223930 Ga0307407_102239302 202
478 3300031911 Ga0307412_10022884 Ga0307412_100228842 202
479 3300031911 Ga0307412_10062139 Ga0307412_100621393 202
480 3300031911 Ga0307412_10246262 Ga0307412_102462622 202
481 3300031911 Ga0307412_10328498 Ga0307412_103284982 202
482 3300031995 Ga0307409_100010810 Ga0307409_1000108104 202
483 3300031995 Ga0307409_100029005 Ga0307409_1000290052 202
484 3300031995 Ga0307409_100030515 Ga0307409_1000305152 202
485 3300031995 Ga0307409_100031412 Ga0307409_1000314122 202
486 3300031995 Ga0307409_100175326 Ga0307409_1001753262 202
487 3300031995 Ga0307409_100294960 Ga0307409_1002949602 202
488 3300031995 Ga0307409_100530263 Ga0307409_1005302631 202
489 3300031995 Ga0307409_100563629 Ga0307409_1005636292 202
490 3300031995 Ga0307409_100646404 Ga0307409_1006464041 202
491 3300032002 Ga0307416_100013083 Ga0307416_1000130832 202
492 3300032002 Ga0307416_100072582 Ga0307416_1000725822 202
493 3300032002 Ga0307416_100362859 Ga0307416_1003628592 202
494 3300032002 Ga0307416_100961959 Ga0307416_1009619592 202
495 3300032004 Ga0307414_10014565 Ga0307414_100145654 202
496 3300032004 Ga0307414_10018498 Ga0307414_100184982 202
497 3300032004 Ga0307414_10032075 Ga0307414_100320753 202
498 3300032004 Ga0307414_10051350 Ga0307414_100513501 202
499 3300032004 Ga0307414_10057266 Ga0307414_100572661 202
500 3300032004 Ga0307414_10105146 Ga0307414_101051461 202
501 3300032004 Ga0307414_10114095 Ga0307414_101140952 202
502 3300032004 Ga0307414_10270341 Ga0307414_102703412 202
503 3300032005 Ga0307411_10001594 Ga0307411_100015946 202
504 3300032005 Ga0307411_10006301 Ga0307411_100063012 202
505 3300032005 Ga0307411_10012113 Ga0307411_100121132 202
506 3300032005 Ga0307411_10049123 Ga0307411_100491232 202
507 3300032005 Ga0307411_10061029 Ga0307411_100610292 202
508 3300032005 Ga0307411_10131723 Ga0307411_101317233 202
509 3300032005 Ga0307411_10151765 Ga0307411_101517651 202
510 3300032005 Ga0307411_10155053 Ga0307411_101550532 202
511 3300032005 Ga0307411_10324951 Ga0307411_103249512 202
512 3300032005 Ga0307411_10680636 Ga0307411_106806361 202
513 3300032126 Ga0307415_100002637 Ga0307415_1000026374 202
514 3300032126 Ga0307415_100008661 Ga0307415_1000086614 202
515 3300032126 Ga0307415_100012704 Ga0307415_1000127044 202
516 3300032126 Ga0307415_100157115 Ga0307415_1001571152 202
517 3300032126 Ga0307415_100161090 Ga0307415_1001610902 202
518 3300032126 Ga0307415_100237428 Ga0307415_1002374282 202
519 3300032126 Ga0307415_100435260 Ga0307415_1004352602 202
520 3300034957 Ga0373938_0053078 Ga0373938_0053078_129_845 202
521 3300035114 Ga0373939_0051434 Ga0373939_0051434_234_950 202
522 3300035691 Ga0373931_0075600 Ga0373931_0075600_974_1690 202
523 3300035692 Ga0373935_0627991 Ga0373935_0627991_41_757 202
524 3300037312 Ga0395899_0006041 Ga0395899_0006041_3625_4335 202
525 3300037312 Ga0395899_0011706 Ga0395899_0011706_2203_2919 202
526 3300037312 Ga0395899_0046336 Ga0395899_0046336_23_739 202
527 3300037312 Ga0395899_0078148 Ga0395899_0078148_1376_2104 202
528 3300037312 Ga0395899_0116335 Ga0395899_0116335_325_1035 202
529 3300037312 Ga0395899_0185596 Ga0395899_0185596_705_1421 202
530 3300037312 Ga0395899_0265781 Ga0395899_0265781_50_766 202
531 3300037418 Ga0395900_0012046 Ga0395900_0012046_37_753 202
