F475168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 686 | 233 | 686 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_100494182|Ga0070661_1004941822 |
| Length | 249 |
| Sequence | MNDKPLFGKLALVTGASRGIGAATAEALAKAGAHVILVARSSAALEEIEERIHQAGGSATIAPLDLTEGEGVGKLAAAVAARWEKLDILMLNAAMLGSLSPVQDIDAKEYARLLTLNVSANQALIAAFDPMLRKAQGDVVAVTSSVGHVPRAFWGAYGSSKAALENLLLTYADETQTVGKIRVHVIDPGATRTRMRALAFPGEEPEDVKPPEVVAGFILERLLSDAPTGEMVRVNGRGLRSDASSDTTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 158 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 159 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 184 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 185 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 186 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 187 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 188 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 230 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 232 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 233 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.94 |
| Nodule | 0 |
| Rhizoplane | 4.08 |
| Rhizosphere | 90.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1005791 | 3300001904 | Bacteria | 2087 |
| 2 | JGI24740J21852_10019537 | 3300001979 | Bacteria | 2385 |
| 3 | JGI24739J22299_10003131 | 3300001989 | Bacteria | 6310 |
| 4 | JGI24737J22298_10004000 | 3300001990 | Bacteria | 5158 |
| 5 | JGI24737J22298_10021171 | 3300001990 | Bacteria | 2074 |
| 6 | JGI24737J22298_10054431 | 3300001990 | Bacteria | 1211 |
| 7 | JGI24743J22301_10017318 | 3300001991 | Bacteria | 1352 |
| 8 | JGI24738J21930_10001952 | 3300002075 | Bacteria | 5560 |
| 9 | JGI25150J39212_1000285 | 3300002774 | Bacteria | 26336 |
| 10 | JGI25153J46596_10000044 | 3300003215 | Bacteria | 154263 |
| 11 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 12 | Ga0055536_1035025 | 3300003781 | Bacteria | 1261 |
| 13 | Ga0055530_10012785 | 3300003791 | Bacteria | 2906 |
| 14 | Ga0055530_10027885 | 3300003791 | Bacteria | 1534 |
| 15 | Ga0055540_1004324 | 3300003792 | Bacteria | 6462 |
| 16 | Ga0055531_10032146 | 3300003794 | Bacteria | 1720 |
| 17 | Ga0055531_10033121 | 3300003794 | Bacteria | 1671 |
| 18 | Ga0065715_10104714 | 3300005293 | Bacteria | 2905 |
| 19 | Ga0070658_10000379 | 3300005327 | Bacteria | 38762 |
| 20 | Ga0070658_10000850 | 3300005327 | Bacteria | 26066 |
| 21 | Ga0070658_10017653 | 3300005327 | Bacteria | 5708 |
| 22 | Ga0070658_10060472 | 3300005327 | Bacteria | 3085 |
| 23 | Ga0070658_10202894 | 3300005327 | Bacteria | 1673 |
| 24 | Ga0070658_10292838 | 3300005327 | Bacteria | 1387 |
| 25 | Ga0070658_10471029 | 3300005327 | Bacteria | 1083 |
| 26 | Ga0070658_10473420 | 3300005327 | Bacteria | 1080 |
| 27 | Ga0070676_10033934 | 3300005328 | Bacteria | 2928 |
| 28 | Ga0070676_10081352 | 3300005328 | Bacteria | 1966 |
| 29 | Ga0070683_100001218 | 3300005329 | Bacteria | 19546 |
| 30 | Ga0070683_100014840 | 3300005329 | Bacteria | 6829 |
| 31 | Ga0070683_100146333 | 3300005329 | Bacteria | 2239 |
| 32 | Ga0070683_100369281 | 3300005329 | Bacteria | 1367 |
| 33 | Ga0070683_100370875 | 3300005329 | Bacteria | 1363 |
| 34 | Ga0070690_100018174 | 3300005330 | Bacteria | 4241 |
| 35 | Ga0070670_100015317 | 3300005331 | Bacteria | 6585 |
| 36 | Ga0070670_100232323 | 3300005331 | Bacteria | 1605 |
| 37 | Ga0070670_100233788 | 3300005331 | Bacteria | 1600 |
| 38 | Ga0070670_100322921 | 3300005331 | Bacteria | 1353 |
| 39 | Ga0070670_100353881 | 3300005331 | Bacteria | 1290 |
| 40 | Ga0070677_10055072 | 3300005333 | Bacteria | 1622 |
| 41 | Ga0070666_10000555 | 3300005335 | Bacteria | 22543 |
| 42 | Ga0070666_10000788 | 3300005335 | Bacteria | 19216 |
| 43 | Ga0070666_10003797 | 3300005335 | Bacteria | 9162 |
| 44 | Ga0070666_10134273 | 3300005335 | Bacteria | 1721 |
| 45 | Ga0070680_100000600 | 3300005336 | Bacteria | 24915 |
| 46 | Ga0070680_100191965 | 3300005336 | Bacteria | 1721 |
| 47 | Ga0070680_100235000 | 3300005336 | Bacteria | 1548 |
| 48 | Ga0070680_100238700 | 3300005336 | Bacteria | 1536 |
| 49 | Ga0070680_100633744 | 3300005336 | Bacteria | 918 |
| 50 | Ga0068868_100000211 | 3300005338 | Bacteria | 39269 |
| 51 | Ga0068868_100011949 | 3300005338 | Bacteria | 6334 |
| 52 | Ga0070660_100001859 | 3300005339 | Bacteria | 14533 |
| 53 | Ga0070660_100002066 | 3300005339 | Bacteria | 13865 |
| 54 | Ga0070660_100014573 | 3300005339 | Bacteria | 5670 |
| 55 | Ga0070660_100031328 | 3300005339 | Bacteria | 3993 |
| 56 | Ga0070660_100033386 | 3300005339 | Bacteria | 3880 |
| 57 | Ga0070660_100037874 | 3300005339 | Bacteria | 3657 |
| 58 | Ga0070660_100064368 | 3300005339 | Bacteria | 2852 |
| 59 | Ga0070660_100074313 | 3300005339 | Bacteria | 2659 |
| 60 | Ga0070660_100077617 | 3300005339 | Bacteria | 2603 |
| 61 | Ga0070660_100188524 | 3300005339 | Bacteria | 1670 |
| 62 | Ga0070660_100306520 | 3300005339 | Bacteria | 1303 |
| 63 | Ga0070660_100402887 | 3300005339 | Bacteria | 1131 |
| 64 | Ga0070660_100533921 | 3300005339 | Bacteria | 978 |
| 65 | Ga0070689_100079995 | 3300005340 | Bacteria | 2565 |
| 66 | Ga0070687_100048833 | 3300005343 | Bacteria | 2178 |
| 67 | Ga0070661_100011344 | 3300005344 | Bacteria | 6210 |
| 68 | Ga0070661_100333617 | 3300005344 | Bacteria | 1186 |
| 69 | Ga0070661_100494182 | 3300005344 | Bacteria | 979 |
| 70 | Ga0070661_100600262 | 3300005344 | Bacteria | 890 |
| 71 | Ga0070661_100665251 | 3300005344 | Bacteria | 846 |
| 72 | Ga0070692_10013735 | 3300005345 | Bacteria | 3783 |
| 73 | Ga0070692_10042744 | 3300005345 | Bacteria | 2328 |
| 74 | Ga0070668_100084106 | 3300005347 | Bacteria | 2499 |
| 75 | Ga0070668_100448989 | 3300005347 | Bacteria | 1108 |
| 76 | Ga0070668_100692893 | 3300005347 | Bacteria | 898 |
| 77 | Ga0070669_100036110 | 3300005353 | Bacteria | 3580 |
| 78 | Ga0070669_100036391 | 3300005353 | Bacteria | 3567 |
| 79 | Ga0070669_100047337 | 3300005353 | Bacteria | 3137 |
| 80 | Ga0070675_100017003 | 3300005354 | Bacteria | 5779 |
| 81 | Ga0070675_100093783 | 3300005354 | Bacteria | 2518 |
| 82 | Ga0070675_100138612 | 3300005354 | Bacteria | 2078 |
| 83 | Ga0070671_100008209 | 3300005355 | Bacteria | 8356 |
| 84 | Ga0070671_100011218 | 3300005355 | Bacteria | 7196 |
| 85 | Ga0070671_100036176 | 3300005355 | Bacteria | 4093 |
| 86 | Ga0070671_100101520 | 3300005355 | Bacteria | 2414 |
| 87 | Ga0070674_100000748 | 3300005356 | Bacteria | 16655 |
| 88 | Ga0070674_100033523 | 3300005356 | Bacteria | 3420 |
| 89 | Ga0070674_100069808 | 3300005356 | Bacteria | 2480 |
| 90 | Ga0070674_100134949 | 3300005356 | Bacteria | 1845 |
| 91 | Ga0070673_100007938 | 3300005364 | Bacteria | 7036 |
| 92 | Ga0070673_100044036 | 3300005364 | Bacteria | 3453 |
| 93 | Ga0070673_100123390 | 3300005364 | Bacteria | 2164 |
| 94 | Ga0070673_100282530 | 3300005364 | Bacteria | 1456 |
| 95 | Ga0070673_100548490 | 3300005364 | Bacteria | 1050 |
| 96 | Ga0070659_100024266 | 3300005366 | Bacteria | 4648 |
| 97 | Ga0070659_100057384 | 3300005366 | Bacteria | 3070 |
| 98 | Ga0070659_100078933 | 3300005366 | Bacteria | 2627 |
| 99 | Ga0070659_100080262 | 3300005366 | Bacteria | 2604 |
| 100 | Ga0070659_100087124 | 3300005366 | Bacteria | 2500 |
| 101 | Ga0070659_100188514 | 3300005366 | Bacteria | 1694 |
| 102 | Ga0070667_100001014 | 3300005367 | Bacteria | 25719 |
| 103 | Ga0070667_100003689 | 3300005367 | Bacteria | 13031 |
| 104 | Ga0070667_100005056 | 3300005367 | Bacteria | 11037 |
| 105 | Ga0070667_100018198 | 3300005367 | Bacteria | 5825 |
| 106 | Ga0070667_100613747 | 3300005367 | Bacteria | 1003 |
| 107 | Ga0070713_100014792 | 3300005436 | Bacteria | 5807 |
| 108 | Ga0070713_100238374 | 3300005436 | Bacteria | 1656 |
| 109 | Ga0070663_100001179 | 3300005455 | Bacteria | 14386 |
| 110 | Ga0070663_100020888 | 3300005455 | Bacteria | 4342 |
| 111 | Ga0070663_100272338 | 3300005455 | Bacteria | 1346 |
| 112 | Ga0070663_100443191 | 3300005455 | Bacteria | 1069 |
| 113 | Ga0070663_100549921 | 3300005455 | Bacteria | 965 |
| 114 | Ga0070678_100065818 | 3300005456 | Bacteria | 2692 |
| 115 | Ga0070678_100196689 | 3300005456 | Bacteria | 1661 |
| 116 | Ga0070662_100004894 | 3300005457 | Bacteria | 8502 |
| 117 | Ga0070662_100008268 | 3300005457 | Bacteria | 6777 |
| 118 | Ga0070662_100009507 | 3300005457 | Bacteria | 6359 |
| 119 | Ga0070662_100021117 | 3300005457 | Bacteria | 4443 |
| 120 | Ga0070662_100153785 | 3300005457 | Bacteria | 1794 |
| 121 | Ga0070662_100219374 | 3300005457 | Bacteria | 1517 |
| 122 | Ga0070681_10103530 | 3300005458 | Bacteria | 2791 |
| 123 | Ga0068867_100145558 | 3300005459 | Bacteria | 1856 |
| 124 | Ga0068867_100203179 | 3300005459 | Bacteria | 1587 |
| 125 | Ga0070679_100075000 | 3300005530 | Bacteria | 3373 |
| 126 | Ga0070679_100111295 | 3300005530 | Bacteria | 2724 |
| 127 | Ga0070679_100129217 | 3300005530 | Bacteria | 2508 |
| 128 | Ga0070684_100648527 | 3300005535 | Bacteria | 983 |
| 129 | Ga0068853_100018513 | 3300005539 | Bacteria | 5767 |
| 130 | Ga0070672_100010078 | 3300005543 | Bacteria | 6543 |
| 131 | Ga0070672_100222162 | 3300005543 | Bacteria | 1585 |
| 132 | Ga0070672_100230499 | 3300005543 | Bacteria | 1556 |
| 133 | Ga0070686_100075696 | 3300005544 | Bacteria | 2214 |
| 134 | Ga0070665_100000044 | 3300005548 | Bacteria | 276702 |
| 135 | Ga0070665_100003221 | 3300005548 | Bacteria | 17544 |
| 136 | Ga0070665_100106428 | 3300005548 | Bacteria | 2807 |
| 137 | Ga0070665_100797092 | 3300005548 | Bacteria | 958 |
| 138 | Ga0068855_100000300 | 3300005563 | Bacteria | 61687 |
| 139 | Ga0070664_100006228 | 3300005564 | Bacteria | 9635 |
| 140 | Ga0070664_100008802 | 3300005564 | Bacteria | 8178 |
| 141 | Ga0070664_100082623 | 3300005564 | Bacteria | 2770 |
| 142 | Ga0068857_100021293 | 3300005577 | Bacteria | 5708 |
| 143 | Ga0068857_100025988 | 3300005577 | Bacteria | 5157 |
| 144 | Ga0068854_100000728 | 3300005578 | Bacteria | 19507 |
| 145 | Ga0068854_100277704 | 3300005578 | Bacteria | 1347 |
| 146 | Ga0068856_100004105 | 3300005614 | Bacteria | 14555 |
| 147 | Ga0068856_100028489 | 3300005614 | Bacteria | 5454 |
| 148 | Ga0068856_100030135 | 3300005614 | Bacteria | 5303 |
| 149 | Ga0068856_100066022 | 3300005614 | Bacteria | 3575 |
| 150 | Ga0068856_100135622 | 3300005614 | Bacteria | 2466 |
| 151 | Ga0068856_100145541 | 3300005614 | Unclassified | 2377 |
| 152 | Ga0068856_100252822 | 3300005614 | Bacteria | 1777 |
| 153 | Ga0068852_100093936 | 3300005616 | Bacteria | 2689 |
| 154 | Ga0068852_100659547 | 3300005616 | Bacteria | 1054 |
| 155 | Ga0068859_100064821 | 3300005617 | Bacteria | 3686 |
| 156 | Ga0068859_100115375 | 3300005617 | Bacteria | 2750 |
| 157 | Ga0068864_100282586 | 3300005618 | Bacteria | 1549 |
| 158 | Ga0068864_100494293 | 3300005618 | Bacteria | 1176 |
| 159 | Ga0068866_10033567 | 3300005718 | Bacteria | 2491 |
| 160 | Ga0068861_100202619 | 3300005719 | Bacteria | 1667 |
| 161 | Ga0068851_10032450 | 3300005834 | Bacteria | 2599 |
| 162 | Ga0068851_10069902 | 3300005834 | Bacteria | 1815 |
| 163 | Ga0068851_10097261 | 3300005834 | Bacteria | 1558 |
| 164 | Ga0068870_10330320 | 3300005840 | Bacteria | 972 |
| 165 | Ga0068863_100161988 | 3300005841 | Bacteria | 2143 |
| 166 | Ga0068863_100166116 | 3300005841 | Bacteria | 2116 |
| 167 | Ga0068858_100004134 | 3300005842 | Bacteria | 14284 |
| 168 | Ga0068858_100101070 | 3300005842 | Bacteria | 2689 |
| 169 | Ga0068860_100206806 | 3300005843 | Bacteria | 1904 |
| 170 | Ga0068862_100056641 | 3300005844 | Bacteria | 3359 |
| 171 | Ga0068862_100186131 | 3300005844 | Bacteria | 1866 |
| 172 | Ga0081539_10023788 | 3300005985 | Bacteria | 3999 |
| 173 | Ga0070717_10002352 | 3300006028 | Bacteria | 13323 |
| 174 | Ga0070717_10311119 | 3300006028 | Bacteria | 1402 |
| 175 | Ga0075369_10062208 | 3300006186 | Bacteria | 1630 |
| 176 | Ga0075366_10011090 | 3300006195 | Bacteria | 5078 |
| 177 | Ga0097621_100036752 | 3300006237 | Bacteria | 3919 |
| 178 | Ga0097621_100048429 | 3300006237 | Bacteria | 3448 |
| 179 | Ga0097621_100186068 | 3300006237 | Bacteria | 1796 |
| 180 | Ga0068871_100026164 | 3300006358 | Bacteria | 4550 |
| 181 | Ga0068865_100017616 | 3300006881 | Bacteria | 4597 |
| 182 | Ga0068865_100039821 | 3300006881 | Bacteria | 3189 |
| 183 | Ga0097620_100064824 | 3300006931 | Bacteria | 3686 |
| 184 | Ga0097620_100115367 | 3300006931 | Bacteria | 2750 |
| 185 | Ga0105240_10008636 | 3300009093 | Bacteria | 14555 |
| 186 | Ga0105240_10109400 | 3300009093 | Bacteria | 3347 |
| 187 | Ga0105240_10207308 | 3300009093 | Bacteria | 2293 |
| 188 | Ga0111539_10259093 | 3300009094 | Bacteria | 2025 |
| 189 | Ga0111539_10583676 | 3300009094 | Bacteria | 1302 |
| 190 | Ga0105245_10135945 | 3300009098 | Bacteria | 2310 |
| 191 | Ga0105243_10000038 | 3300009148 | Bacteria | 174351 |
| 192 | Ga0105243_10040865 | 3300009148 | Bacteria | 3625 |
| 193 | Ga0105243_10078506 | 3300009148 | Bacteria | 2688 |
| 194 | Ga0105242_10003245 | 3300009176 | Bacteria | 12685 |
| 195 | Ga0105248_10000442 | 3300009177 | Bacteria | 47089 |
| 196 | Ga0105248_10003885 | 3300009177 | Bacteria | 16517 |
| 197 | Ga0105248_10042951 | 3300009177 | Bacteria | 5069 |
| 198 | Ga0105248_10184947 | 3300009177 | Bacteria | 2348 |
| 199 | Ga0105248_10452542 | 3300009177 | Bacteria | 1447 |
| 200 | Ga0105237_10734784 | 3300009545 | Bacteria | 993 |
| 201 | Ga0105238_10004331 | 3300009551 | Bacteria | 14084 |
| 202 | Ga0105238_10111619 | 3300009551 | Bacteria | 2714 |
| 203 | Ga0105239_10097099 | 3300010375 | Bacteria | 3256 |
| 204 | Ga0105239_10189608 | 3300010375 | Bacteria | 2302 |
| 205 | Ga0105239_10500934 | 3300010375 | Bacteria | 1381 |
| 206 | Ga0105246_10337381 | 3300011119 | Bacteria | 1230 |
| 207 | Ga0157373_10009132 | 3300013100 | Bacteria | 7332 |
| 208 | Ga0157373_10010212 | 3300013100 | Bacteria | 6916 |
| 209 | Ga0157373_10020611 | 3300013100 | Bacteria | 4790 |
| 210 | Ga0157373_10028202 | 3300013100 | Bacteria | 4051 |