532 3300037418 Ga0395900_0033578 Ga0395900_0033578_1422_2135 202
533 3300037418 Ga0395900_0067116 Ga0395900_0067116_329_1045 202
534 3300037418 Ga0395900_0075135 Ga0395900_0075135_2355_3071 202
535 3300037418 Ga0395900_0081617 Ga0395900_0081617_2304_3020 202
536 3300037418 Ga0395900_0086448 Ga0395900_0086448_1227_1943 202
537 3300037418 Ga0395900_0121484 Ga0395900_0121484_37_753 202
538 3300037418 Ga0395900_0163883 Ga0395900_0163883_500_1216 202
539 3300037418 Ga0395900_0164250 Ga0395900_0164250_524_1240 202
540 3300037418 Ga0395900_0220048 Ga0395900_0220048_482_1198 202
541 3300037418 Ga0395900_0251151 Ga0395900_0251151_610_1326 202
542 3300037418 Ga0395900_0272079 Ga0395900_0272079_353_1063 202
543 3300037418 Ga0395900_0353061 Ga0395900_0353061_525_1241 202
544 3300037418 Ga0395900_0383674 Ga0395900_0383674_149_865 202
545 3300037418 Ga0395900_0424389 Ga0395900_0424389_168_884 202
546 3300037418 Ga0395900_0745332 Ga0395900_0745332_73_789 202
547 3300037466 Ga0395898_0002752 Ga0395898_0002752_8200_8916 202
548 3300037466 Ga0395898_0015887 Ga0395898_0015887_1059_1775 202
549 3300037466 Ga0395898_0023552 Ga0395898_0023552_3559_4269 202
550 3300037466 Ga0395898_0038075 Ga0395898_0038075_2360_3070 202
551 3300037466 Ga0395898_0086016 Ga0395898_0086016_1918_2634 202
552 3300037466 Ga0395898_0138627 Ga0395898_0138627_946_1662 202
553 3300037466 Ga0395898_0148137 Ga0395898_0148137_884_1594 202
554 3300037466 Ga0395898_0300187 Ga0395898_0300187_424_1140 202
555 3300037466 Ga0395898_0468829 Ga0395898_0468829_24_740 202
556 3300037466 Ga0395898_0514898 Ga0395898_0514898_202_918 202
557 3300037466 Ga0395898_0680098 Ga0395898_0680098_12_725 202
558 3300037471 Ga0395905_0001949 Ga0395905_0001949_18153_18869 202
559 3300037471 Ga0395905_0002085 Ga0395905_0002085_7925_8641 202
560 3300037471 Ga0395905_0002354 Ga0395905_0002354_14424_15140 202
561 3300037471 Ga0395905_0004344 Ga0395905_0004344_9151_9867 202
562 3300037471 Ga0395905_0023342 Ga0395905_0023342_3371_4087 202
563 3300037471 Ga0395905_0059803 Ga0395905_0059803_23_739 202
564 3300037471 Ga0395905_0062683 Ga0395905_0062683_636_1352 202
565 3300037471 Ga0395905_0169949 Ga0395905_0169949_1418_2029 202
566 3300037471 Ga0395905_0199777 Ga0395905_0199777_37_753 202
567 3300037471 Ga0395905_0245036 Ga0395905_0245036_32_748 202
568 3300037471 Ga0395905_0282647 Ga0395905_0282647_323_1039 202
569 3300037471 Ga0395905_0354439 Ga0395905_0354439_522_1238 202
570 3300037471 Ga0395905_0651032 Ga0395905_0651032_203_919 202
571 3300037853 Ga0436364_1467667 Ga0436364_1467667_4853_5569 202
572 3300038443 Ga0395901_0019953 Ga0395901_0019953_4723_5439 202
573 3300038443 Ga0395901_0024645 Ga0395901_0024645_1729_2445 202
574 3300038443 Ga0395901_0036995 Ga0395901_0036995_2041_2757 202
575 3300038443 Ga0395901_0043000 Ga0395901_0043000_3884_4600 202
576 3300038443 Ga0395901_0045097 Ga0395901_0045097_325_1035 202
577 3300038443 Ga0395901_0056704 Ga0395901_0056704_23_739 202
578 3300038443 Ga0395901_0079393 Ga0395901_0079393_1494_2210 202
579 3300038443 Ga0395901_0120186 Ga0395901_0120186_1891_2607 202
580 3300038443 Ga0395901_0193330 Ga0395901_0193330_829_1542 202
581 3300038443 Ga0395901_0231156 Ga0395901_0231156_325_1041 202
582 3300038443 Ga0395901_0245020 Ga0395901_0245020_846_1562 202