| 211 | Ga0157371_10003905 | 3300013102 | Bacteria | 13277 |
| 212 | Ga0157371_10030406 | 3300013102 | Bacteria | 3897 |
| 213 | Ga0157371_10041019 | 3300013102 | Bacteria | 3304 |
| 214 | Ga0157371_10092407 | 3300013102 | Bacteria | 2144 |
| 215 | Ga0157371_10139705 | 3300013102 | Bacteria | 1725 |
| 216 | Ga0157371_10225805 | 3300013102 | Bacteria | 1345 |
| 217 | Ga0157371_10273084 | 3300013102 | Bacteria | 1220 |
| 218 | Ga0157371_10388972 | 3300013102 | Bacteria | 1019 |
| 219 | Ga0157370_10076239 | 3300013104 | Bacteria | 3159 |
| 220 | Ga0157370_10131571 | 3300013104 | Bacteria | 2334 |
| 221 | Ga0157370_10264547 | 3300013104 | Bacteria | 1589 |
| 222 | Ga0157370_10576355 | 3300013104 | Bacteria | 1031 |
| 223 | Ga0157369_10001743 | 3300013105 | Bacteria | 26402 |
| 224 | Ga0157369_10008003 | 3300013105 | Bacteria | 12139 |
| 225 | Ga0157369_10012108 | 3300013105 | Bacteria | 9794 |
| 226 | Ga0157369_10032646 | 3300013105 | Bacteria | 5723 |
| 227 | Ga0157369_10146486 | 3300013105 | Bacteria | 2497 |
| 228 | Ga0157369_10268978 | 3300013105 | Bacteria | 1777 |
| 229 | Ga0157374_10003127 | 3300013296 | Bacteria | 13908 |
| 230 | Ga0157374_10113722 | 3300013296 | Bacteria | 2605 |
| 231 | Ga0157374_10149969 | 3300013296 | Bacteria | 2266 |
| 232 | Ga0157374_10162164 | 3300013296 | Bacteria | 2177 |
| 233 | Ga0157378_10104322 | 3300013297 | Bacteria | 2591 |
| 234 | Ga0157378_10160910 | 3300013297 | Bacteria | 2099 |
| 235 | Ga0157372_10066311 | 3300013307 | Bacteria | 4055 |
| 236 | Ga0157372_10077125 | 3300013307 | Bacteria | 3763 |
| 237 | Ga0157372_10153558 | 3300013307 | Bacteria | 2658 |
| 238 | Ga0157375_10296300 | 3300013308 | Bacteria | 1781 |
| 239 | Ga0157375_10445469 | 3300013308 | Bacteria | 1460 |
| 240 | Ga0163163_10022654 | 3300014325 | Bacteria | 5953 |
| 241 | Ga0163163_10060370 | 3300014325 | Bacteria | 3754 |
| 242 | Ga0157377_10315766 | 3300014745 | Bacteria | 1036 |
| 243 | Ga0157377_10446535 | 3300014745 | Bacteria | 892 |
| 244 | Ga0157379_10095548 | 3300014968 | Bacteria | 2667 |
| 245 | Ga0157379_10690849 | 3300014968 | Bacteria | 957 |
| 246 | Ga0157376_10161811 | 3300014969 | Bacteria | 2030 |
| 247 | Ga0157376_10241116 | 3300014969 | Bacteria | 1684 |
| 248 | Ga0163161_10001335 | 3300017792 | Bacteria | 18330 |
| 249 | Ga0213875_10039040 | 3300021388 | Bacteria | 2237 |
| 250 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 251 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 252 | Ga0209676_1018236 | 3300025292 | Bacteria | 2454 |
| 253 | Ga0209025_1000726 | 3300025294 | Bacteria | 55863 |
| 254 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 255 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 256 | Ga0209050_1005087 | 3300025298 | Bacteria | 8478 |
| 257 | Ga0209051_1000793 | 3300025303 | Bacteria | 33269 |
| 258 | Ga0209051_1016432 | 3300025303 | Bacteria | 3348 |
| 259 | Ga0209257_1000617 | 3300025304 | Bacteria | 57694 |
| 260 | Ga0209257_1000633 | 3300025304 | Bacteria | 56365 |
| 261 | Ga0207697_10074595 | 3300025315 | Bacteria | 1425 |
| 262 | Ga0207656_10033586 | 3300025321 | Bacteria | 2138 |
| 263 | Ga0207682_10004604 | 3300025893 | Bacteria | 5741 |
| 264 | Ga0207682_10047348 | 3300025893 | Bacteria | 1770 |
| 265 | Ga0207680_10001223 | 3300025903 | Bacteria | 12131 |
| 266 | Ga0207680_10001981 | 3300025903 | Bacteria | 9583 |
| 267 | Ga0207680_10138489 | 3300025903 | Bacteria | 1611 |
| 268 | Ga0207680_10284722 | 3300025903 | Bacteria | 1149 |
| 269 | Ga0207647_10005192 | 3300025904 | Bacteria | 9581 |
| 270 | Ga0207647_10026990 | 3300025904 | Bacteria | 3748 |
| 271 | Ga0207647_10107202 | 3300025904 | Bacteria | 1653 |
| 272 | Ga0207645_10015870 | 3300025907 | Bacteria | 4990 |
| 273 | Ga0207645_10026228 | 3300025907 | Bacteria | 3766 |
| 274 | Ga0207645_10077456 | 3300025907 | Bacteria | 2130 |
| 275 | Ga0207645_10080726 | 3300025907 | Bacteria | 2085 |
| 276 | Ga0207643_10312897 | 3300025908 | Bacteria | 979 |
| 277 | Ga0207705_10000060 | 3300025909 | Bacteria | 152576 |
| 278 | Ga0207705_10000429 | 3300025909 | Bacteria | 36649 |
| 279 | Ga0207705_10000779 | 3300025909 | Bacteria | 26154 |
| 280 | Ga0207705_10003393 | 3300025909 | Bacteria | 12111 |
| 281 | Ga0207705_10006538 | 3300025909 | Bacteria | 8634 |
| 282 | Ga0207705_10010399 | 3300025909 | Bacteria | 6766 |
| 283 | Ga0207705_10028693 | 3300025909 | Bacteria | 3966 |
| 284 | Ga0207705_10051177 | 3300025909 | Bacteria | 2973 |
| 285 | Ga0207705_10051439 | 3300025909 | Bacteria | 2965 |
| 286 | Ga0207705_10070261 | 3300025909 | Bacteria | 2537 |
| 287 | Ga0207705_10178370 | 3300025909 | Bacteria | 1602 |
| 288 | Ga0207705_10345107 | 3300025909 | Bacteria | 1146 |
| 289 | Ga0207707_10195711 | 3300025912 | Bacteria | 1763 |
| 290 | Ga0207707_10477744 | 3300025912 | Bacteria | 1065 |
| 291 | Ga0207695_10001996 | 3300025913 | Bacteria | 31509 |
| 292 | Ga0207695_10024085 | 3300025913 | Bacteria | 6859 |
| 293 | Ga0207660_10083358 | 3300025917 | Bacteria | 2354 |
| 294 | Ga0207660_10450550 | 3300025917 | Bacteria | 1041 |
| 295 | Ga0207662_10070400 | 3300025918 | Bacteria | 2116 |
| 296 | Ga0207657_10000631 | 3300025919 | Bacteria | 37345 |
| 297 | Ga0207657_10004219 | 3300025919 | Bacteria | 15225 |
| 298 | Ga0207657_10004392 | 3300025919 | Bacteria | 14921 |
| 299 | Ga0207657_10004601 | 3300025919 | Bacteria | 14580 |
| 300 | Ga0207657_10005022 | 3300025919 | Bacteria | 13885 |
| 301 | Ga0207657_10044515 | 3300025919 | Bacteria | 3901 |
| 302 | Ga0207657_10066869 | 3300025919 | Bacteria | 3058 |
| 303 | Ga0207657_10087648 | 3300025919 | Bacteria | 2604 |
| 304 | Ga0207649_10000702 | 3300025920 | Bacteria | 21959 |
| 305 | Ga0207649_10160693 | 3300025920 | Bacteria | 1556 |
| 306 | Ga0207649_10238501 | 3300025920 | Bacteria | 1304 |
| 307 | Ga0207652_10187523 | 3300025921 | Bacteria | 1860 |
| 308 | Ga0207652_10580523 | 3300025921 | Bacteria | 1006 |
| 309 | Ga0207652_10863604 | 3300025921 | Bacteria | 801 |
| 310 | Ga0207681_10028101 | 3300025923 | Bacteria | 3642 |
| 311 | Ga0207681_10033974 | 3300025923 | Bacteria | 3349 |
| 312 | Ga0207681_10038492 | 3300025923 | Bacteria | 3169 |
| 313 | Ga0207694_10015718 | 3300025924 | Bacteria | 5709 |
| 314 | Ga0207650_10003954 | 3300025925 | Bacteria | 10140 |
| 315 | Ga0207650_10122814 | 3300025925 | Bacteria | 2024 |
| 316 | Ga0207650_10196151 | 3300025925 | Bacteria | 1615 |
| 317 | Ga0207650_10226637 | 3300025925 | Bacteria | 1506 |
| 318 | Ga0207650_10656957 | 3300025925 | Bacteria | 884 |
| 319 | Ga0207659_10009997 | 3300025926 | Bacteria | 5944 |
| 320 | Ga0207659_10070580 | 3300025926 | Bacteria | 2548 |
| 321 | Ga0207659_10291642 | 3300025926 | Bacteria | 1337 |
| 322 | Ga0207700_10006689 | 3300025928 | Bacteria | 6994 |
| 323 | Ga0207644_10000616 | 3300025931 | Bacteria | 22668 |
| 324 | Ga0207644_10003692 | 3300025931 | Bacteria | 9927 |
| 325 | Ga0207644_10060563 | 3300025931 | Bacteria | 2739 |
| 326 | Ga0207644_10106241 | 3300025931 | Bacteria | 2116 |
| 327 | Ga0207644_10150553 | 3300025931 | Bacteria | 1800 |
| 328 | Ga0207644_10311361 | 3300025931 | Bacteria | 1271 |
| 329 | Ga0207690_10076032 | 3300025932 | Bacteria | 2330 |
| 330 | Ga0207690_10095443 | 3300025932 | Bacteria | 2112 |
| 331 | Ga0207690_10120416 | 3300025932 | Bacteria | 1905 |
| 332 | Ga0207690_10120550 | 3300025932 | Bacteria | 1904 |
| 333 | Ga0207690_10297025 | 3300025932 | Bacteria | 1263 |
| 334 | Ga0207690_10329131 | 3300025932 | Bacteria | 1203 |
| 335 | Ga0207690_10389072 | 3300025932 | Bacteria | 1110 |
| 336 | Ga0207706_10000479 | 3300025933 | Bacteria | 42802 |
| 337 | Ga0207706_10002783 | 3300025933 | Bacteria | 16997 |
| 338 | Ga0207706_10038708 | 3300025933 | Bacteria | 4230 |
| 339 | Ga0207706_10040986 | 3300025933 | Bacteria | 4105 |
| 340 | Ga0207706_10045794 | 3300025933 | Bacteria | 3874 |
| 341 | Ga0207706_10066417 | 3300025933 | Bacteria | 3174 |
| 342 | Ga0207706_10153509 | 3300025933 | Bacteria | 2025 |
| 343 | Ga0207706_10250007 | 3300025933 | Bacteria | 1549 |
| 344 | Ga0207706_10257700 | 3300025933 | Bacteria | 1523 |
| 345 | Ga0207706_10456867 | 3300025933 | Bacteria | 1104 |
| 346 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 347 | Ga0207709_10011963 | 3300025935 | Bacteria | 4784 |
| 348 | Ga0207669_10002114 | 3300025937 | Bacteria | 8422 |
| 349 | Ga0207669_10032531 | 3300025937 | Bacteria | 2930 |
| 350 | Ga0207669_10034651 | 3300025937 | Bacteria | 2863 |
| 351 | Ga0207669_10053893 | 3300025937 | Bacteria | 2426 |
| 352 | Ga0207704_10013390 | 3300025938 | Bacteria | 4102 |
| 353 | Ga0207704_10457906 | 3300025938 | Bacteria | 1019 |
| 354 | Ga0207691_10008185 | 3300025940 | Bacteria | 10041 |
| 355 | Ga0207691_10015613 | 3300025940 | Bacteria | 7219 |
| 356 | Ga0207691_10171780 | 3300025940 | Bacteria | 1898 |
| 357 | Ga0207711_10000526 | 3300025941 | Bacteria | 39259 |
| 358 | Ga0207711_10002857 | 3300025941 | Bacteria | 15139 |
| 359 | Ga0207711_10308580 | 3300025941 | Bacteria | 1460 |
| 360 | Ga0207661_10015344 | 3300025944 | Bacteria | 5635 |
| 361 | Ga0207661_10476366 | 3300025944 | Bacteria | 1139 |
| 362 | Ga0207679_10004129 | 3300025945 | Bacteria | 9019 |
| 363 | Ga0207679_10028047 | 3300025945 | Bacteria | 3902 |
| 364 | Ga0207679_10148717 | 3300025945 | Bacteria | 1903 |
| 365 | Ga0207679_10485370 | 3300025945 | Bacteria | 1101 |
| 366 | Ga0207667_10000187 | 3300025949 | Bacteria | 90766 |
| 367 | Ga0207667_10047524 | 3300025949 | Bacteria | 4542 |
| 368 | Ga0207667_10230028 | 3300025949 | Bacteria | 1899 |
| 369 | Ga0207667_10441964 | 3300025949 | Bacteria | 1322 |
| 370 | Ga0207651_10001053 | 3300025960 | Bacteria | 12220 |
| 371 | Ga0207651_10109559 | 3300025960 | Bacteria | 2069 |
| 372 | Ga0207651_10434429 | 3300025960 | Bacteria | 1123 |
| 373 | Ga0207668_10217452 | 3300025972 | Bacteria | 1532 |
| 374 | Ga0207668_10533687 | 3300025972 | Bacteria | 1014 |
| 375 | Ga0207640_10000830 | 3300025981 | Bacteria | 17599 |
| 376 | Ga0207640_10021319 | 3300025981 | Bacteria | 3861 |
| 377 | Ga0207658_10001939 | 3300025986 | Bacteria | 15445 |
| 378 | Ga0207658_10017829 | 3300025986 | Bacteria | 4892 |
| 379 | Ga0207658_10046725 | 3300025986 | Bacteria | 3163 |
| 380 | Ga0207658_10101906 | 3300025986 | Bacteria | 2251 |
| 381 | Ga0207658_10105929 | 3300025986 | Bacteria | 2212 |
| 382 | Ga0207677_10001135 | 3300026023 | Bacteria | 14530 |
| 383 | Ga0207677_10001443 | 3300026023 | Bacteria | 12627 |
| 384 | Ga0207703_10002018 | 3300026035 | Bacteria | 17909 |
| 385 | Ga0207703_10002744 | 3300026035 | Bacteria | 15084 |
| 386 | Ga0207639_10149300 | 3300026041 | Bacteria | 1956 |
| 387 | Ga0207678_10002632 | 3300026067 | Bacteria | 16348 |
| 388 | Ga0207678_10003960 | 3300026067 | Bacteria | 13321 |
| 389 | Ga0207678_10016075 | 3300026067 | Bacteria | 6571 |
| 390 | Ga0207678_10138649 | 3300026067 | Bacteria | 2076 |
| 391 | Ga0207678_10365789 | 3300026067 | Bacteria | 1245 |
| 392 | Ga0207702_10022091 | 3300026078 | Bacteria | 5271 |
| 393 | Ga0207702_10150514 | 3300026078 | Bacteria | 2116 |
| 394 | Ga0207641_10084623 | 3300026088 | Bacteria | 2761 |
| 395 | Ga0207641_10111335 | 3300026088 | Bacteria | 2427 |
| 396 | Ga0207641_10195067 | 3300026088 | Bacteria | 1863 |
| 397 | Ga0207648_10005222 | 3300026089 | Bacteria | 13134 |
| 398 | Ga0207648_10671450 | 3300026089 | Bacteria | 959 |
| 399 | Ga0207676_10036937 | 3300026095 | Bacteria | 3719 |
| 400 | Ga0207676_10172957 | 3300026095 | Bacteria | 1883 |
| 401 | Ga0207676_10422001 | 3300026095 | Bacteria | 1251 |
| 402 | Ga0207674_10010957 | 3300026116 | Bacteria | 10204 |
| 403 | Ga0207674_10013241 | 3300026116 | Bacteria | 9166 |
| 404 | Ga0207675_100181159 | 3300026118 | Bacteria | 2017 |
| 405 | Ga0207683_10120822 | 3300026121 | Bacteria | 2351 |
| 406 | Ga0207698_10009005 | 3300026142 | Bacteria | 6339 |
| 407 | Ga0207698_10010670 | 3300026142 | Bacteria | 5922 |
| 408 | Ga0207698_10119154 | 3300026142 | Bacteria | 2230 |
| 409 | Ga0207698_10476135 | 3300026142 | Bacteria | 1210 |
| 410 | Ga0207698_10511774 | 3300026142 | Bacteria | 1170 |
| 411 | Ga0209983_1025505 | 3300027665 | Bacteria | 1247 |
| 412 | Ga0209971_1022315 | 3300027682 | Bacteria | 1507 |
| 413 | Ga0209974_10001664 | 3300027876 | Bacteria | 8047 |
| 414 | Ga0209974_10020793 | 3300027876 | Bacteria | 2175 |
| 415 | Ga0209974_10061469 | 3300027876 | Bacteria | 1271 |
| 416 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 417 | Ga0268266_10007662 | 3300028379 | Bacteria | 9706 |
| 418 | Ga0268266_10076820 | 3300028379 | Bacteria | 2903 |
| 419 | Ga0268266_10428874 | 3300028379 | Bacteria | 1254 |
| 420 | Ga0268265_10020526 | 3300028380 | Bacteria | 4611 |
| 421 | Ga0268265_10026561 | 3300028380 | Bacteria | 4121 |
| 422 | Ga0307517_10022167 | 3300028786 | Bacteria | 7973 |
| 423 | Ga0307517_10022587 | 3300028786 | Bacteria | 7876 |
| 424 | Ga0316183_1201056 | 3300030742 | Bacteria | 1577 |
| 425 | Ga0316182_1043585 | 3300030745 | Bacteria | 2309 |
| 426 | Ga0307408_100005051 | 3300031548 | Bacteria | 8852 |
| 427 | Ga0307408_100018438 | 3300031548 | Bacteria | 4685 |
| 428 | Ga0307408_100058940 | 3300031548 | Bacteria | 2793 |
| 429 | Ga0307408_100072671 | 3300031548 | Bacteria | 2547 |
| 430 | Ga0307408_100083961 | 3300031548 | Bacteria | 2387 |
| 431 | Ga0307408_100650732 | 3300031548 | Bacteria | 942 |
| 432 | Ga0307405_10008142 | 3300031731 | Bacteria | 5297 |
| 433 | Ga0307405_10102656 | 3300031731 | Bacteria | 1921 |
| 434 | Ga0307405_10105492 | 3300031731 | Bacteria | 1898 |
| 435 | Ga0307413_10001109 | 3300031824 | Bacteria | 9841 |
| 436 | Ga0307413_10003856 | 3300031824 | Bacteria | 6404 |
| 437 | Ga0307413_10003892 | 3300031824 | Bacteria | 6385 |
| 438 | Ga0307413_10017918 | 3300031824 | Bacteria | 3701 |
| 439 | Ga0307413_10042672 | 3300031824 | Bacteria | 2667 |
| 440 | Ga0307413_10149107 | 3300031824 | Bacteria | 1627 |
| 441 | Ga0307413_10310922 | 3300031824 | Bacteria | 1199 |
| 442 | Ga0307413_10324467 | 3300031824 | Bacteria | 1177 |