583 3300038443 Ga0395901_0260179 Ga0395901_0260179_738_1454 202
584 3300038443 Ga0395901_0260622 Ga0395901_0260622_564_1280 202
585 3300038443 Ga0395901_0286477 Ga0395901_0286477_83_799 202
586 3300042000 Ga0439437_001938 Ga0439437_001938_546_1262 202
587 3300042006 Ga0439432_016256 Ga0439432_016256_539_1255 202
588 3300042006 Ga0439432_108353 Ga0439432_108353_10_726 202
589 3300042012 Ga0439455_0002616 Ga0439455_0002616_1071_1784 202
590 3300042132 Ga0450895_007553 Ga0450895_007553_95_811 202
591 3300042145 Ga0450906_014645 Ga0450906_014645_68_784 202
592 3300042157 Ga0439458_0000679 Ga0439458_0000679_6902_7618 202
593 3300042157 Ga0439458_0009670 Ga0439458_0009670_127_843 202
594 3300042876 Ga0451577_0474463 Ga0451577_0474463_181_897 202
595 3300044656 Ga0466969_0001359 Ga0466969_0001359_10573_11283 202
596 3300044684 Ga0466966_0000001 Ga0466966_0000001_209290_210000 202
597 3300044684 Ga0466966_0217631 Ga0466966_0217631_254_964 202
598 3300044693 Ga0466961_0004065 Ga0466961_0004065_5114_5824 202
599 3300044693 Ga0466961_0044556 Ga0466961_0044556_888_1604 202
600 3300044693 Ga0466961_0117927 Ga0466961_0117927_719_1438 202
601 3300044694 Ga0466963_0032241 Ga0466963_0032241_2153_2863 202
602 3300044694 Ga0466963_0040516 Ga0466963_0040516_1631_2341 202
603 3300044694 Ga0466963_0165159 Ga0466963_0165159_498_1214 202
604 3300044694 Ga0466963_0262409 Ga0466963_0262409_114_830 202
605 3300044719 Ga0466971_0004819 Ga0466971_0004819_4462_5172 202
606 3300044719 Ga0466971_0043076 Ga0466971_0043076_944_1660 202
607 3300044765 Ga0466970_0002777 Ga0466970_0002777_4396_5106 202
608 3300044842 Ga0466957_0001016 Ga0466957_0001016_8350_9060 202
609 3300044842 Ga0466957_0028790 Ga0466957_0028790_1065_1781 202
610 3300044842 Ga0466957_0042385 Ga0466957_0042385_11_622 202
611 3300044842 Ga0466957_0063940 Ga0466957_0063940_602_1318 202
612 3300044842 Ga0466957_0127568 Ga0466957_0127568_513_1229 202
613 3300045049 Ga0466959_0098283 Ga0466959_0098283_477_1193 202
614 3300045049 Ga0466959_0148018 Ga0466959_0148018_535_1251 202
615 3300045049 Ga0466959_0215057 Ga0466959_0215057_488_1198 202
616 3300045836 Ga0466958_0019300 Ga0466958_0019300_3068_3778 202
617 3300045836 Ga0466958_0035396 Ga0466958_0035396_1609_2325 202
618 3300045836 Ga0466958_0237934 Ga0466958_0237934_361_1077 202
619 3300045836 Ga0466958_0271492 Ga0466958_0271492_157_873 202
620 3300045836 Ga0466958_0317337 Ga0466958_0317337_54_767 202
621 3300045976 Ga0466967_0022899 Ga0466967_0022899_1338_2054 202
622 3300045976 Ga0466967_0034090 Ga0466967_0034090_2363_3079 202
623 3300045976 Ga0466967_0179801 Ga0466967_0179801_706_1422 202
624 3300046537 Ga0495598_0137298 Ga0495598_0137298_100_816 202
625 3300046616 Ga0495668_0048011 Ga0495668_0048011_371_1087 202
626 3300046684 Ga0495669_0094186 Ga0495669_0094186_147_863 202
627 3300046691 Ga0495670_0102076 Ga0495670_0102076_657_1373 202
628 3300048904 Ga0496101_0049454 Ga0496101_0049454_1413_2129 202
629 3300048904 Ga0496101_0093823 Ga0496101_0093823_653_1369 202
630 3300048905 Ga0496102_0150383 Ga0496102_0150383_291_1007 202
631 3300048906 Ga0496103_0517714 Ga0496103_0517714_24_704 202
632 3300048907 Ga0496104_0128694 Ga0496104_0128694_1413_2129 202
633 3300048908 Ga0496105_0084391 Ga0496105_0084391_1121_1837 202
634 3300048908 Ga0496105_0112299 Ga0496105_0112299_1332_2048 202
635 3300048909 Ga0496106_0066213 Ga0496106_0066213_1001_1717 202
636 3300048909 Ga0496106_0129690 Ga0496106_0129690_748_1464 202
637 3300048910 Ga0496107_0015391 Ga0496107_0015391_765_1484 202
638 3300048910 Ga0496107_0071527 Ga0496107_0071527_1761_2477 202
639 3300048910 Ga0496107_0408690 Ga0496107_0408690_69_785 202
640 3300048910 Ga0496107_0479089 Ga0496107_0479089_45_761 202
641 3300048911 Ga0496108_0105817 Ga0496108_0105817_771_1487 202
642 3300048911 Ga0496108_0188003 Ga0496108_0188003_72_788 202
643 3300048911 Ga0496108_0454371 Ga0496108_0454371_242_961 202
644 3300048913 Ga0496110_0046380 Ga0496110_0046380_1941_2660 202
645 3300048913 Ga0496110_0110014 Ga0496110_0110014_642_1358 202
646 3300048913 Ga0496110_0295173 Ga0496110_0295173_62_778 202
647 3300048915 Ga0496112_0000602 Ga0496112_0000602_23741_24457 202
648 3300048915 Ga0496112_0048688 Ga0496112_0048688_700_1416 202
649 3300048915 Ga0496112_0645636 Ga0496112_0645636_41_757 202
650 3300048916 Ga0496113_0147461 Ga0496113_0147461_444_1160 202
651 3300048917 Ga0496114_0012266 Ga0496114_0012266_2324_3043 202
652 3300048917 Ga0496114_0510746 Ga0496114_0510746_130_846 202
653 3300053134 Ga0500658_0003570 Ga0500658_0003570_118_834 202
654 3300061719 Ga0466962_0006762 Ga0466962_0006762_3088_3804 202
655 3300005339 Ga0070660_100077617 Ga0070660_1000776172 203
656 3300025926 Ga0207659_10070580 Ga0207659_100705804 203
657 3300032126 Ga0307415_100079876 Ga0307415_1000798762 204
658 3300032126 Ga0307415_100440177 Ga0307415_1004401772 204
659 3300035111 Ga0373923_0068276 Ga0373923_0068276_521_1225 204
660 3300005327 Ga0070658_10292838 Ga0070658_102928382 205
661 3300013296 Ga0157374_10149969 Ga0157374_101499692 205
662 3300031548 Ga0307408_100083961 Ga0307408_1000839613 206
663 3300031824 Ga0307413_10042672 Ga0307413_100426722 206
664 3300032126 Ga0307415_100151259 Ga0307415_1001512592 206
665 3300005436 Ga0070713_100238374 Ga0070713_1002383742 210
666 3300037312 Ga0395899_0004509 Ga0395899_0004509_5225_5965 210
667 3300037466 Ga0395898_0007693 Ga0395898_0007693_5649_6389 210
668 3300037471 Ga0395905_0006447 Ga0395905_0006447_5340_6080 210
669 3300037471 Ga0395905_0071127 Ga0395905_0071127_1169_1909 210
670 3300001979 JGI24740J21852_10019537 JGI24740J21852_100195372 211
671 3300001990 JGI24737J22298_10004000 JGI24737J22298_100040002 211
672 3300005457 Ga0070662_100153785 Ga0070662_1001537852 211
673 3300005530 Ga0070679_100111295 Ga0070679_1001112952 211
674 3300010375 Ga0105239_10500934 Ga0105239_105009341 211
675 3300013100 Ga0157373_10028202 Ga0157373_100282023 211
676 3300013307 Ga0157372_10153558 Ga0157372_101535582 211
677 3300025921 Ga0207652_10580523 Ga0207652_105805231 211
678 3300025933 Ga0207706_10153509 Ga0207706_101535092 211
679 3300025949 Ga0207667_10441964 Ga0207667_104419642 211
680 3300037312 Ga0395899_0000416 Ga0395899_0000416_2805_3548 211
681 3300001904 JGI24736J21556_1005791 JGI24736J21556_10057912 215
682 3300005344 Ga0070661_100494182 Ga0070661_1004941822 215
683 3300005455 Ga0070663_100020888 Ga0070663_1000208884 215
684 3300005614 Ga0068856_100004105 Ga0068856_1000041053 215
685 3300026067 Ga0207678_10365789 Ga0207678_103657892 215
686 3300026142 Ga0207698_10010670 Ga0207698_100106703 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