| 443 | Ga0307413_10337151 | 3300031824 | Bacteria | 1158 |
| 444 | Ga0307413_10652382 | 3300031824 | Bacteria | 868 |
| 445 | Ga0307410_10005778 | 3300031852 | Bacteria | 6595 |
| 446 | Ga0307410_10008421 | 3300031852 | Bacteria | 5717 |
| 447 | Ga0307410_10012417 | 3300031852 | Bacteria | 4925 |
| 448 | Ga0307410_10042354 | 3300031852 | Bacteria | 3009 |
| 449 | Ga0307410_10046935 | 3300031852 | Bacteria | 2884 |
| 450 | Ga0307410_10061682 | 3300031852 | Bacteria | 2566 |
| 451 | Ga0307410_10118517 | 3300031852 | Bacteria | 1926 |
| 452 | Ga0307410_10183245 | 3300031852 | Bacteria | 1587 |
| 453 | Ga0307406_10005891 | 3300031901 | Bacteria | 6726 |
| 454 | Ga0307406_10011121 | 3300031901 | Bacteria | 5099 |
| 455 | Ga0307406_10030437 | 3300031901 | Bacteria | 3278 |
| 456 | Ga0307406_10287446 | 3300031901 | Bacteria | 1257 |
| 457 | Ga0307407_10020959 | 3300031903 | Bacteria | 3360 |
| 458 | Ga0307407_10112853 | 3300031903 | Bacteria | 1709 |
| 459 | Ga0307407_10122080 | 3300031903 | Bacteria | 1653 |
| 460 | Ga0307407_10166545 | 3300031903 | Bacteria | 1447 |
| 461 | Ga0307407_10199643 | 3300031903 | Bacteria | 1339 |
| 462 | Ga0307407_10223930 | 3300031903 | Bacteria | 1273 |
| 463 | Ga0307412_10022884 | 3300031911 | Bacteria | 3837 |
| 464 | Ga0307412_10062139 | 3300031911 | Bacteria | 2513 |
| 465 | Ga0307412_10246262 | 3300031911 | Bacteria | 1385 |
| 466 | Ga0307412_10318091 | 3300031911 | Bacteria | 1237 |
| 467 | Ga0307412_10328498 | 3300031911 | Bacteria | 1220 |
| 468 | Ga0307409_100010810 | 3300031995 | Bacteria | 5706 |
| 469 | Ga0307409_100029005 | 3300031995 | Bacteria | 3953 |
| 470 | Ga0307409_100030515 | 3300031995 | Bacteria | 3874 |
| 471 | Ga0307409_100031412 | 3300031995 | Bacteria | 3832 |
| 472 | Ga0307409_100175326 | 3300031995 | Bacteria | 1892 |
| 473 | Ga0307409_100294960 | 3300031995 | Bacteria | 1505 |
| 474 | Ga0307409_100473405 | 3300031995 | Bacteria | 1214 |
| 475 | Ga0307409_100530263 | 3300031995 | Bacteria | 1152 |
| 476 | Ga0307409_100563629 | 3300031995 | Bacteria | 1120 |
| 477 | Ga0307409_100646404 | 3300031995 | Bacteria | 1051 |
| 478 | Ga0307416_100013083 | 3300032002 | Bacteria | 5626 |
| 479 | Ga0307416_100072582 | 3300032002 | Bacteria | 2865 |
| 480 | Ga0307416_100101581 | 3300032002 | Bacteria | 2505 |
| 481 | Ga0307416_100362859 | 3300032002 | Bacteria | 1471 |
| 482 | Ga0307416_100961959 | 3300032002 | Bacteria | 956 |
| 483 | Ga0307414_10014565 | 3300032004 | Bacteria | 4720 |
| 484 | Ga0307414_10018498 | 3300032004 | Bacteria | 4292 |
| 485 | Ga0307414_10024261 | 3300032004 | Bacteria | 3865 |
| 486 | Ga0307414_10032075 | 3300032004 | Bacteria | 3455 |
| 487 | Ga0307414_10051350 | 3300032004 | Bacteria | 2862 |
| 488 | Ga0307414_10057266 | 3300032004 | Bacteria | 2739 |
| 489 | Ga0307414_10105146 | 3300032004 | Bacteria | 2134 |
| 490 | Ga0307414_10114095 | 3300032004 | Bacteria | 2064 |
| 491 | Ga0307414_10270341 | 3300032004 | Bacteria | 1423 |
| 492 | Ga0307411_10001594 | 3300032005 | Bacteria | 9418 |
| 493 | Ga0307411_10006301 | 3300032005 | Bacteria | 5924 |
| 494 | Ga0307411_10012113 | 3300032005 | Bacteria | 4687 |
| 495 | Ga0307411_10049123 | 3300032005 | Bacteria | 2739 |
| 496 | Ga0307411_10061029 | 3300032005 | Bacteria | 2507 |
| 497 | Ga0307411_10131723 | 3300032005 | Bacteria | 1828 |
| 498 | Ga0307411_10151765 | 3300032005 | Bacteria | 1722 |
| 499 | Ga0307411_10155053 | 3300032005 | Bacteria | 1707 |
| 500 | Ga0307411_10324951 | 3300032005 | Bacteria | 1244 |
| 501 | Ga0307411_10680636 | 3300032005 | Bacteria | 894 |
| 502 | Ga0307415_100002637 | 3300032126 | Bacteria | 8939 |
| 503 | Ga0307415_100008661 | 3300032126 | Bacteria | 5656 |
| 504 | Ga0307415_100012704 | 3300032126 | Bacteria | 4880 |
| 505 | Ga0307415_100062131 | 3300032126 | Bacteria | 2589 |
| 506 | Ga0307415_100079876 | 3300032126 | Bacteria | 2332 |
| 507 | Ga0307415_100135105 | 3300032126 | Bacteria | 1874 |
| 508 | Ga0307415_100151259 | 3300032126 | Bacteria | 1787 |
| 509 | Ga0307415_100157115 | 3300032126 | Bacteria | 1757 |
| 510 | Ga0307415_100161090 | 3300032126 | Bacteria | 1739 |
| 511 | Ga0307415_100237428 | 3300032126 | Bacteria | 1472 |
| 512 | Ga0307415_100435260 | 3300032126 | Bacteria | 1129 |
| 513 | Ga0307415_100440177 | 3300032126 | Bacteria | 1124 |
| 514 | Ga0373938_0053078 | 3300034957 | Bacteria | 931 |
| 515 | Ga0373923_0068276 | 3300035111 | Bacteria | 1522 |
| 516 | Ga0373939_0051434 | 3300035114 | Bacteria | 1281 |
| 517 | Ga0373931_0075600 | 3300035691 | Bacteria | 1848 |
| 518 | Ga0373935_0627991 | 3300035692 | Bacteria | 787 |
| 519 | Ga0395899_0000112 | 3300037312 | Bacteria | 138389 |
| 520 | Ga0395899_0000416 | 3300037312 | Bacteria | 49361 |
| 521 | Ga0395899_0004509 | 3300037312 | Bacteria | 10857 |
| 522 | Ga0395899_0006041 | 3300037312 | Bacteria | 9401 |
| 523 | Ga0395899_0011706 | 3300037312 | Bacteria | 6715 |
| 524 | Ga0395899_0046336 | 3300037312 | Bacteria | 3238 |
| 525 | Ga0395899_0078148 | 3300037312 | Bacteria | 2412 |
| 526 | Ga0395899_0116335 | 3300037312 | Bacteria | 1918 |
| 527 | Ga0395899_0185596 | 3300037312 | Bacteria | 1457 |
| 528 | Ga0395899_0225264 | 3300037312 | Bacteria | 1297 |
| 529 | Ga0395899_0265781 | 3300037312 | Bacteria | 1172 |
| 530 | Ga0395900_0000126 | 3300037418 | Bacteria | 127586 |
| 531 | Ga0395900_0012046 | 3300037418 | Bacteria | 8840 |
| 532 | Ga0395900_0033578 | 3300037418 | Bacteria | 5280 |
| 533 | Ga0395900_0067116 | 3300037418 | Bacteria | 3685 |
| 534 | Ga0395900_0075135 | 3300037418 | Bacteria | 3473 |
| 535 | Ga0395900_0081617 | 3300037418 | Bacteria | 3322 |
| 536 | Ga0395900_0086448 | 3300037418 | Bacteria | 3222 |
| 537 | Ga0395900_0121484 | 3300037418 | Bacteria | 2679 |
| 538 | Ga0395900_0163883 | 3300037418 | Bacteria | 2266 |
| 539 | Ga0395900_0164250 | 3300037418 | Bacteria | 2263 |
| 540 | Ga0395900_0220048 | 3300037418 | Bacteria | 1914 |
| 541 | Ga0395900_0251151 | 3300037418 | Bacteria | 1770 |
| 542 | Ga0395900_0272079 | 3300037418 | Bacteria | 1688 |
| 543 | Ga0395900_0353061 | 3300037418 | Bacteria | 1443 |
| 544 | Ga0395900_0383674 | 3300037418 | Bacteria | 1372 |
| 545 | Ga0395900_0424389 | 3300037418 | Bacteria | 1290 |
| 546 | Ga0395900_0745332 | 3300037418 | Bacteria | 910 |
| 547 | Ga0395898_0002752 | 3300037466 | Bacteria | 20261 |
| 548 | Ga0395898_0004549 | 3300037466 | Bacteria | 15138 |
| 549 | Ga0395898_0007693 | 3300037466 | Bacteria | 11440 |
| 550 | Ga0395898_0015887 | 3300037466 | Bacteria | 7713 |
| 551 | Ga0395898_0023552 | 3300037466 | Bacteria | 6220 |
| 552 | Ga0395898_0038075 | 3300037466 | Bacteria | 4768 |
| 553 | Ga0395898_0086016 | 3300037466 | Bacteria | 3030 |
| 554 | Ga0395898_0138627 | 3300037466 | Bacteria | 2329 |
| 555 | Ga0395898_0148137 | 3300037466 | Bacteria | 2246 |
| 556 | Ga0395898_0300187 | 3300037466 | Bacteria | 1532 |
| 557 | Ga0395898_0468829 | 3300037466 | Bacteria | 1198 |
| 558 | Ga0395898_0514898 | 3300037466 | Bacteria | 1138 |