9

204

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

15

224

0.92

PF08659

KR

KR domain

10

191

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i1j-assembly1.cif.gz_A structure of a putative short chain dehydrogenase from pseudomonas syringae 0.8867 5 199
3gy0-assembly1.cif.gz_A-2 crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 complexed with nadp 0.8863 6 199
3g1t-assembly1.cif.gz_A-2 crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 0.8856 5 199
4z0t-assembly1.cif.gz_A crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis 0.8848 5 199
3gz4-assembly1.cif.gz_B crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with nadph 0.8834 6 199
ID Description Score Start End Superfamily
4z0tA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8848 5 199 3.40.50.720
3i1jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8668 5 201 3.40.50.720
af_Q9VR28_44_308_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8637 7 200 3.40.50.720
af_Q9T0G0_32_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8584 3 160 3.40.50.720
af_Q3B7V0_30_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8582 5 200 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3CU73-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9387 62 201 GO:0016491
AF-A0A2G1YM31-F1-model_v4 Oxidoreductase 0.9273 11 201 GO:0016491
AF-A0A4Q3C5C6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.925 48 201 GO:0016491
AF-A0A5C6TX84-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9248 5 201 GO:0016020
GO:0016491
AF-A0A7T2LMA6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9247 5 201 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
86.23 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map