| 559 | Ga0395898_0680098 | 3300037466 | Unclassified | 971 |
| 560 | Ga0395905_0001949 | 3300037471 | Bacteria | 23650 |
| 561 | Ga0395905_0002085 | 3300037471 | Bacteria | 22730 |
| 562 | Ga0395905_0002354 | 3300037471 | Bacteria | 21056 |
| 563 | Ga0395905_0004344 | 3300037471 | Bacteria | 14757 |
| 564 | Ga0395905_0006447 | 3300037471 | Bacteria | 11813 |
| 565 | Ga0395905_0023342 | 3300037471 | Bacteria | 5847 |
| 566 | Ga0395905_0059803 | 3300037471 | Bacteria | 3562 |
| 567 | Ga0395905_0062683 | 3300037471 | Bacteria | 3477 |
| 568 | Ga0395905_0071127 | 3300037471 | Bacteria | 3262 |
| 569 | Ga0395905_0089442 | 3300037471 | Bacteria | 2886 |
| 570 | Ga0395905_0169949 | 3300037471 | Bacteria | 2048 |
| 571 | Ga0395905_0199777 | 3300037471 | Bacteria | 1874 |
| 572 | Ga0395905_0245036 | 3300037471 | Bacteria | 1674 |
| 573 | Ga0395905_0282647 | 3300037471 | Bacteria | 1545 |
| 574 | Ga0395905_0354439 | 3300037471 | Bacteria | 1359 |
| 575 | Ga0395905_0651032 | 3300037471 | Bacteria | 955 |
| 576 | Ga0436364_1467667 | 3300037853 | Bacteria | 13726 |
| 577 | Ga0395901_0000249 | 3300038443 | Bacteria | 66993 |
| 578 | Ga0395901_0019953 | 3300038443 | Bacteria | 6858 |
| 579 | Ga0395901_0024645 | 3300038443 | Bacteria | 6177 |
| 580 | Ga0395901_0036995 | 3300038443 | Bacteria | 5047 |
| 581 | Ga0395901_0043000 | 3300038443 | Bacteria | 4686 |
| 582 | Ga0395901_0045097 | 3300038443 | Bacteria | 4574 |
| 583 | Ga0395901_0056704 | 3300038443 | Bacteria | 4075 |
| 584 | Ga0395901_0061025 | 3300038443 | Bacteria | 3924 |
| 585 | Ga0395901_0079393 | 3300038443 | Bacteria | 3426 |
| 586 | Ga0395901_0120186 | 3300038443 | Bacteria | 2761 |
| 587 | Ga0395901_0193330 | 3300038443 | Unclassified | 2134 |
| 588 | Ga0395901_0231156 | 3300038443 | Bacteria | 1930 |
| 589 | Ga0395901_0245020 | 3300038443 | Bacteria | 1868 |
| 590 | Ga0395901_0260179 | 3300038443 | Bacteria | 1806 |
| 591 | Ga0395901_0260622 | 3300038443 | Bacteria | 1804 |
| 592 | Ga0395901_0286477 | 3300038443 | Bacteria | 1710 |
| 593 | Ga0439437_001938 | 3300042000 | Bacteria | 2200 |
| 594 | Ga0439432_016256 | 3300042006 | Bacteria | 2506 |
| 595 | Ga0439432_108353 | 3300042006 | Bacteria | 828 |
| 596 | Ga0439455_0002616 | 3300042012 | Bacteria | 3305 |
| 597 | Ga0450895_007553 | 3300042132 | Bacteria | 901 |
| 598 | Ga0450906_014645 | 3300042145 | Bacteria | 1434 |
| 599 | Ga0439458_0000679 | 3300042157 | Bacteria | 8779 |
| 600 | Ga0439458_0009670 | 3300042157 | Bacteria | 2148 |
| 601 | Ga0451577_0474463 | 3300042876 | Bacteria | 1136 |
| 602 | Ga0466969_0001359 | 3300044656 | Bacteria | 13195 |
| 603 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 604 | Ga0466966_0217631 | 3300044684 | Bacteria | 1153 |
| 605 | Ga0466961_0004065 | 3300044693 | Bacteria | 9161 |
| 606 | Ga0466961_0044556 | 3300044693 | Bacteria | 2839 |
| 607 | Ga0466961_0117927 | 3300044693 | Bacteria | 1667 |
| 608 | Ga0466963_0032241 | 3300044694 | Bacteria | 3391 |
| 609 | Ga0466963_0040516 | 3300044694 | Bacteria | 3053 |
| 610 | Ga0466963_0165159 | 3300044694 | Bacteria | 1542 |
| 611 | Ga0466963_0262409 | 3300044694 | Bacteria | 1213 |
| 612 | Ga0466971_0004819 | 3300044719 | Bacteria | 5840 |
| 613 | Ga0466971_0043076 | 3300044719 | Bacteria | 2028 |
| 614 | Ga0466970_0002777 | 3300044765 | Bacteria | 8446 |
| 615 | Ga0466957_0001016 | 3300044842 | Bacteria | 14449 |
| 616 | Ga0466957_0028790 | 3300044842 | Bacteria | 3309 |
| 617 | Ga0466957_0042385 | 3300044842 | Bacteria | 2754 |
| 618 | Ga0466957_0063940 | 3300044842 | Bacteria | 2263 |
| 619 | Ga0466957_0127568 | 3300044842 | Bacteria | 1627 |
| 620 | Ga0466959_0098283 | 3300045049 | Bacteria | 2097 |
| 621 | Ga0466959_0148018 | 3300045049 | Bacteria | 1656 |
| 622 | Ga0466959_0215057 | 3300045049 | Bacteria | 1335 |
| 623 | Ga0466958_0019300 | 3300045836 | Bacteria | 3967 |
| 624 | Ga0466958_0035396 | 3300045836 | Bacteria | 2983 |
| 625 | Ga0466958_0237934 | 3300045836 | Bacteria | 1163 |
| 626 | Ga0466958_0271492 | 3300045836 | Bacteria | 1086 |
| 627 | Ga0466958_0317337 | 3300045836 | Bacteria | 1001 |
| 628 | Ga0466967_0006319 | 3300045976 | Bacteria | 8365 |
| 629 | Ga0466967_0022899 | 3300045976 | Bacteria | 5108 |
| 630 | Ga0466967_0034090 | 3300045976 | Bacteria | 4317 |
| 631 | Ga0466967_0179801 | 3300045976 | Bacteria | 1995 |
| 632 | Ga0495650_0085781 | 3300046471 | Bacteria | 1206 |
| 633 | Ga0495584_0025603 | 3300046491 | Bacteria | 2991 |
| 634 | Ga0495583_0004082 | 3300046506 | Bacteria | 10715 |
| 635 | Ga0495606_0001775 | 3300046507 | Bacteria | 27610 |
| 636 | Ga0495643_0002032 | 3300046522 | Bacteria | 16834 |
| 637 | Ga0495643_0023693 | 3300046522 | Bacteria | 3487 |
| 638 | Ga0495598_0137298 | 3300046537 | Bacteria | 843 |
| 639 | Ga0495609_0138534 | 3300046538 | Bacteria | 1039 |
| 640 | Ga0495597_0069201 | 3300046542 | Bacteria | 1524 |
| 641 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 642 | Ga0495668_0048011 | 3300046616 | Bacteria | 2369 |
| 643 | Ga0495611_0026312 | 3300046648 | Bacteria | 2538 |
| 644 | Ga0495625_0000167 | 3300046660 | Bacteria | 102783 |
| 645 | Ga0495625_0089733 | 3300046660 | Bacteria | 2127 |
| 646 | Ga0495669_0000110 | 3300046684 | Bacteria | 52962 |
| 647 | Ga0495669_0094186 | 3300046684 | Bacteria | 1386 |
| 648 | Ga0495670_0102076 | 3300046691 | Bacteria | 1478 |
| 649 | Ga0495687_000178 | 3300047443 | Bacteria | 93234 |
| 650 | Ga0496101_0049454 | 3300048904 | Bacteria | 3024 |
| 651 | Ga0496101_0093823 | 3300048904 | Bacteria | 2236 |
| 652 | Ga0496102_0150383 | 3300048905 | Bacteria | 2187 |
| 653 | Ga0496103_0214143 | 3300048906 | Bacteria | 1239 |
| 654 | Ga0496103_0517714 | 3300048906 | Bacteria | 763 |
| 655 | Ga0496104_0128694 | 3300048907 | Bacteria | 2432 |
| 656 | Ga0496105_0084391 | 3300048908 | Bacteria | 2624 |
| 657 | Ga0496105_0112299 | 3300048908 | Bacteria | 2249 |
| 658 | Ga0496106_0066213 | 3300048909 | Bacteria | 2751 |
| 659 | Ga0496106_0129690 | 3300048909 | Bacteria | 1977 |
| 660 | Ga0496107_0015391 | 3300048910 | Bacteria | 5360 |
| 661 | Ga0496107_0071527 | 3300048910 | Bacteria | 2520 |
| 662 | Ga0496107_0408690 | 3300048910 | Bacteria | 1009 |
| 663 | Ga0496107_0479089 | 3300048910 | Bacteria | 923 |
| 664 | Ga0496108_0105817 | 3300048911 | Bacteria | 2402 |
| 665 | Ga0496108_0188003 | 3300048911 | Bacteria | 1789 |
| 666 | Ga0496108_0454371 | 3300048911 | Bacteria | 1119 |
| 667 | Ga0496110_0046380 | 3300048913 | Bacteria | 3802 |
| 668 | Ga0496110_0110014 | 3300048913 | Bacteria | 2475 |
| 669 | Ga0496110_0295173 | 3300048913 | Bacteria | 1476 |
| 670 | Ga0496112_0000602 | 3300048915 | Bacteria | 24773 |
| 671 | Ga0496112_0048688 | 3300048915 | Bacteria | 4154 |
| 672 | Ga0496112_0645636 | 3300048915 | Bacteria | 988 |
| 673 | Ga0496113_0147461 | 3300048916 | Bacteria | 1854 |
| 674 | Ga0496113_0181783 | 3300048916 | Bacteria | 1667 |
| 675 | Ga0496114_0012266 | 3300048917 | Bacteria | 6858 |
| 676 | Ga0496114_0028053 | 3300048917 | Bacteria | 4617 |
| 677 | Ga0496114_0510746 | 3300048917 | Bacteria | 1063 |
| 678 | Ga0496122_0020198 | 3300048925 | Bacteria | 6036 |
| 679 | Ga0496123_0016388 | 3300048926 | Bacteria | 6021 |
| 680 | Ga0496125_0000638 | 3300048928 | Bacteria | 58580 |
| 681 | Ga0500610_0002234 | 3300053079 | Bacteria | 7021 |
| 682 | Ga0500658_0003570 | 3300053134 | Bacteria | 5871 |
| 683 | Ga0500645_000011 | 3300053730 | Bacteria | 169616 |
| 684 | Ga0500645_000864 | 3300053730 | Bacteria | 17683 |
| 685 | Ga0500596_000559 | 3300053735 | Bacteria | 7070 |
| 686 | Ga0466962_0006762 | 3300061719 | Bacteria | 5501 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_100145541 | Ga0068856_1001455412 | 178 |
| 2 | 3300013102 | Ga0157371_10273084 | Ga0157371_102730842 | 178 |
| 3 | 3300013105 | Ga0157369_10032646 | Ga0157369_100326463 | 178 |
| 4 | 3300005327 | Ga0070658_10000379 | Ga0070658_1000037916 | 193 |
| 5 | 3300005339 | Ga0070660_100014573 | Ga0070660_1000145734 | 193 |
| 6 | 3300005345 | Ga0070692_10042744 | Ga0070692_100427442 | 193 |
| 7 | 3300013104 | Ga0157370_10264547 | Ga0157370_102645472 | 193 |
| 8 | 3300025909 | Ga0207705_10003393 | Ga0207705_100033932 | 193 |
| 9 | 3300025919 | Ga0207657_10000631 | Ga0207657_1000063126 | 193 |
| 10 | 3300031911 | Ga0307412_10318091 | Ga0307412_103180912 | 193 |
| 11 | 3300031995 | Ga0307409_100473405 | Ga0307409_1004734051 | 193 |
| 12 | 3300032126 | Ga0307415_100062131 | Ga0307415_1000621313 | 193 |
| 13 | 3300037312 | Ga0395899_0000112 | Ga0395899_0000112_114921_115637 | 193 |
| 14 | 3300037418 | Ga0395900_0000126 | Ga0395900_0000126_30608_31324 | 193 |
| 15 | 3300037466 | Ga0395898_0004549 | Ga0395898_0004549_12739_13455 | 193 |
| 16 | 3300037471 | Ga0395905_0089442 | Ga0395905_0089442_1411_2127 | 193 |
| 17 | 3300038443 | Ga0395901_0000249 | Ga0395901_0000249_30588_31304 | 193 |
| 18 | 3300045976 | Ga0466967_0006319 | Ga0466967_0006319_3648_4364 | 194 |
| 19 | 3300002774 | JGI25150J39212_1000285 | JGI25150J39212_100028523 | 201 |
| 20 | 3300003215 | JGI25153J46596_10000044 | JGI25153J46596_1000004481 | 201 |
| 21 | 3300003759 | Ga0055525_1000051 | Ga0055525_1000051184 | 201 |
| 22 | 3300003781 | Ga0055536_1035025 | Ga0055536_10350251 | 201 |
| 23 | 3300003791 | Ga0055530_10012785 | Ga0055530_100127852 | 201 |
| 24 | 3300003791 | Ga0055530_10027885 | Ga0055530_100278852 | 201 |
| 25 | 3300003792 | Ga0055540_1004324 | Ga0055540_10043245 | 201 |
| 26 | 3300003794 | Ga0055531_10032146 | Ga0055531_100321462 | 201 |
| 27 | 3300003794 | Ga0055531_10033121 | Ga0055531_100331212 | 201 |
| 28 | 3300005354 | Ga0070675_100093783 | Ga0070675_1000937832 | 201 |
| 29 | 3300005356 | Ga0070674_100000748 | Ga0070674_10000074811 | 201 |
| 30 | 3300005457 | Ga0070662_100219374 | Ga0070662_1002193742 | 201 |
| 31 | 3300005548 | Ga0070665_100000044 | Ga0070665_100000044221 | 201 |
| 32 | 3300005548 | Ga0070665_100106428 | Ga0070665_1001064285 | 201 |
| 33 | 3300006186 | Ga0075369_10062208 | Ga0075369_100622082 | 201 |
| 34 | 3300006195 | Ga0075366_10011090 | Ga0075366_100110905 | 201 |
| 35 | 3300009148 | Ga0105243_10000038 | Ga0105243_100000382 | 201 |
| 36 | 3300014969 | Ga0157376_10241116 | Ga0157376_102411162 | 201 |
| 37 | 3300025230 | Ga0209563_100019 | Ga0209563_100019322 | 201 |
| 38 | 3300025245 | Ga0207425_1000026 | Ga0207425_1000026176 | 201 |
| 39 | 3300025292 | Ga0209676_1018236 | Ga0209676_10182362 | 201 |
| 40 | 3300025294 | Ga0209025_1000726 | Ga0209025_100072625 | 201 |
| 41 | 3300025297 | Ga0209758_1000004 | Ga0209758_10000041118 | 201 |
| 42 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000013114 | 201 |
| 43 | 3300025298 | Ga0209050_1005087 | Ga0209050_10050878 | 201 |
| 44 | 3300025303 | Ga0209051_1000793 | Ga0209051_100079315 | 201 |
| 45 | 3300025303 | Ga0209051_1016432 | Ga0209051_10164322 | 201 |
| 46 | 3300025304 | Ga0209257_1000617 | Ga0209257_100061717 | 201 |
| 47 | 3300025304 | Ga0209257_1000633 | Ga0209257_100063317 | 201 |
| 48 | 3300025907 | Ga0207645_10077456 | Ga0207645_100774563 | 201 |
| 49 | 3300025933 | Ga0207706_10066417 | Ga0207706_100664171 | 201 |
| 50 | 3300025933 | Ga0207706_10250007 | Ga0207706_102500072 | 201 |
| 51 | 3300025933 | Ga0207706_10257700 | Ga0207706_102577002 | 201 |
| 52 | 3300025935 | Ga0207709_10000031 | Ga0207709_10000031281 | 201 |
| 53 | 3300025937 | Ga0207669_10002114 | Ga0207669_100021148 | 201 |
| 54 | 3300025945 | Ga0207679_10485370 | Ga0207679_104853702 | 201 |
| 55 | 3300025972 | Ga0207668_10217452 | Ga0207668_102174522 | 201 |
| 56 | 3300027876 | Ga0209974_10020793 | Ga0209974_100207932 | 201 |
| 57 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022110 | 201 |
| 58 | 3300028379 | Ga0268266_10076820 | Ga0268266_100768202 | 201 |
| 59 | 3300028786 | Ga0307517_10022167 | Ga0307517_100221677 | 201 |
| 60 | 3300028786 | Ga0307517_10022587 | Ga0307517_100225873 | 201 |
| 61 | 3300031548 | Ga0307408_100072671 | Ga0307408_1000726712 | 201 |
| 62 | 3300031852 | Ga0307410_10046935 | Ga0307410_100469352 | 201 |
| 63 | 3300031901 | Ga0307406_10030437 | Ga0307406_100304372 | 201 |
| 64 | 3300031901 | Ga0307406_10287446 | Ga0307406_102874462 | 201 |
| 65 | 3300032002 | Ga0307416_100101581 | Ga0307416_1001015812 | 201 |
| 66 | 3300032004 | Ga0307414_10024261 | Ga0307414_100242614 | 201 |
| 67 | 3300032126 | Ga0307415_100135105 | Ga0307415_1001351052 | 201 |
| 68 | 3300037312 | Ga0395899_0225264 | Ga0395899_0225264_282_989 | 201 |
| 69 | 3300038443 | Ga0395901_0061025 | Ga0395901_0061025_1726_2433 | 201 |
| 70 | 3300046471 | Ga0495650_0085781 | Ga0495650_0085781_110_811 | 201 |
| 71 | 3300046491 | Ga0495584_0025603 | Ga0495584_0025603_639_1346 | 201 |
| 72 | 3300046506 | Ga0495583_0004082 | Ga0495583_0004082_8427_9134 | 201 |
| 73 | 3300046507 | Ga0495606_0001775 | Ga0495606_0001775_25339_26046 | 201 |
| 74 | 3300046522 | Ga0495643_0002032 | Ga0495643_0002032_13069_13776 | 201 |
| 75 | 3300046522 | Ga0495643_0023693 | Ga0495643_0023693_2733_3440 | 201 |
| 76 | 3300046538 | Ga0495609_0138534 | Ga0495609_0138534_321_1028 | 201 |
| 77 | 3300046542 | Ga0495597_0069201 | Ga0495597_0069201_761_1468 | 201 |
| 78 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_52242_52949 | 201 |
| 79 | 3300046648 | Ga0495611_0026312 | Ga0495611_0026312_1283_1990 | 201 |
| 80 | 3300046660 | Ga0495625_0000167 | Ga0495625_0000167_68904_69611 | 201 |
| 81 | 3300046660 | Ga0495625_0089733 | Ga0495625_0089733_1077_1784 | 201 |
| 82 | 3300046684 | Ga0495669_0000110 | Ga0495669_0000110_39341_40048 | 201 |
| 83 | 3300047443 | Ga0495687_000178 | Ga0495687_000178_40561_41268 | 201 |
| 84 | 3300048906 | Ga0496103_0214143 | Ga0496103_0214143_149_862 | 201 |
| 85 | 3300048916 | Ga0496113_0181783 | Ga0496113_0181783_620_1327 | 201 |
| 86 | 3300048917 | Ga0496114_0028053 | Ga0496114_0028053_1582_2289 | 201 |
| 87 | 3300048925 | Ga0496122_0020198 | Ga0496122_0020198_4222_4929 | 201 |
| 88 | 3300048926 | Ga0496123_0016388 | Ga0496123_0016388_2556_3263 | 201 |
| 89 | 3300048928 | Ga0496125_0000638 | Ga0496125_0000638_14117_14824 | 201 |
| 90 | 3300053079 | Ga0500610_0002234 | Ga0500610_0002234_2526_3233 | 201 |
| 91 | 3300053730 | Ga0500645_000011 | Ga0500645_000011_115050_115757 | 201 |
| 92 | 3300053730 | Ga0500645_000864 | Ga0500645_000864_13146_13856 | 201 |
| 93 | 3300053735 | Ga0500596_000559 | Ga0500596_000559_4213_4920 | 201 |
| 94 | 3300001989 | JGI24739J22299_10003131 | JGI24739J22299_100031314 | 202 |
| 95 | 3300001990 | JGI24737J22298_10021171 | JGI24737J22298_100211712 | 202 |
| 96 | 3300001990 | JGI24737J22298_10054431 | JGI24737J22298_100544312 | 202 |
| 97 | 3300001991 | JGI24743J22301_10017318 | JGI24743J22301_100173183 | 202 |
| 98 | 3300002075 | JGI24738J21930_10001952 | JGI24738J21930_100019522 | 202 |
| 99 | 3300005293 | Ga0065715_10104714 | Ga0065715_101047142 | 202 |
| 100 | 3300005327 | Ga0070658_10000850 | Ga0070658_1000085019 | 202 |
| 101 | 3300005327 | Ga0070658_10017653 | Ga0070658_100176536 | 202 |
| 102 | 3300005327 | Ga0070658_10060472 | Ga0070658_100604722 | 202 |
| 103 | 3300005327 | Ga0070658_10202894 | Ga0070658_102028942 | 202 |
| 104 | 3300005327 | Ga0070658_10471029 | Ga0070658_104710292 | 202 |
| 105 | 3300005327 | Ga0070658_10473420 | Ga0070658_104734201 | 202 |
| 106 | 3300005328 | Ga0070676_10033934 | Ga0070676_100339342 | 202 |
| 107 | 3300005328 | Ga0070676_10081352 | Ga0070676_100813522 | 202 |
| 108 | 3300005329 | Ga0070683_100001218 | Ga0070683_1000012184 | 202 |
| 109 | 3300005329 | Ga0070683_100014840 | Ga0070683_1000148404 | 202 |
| 110 | 3300005329 | Ga0070683_100146333 | Ga0070683_1001463332 | 202 |
| 111 | 3300005329 | Ga0070683_100369281 | Ga0070683_1003692811 | 202 |
| 112 | 3300005329 | Ga0070683_100370875 | Ga0070683_1003708751 | 202 |
| 113 | 3300005330 | Ga0070690_100018174 | Ga0070690_1000181742 | 202 |
| 114 | 3300005331 | Ga0070670_100015317 | Ga0070670_1000153174 | 202 |
| 115 | 3300005331 | Ga0070670_100232323 | Ga0070670_1002323232 | 202 |
| 116 | 3300005331 | Ga0070670_100233788 | Ga0070670_1002337882 | 202 |
| 117 | 3300005331 | Ga0070670_100322921 | Ga0070670_1003229212 | 202 |
| 118 | 3300005331 | Ga0070670_100353881 | Ga0070670_1003538812 | 202 |
| 119 | 3300005333 | Ga0070677_10055072 | Ga0070677_100550722 | 202 |
| 120 | 3300005335 | Ga0070666_10000555 | Ga0070666_1000055515 | 202 |
| 121 | 3300005335 | Ga0070666_10000788 | Ga0070666_1000078816 | 202 |
| 122 | 3300005335 | Ga0070666_10003797 | Ga0070666_100037972 | 202 |
| 123 | 3300005335 | Ga0070666_10134273 | Ga0070666_101342731 | 202 |
| 124 | 3300005336 | Ga0070680_100000600 | Ga0070680_1000006007 | 202 |
| 125 | 3300005336 | Ga0070680_100191965 | Ga0070680_1001919652 | 202 |
| 126 | 3300005336 | Ga0070680_100235000 | Ga0070680_1002350002 | 202 |
| 127 | 3300005336 | Ga0070680_100238700 | Ga0070680_1002387001 | 202 |
| 128 | 3300005336 | Ga0070680_100633744 | Ga0070680_1006337441 | 202 |
| 129 | 3300005338 | Ga0068868_100000211 | Ga0068868_10000021137 | 202 |
| 130 | 3300005338 | Ga0068868_100011949 | Ga0068868_1000119492 | 202 |
| 131 | 3300005339 | Ga0070660_100001859 | Ga0070660_1000018596 | 202 |
| 132 | 3300005339 | Ga0070660_100002066 | Ga0070660_1000020665 | 202 |
| 133 | 3300005339 | Ga0070660_100031328 | Ga0070660_1000313283 | 202 |
| 134 | 3300005339 | Ga0070660_100033386 | Ga0070660_1000333863 | 202 |
| 135 | 3300005339 | Ga0070660_100037874 | Ga0070660_1000378742 | 202 |
| 136 | 3300005339 | Ga0070660_100064368 | Ga0070660_1000643682 | 202 |
| 137 | 3300005339 | Ga0070660_100074313 | Ga0070660_1000743135 | 202 |
| 138 | 3300005339 | Ga0070660_100188524 | Ga0070660_1001885242 | 202 |
| 139 | 3300005339 | Ga0070660_100306520 | Ga0070660_1003065201 | 202 |
| 140 | 3300005339 | Ga0070660_100402887 | Ga0070660_1004028872 | 202 |
| 141 | 3300005339 | Ga0070660_100533921 | Ga0070660_1005339211 | 202 |
| 142 | 3300005340 | Ga0070689_100079995 | Ga0070689_1000799953 | 202 |
| 143 | 3300005343 | Ga0070687_100048833 | Ga0070687_1000488332 | 202 |
| 144 | 3300005344 | Ga0070661_100011344 | Ga0070661_1000113445 | 202 |
| 145 | 3300005344 | Ga0070661_100333617 | Ga0070661_1003336171 | 202 |
| 146 | 3300005344 | Ga0070661_100600262 | Ga0070661_1006002621 | 202 |
| 147 | 3300005344 | Ga0070661_100665251 | Ga0070661_1006652511 | 202 |
| 148 | 3300005345 | Ga0070692_10013735 | Ga0070692_100137352 | 202 |
| 149 | 3300005347 | Ga0070668_100084106 | Ga0070668_1000841063 | 202 |
| 150 | 3300005347 | Ga0070668_100448989 | Ga0070668_1004489891 | 202 |
| 151 | 3300005347 | Ga0070668_100692893 | Ga0070668_1006928931 | 202 |
| 152 | 3300005353 | Ga0070669_100036110 | Ga0070669_1000361102 | 202 |
| 153 | 3300005353 | Ga0070669_100036391 | Ga0070669_1000363912 | 202 |
| 154 | 3300005353 | Ga0070669_100047337 | Ga0070669_1000473372 | 202 |
| 155 | 3300005354 | Ga0070675_100017003 | Ga0070675_1000170034 | 202 |
| 156 | 3300005354 | Ga0070675_100138612 | Ga0070675_1001386122 | 202 |
| 157 | 3300005355 | Ga0070671_100008209 | Ga0070671_1000082094 | 202 |
| 158 | 3300005355 | Ga0070671_100011218 | Ga0070671_1000112185 | 202 |
| 159 | 3300005355 | Ga0070671_100036176 | Ga0070671_1000361762 | 202 |
| 160 | 3300005355 | Ga0070671_100101520 | Ga0070671_1001015202 | 202 |
| 161 | 3300005356 | Ga0070674_100033523 | Ga0070674_1000335233 | 202 |
| 162 | 3300005356 | Ga0070674_100069808 | Ga0070674_1000698082 | 202 |
| 163 | 3300005356 | Ga0070674_100134949 | Ga0070674_1001349492 | 202 |
| 164 | 3300005364 | Ga0070673_100007938 | Ga0070673_1000079383 | 202 |
| 165 | 3300005364 | Ga0070673_100044036 | Ga0070673_1000440361 | 202 |
| 166 | 3300005364 | Ga0070673_100123390 | Ga0070673_1001233901 | 202 |
| 167 | 3300005364 | Ga0070673_100282530 | Ga0070673_1002825302 | 202 |
| 168 | 3300005364 | Ga0070673_100548490 | Ga0070673_1005484902 | 202 |
| 169 | 3300005366 | Ga0070659_100024266 | Ga0070659_1000242664 | 202 |
| 170 | 3300005366 | Ga0070659_100057384 | Ga0070659_1000573843 | 202 |
| 171 | 3300005366 | Ga0070659_100078933 | Ga0070659_1000789332 | 202 |
| 172 | 3300005366 | Ga0070659_100080262 | Ga0070659_1000802623 | 202 |
| 173 | 3300005366 | Ga0070659_100087124 | Ga0070659_1000871242 | 202 |
| 174 | 3300005366 | Ga0070659_100188514 | Ga0070659_1001885141 | 202 |
| 175 | 3300005367 | Ga0070667_100001014 | Ga0070667_10000101415 | 202 |
| 176 | 3300005367 | Ga0070667_100003689 | Ga0070667_10000368911 | 202 |
| 177 | 3300005367 | Ga0070667_100005056 | Ga0070667_1000050565 | 202 |
| 178 | 3300005367 | Ga0070667_100018198 | Ga0070667_1000181981 | 202 |
| 179 | 3300005367 | Ga0070667_100613747 | Ga0070667_1006137472 | 202 |
| 180 | 3300005436 | Ga0070713_100014792 | Ga0070713_1000147921 | 202 |
| 181 | 3300005455 | Ga0070663_100001179 | Ga0070663_1000011799 | 202 |
| 182 | 3300005455 | Ga0070663_100272338 | Ga0070663_1002723381 | 202 |
| 183 | 3300005455 | Ga0070663_100443191 | Ga0070663_1004431911 | 202 |
| 184 | 3300005455 | Ga0070663_100549921 | Ga0070663_1005499211 | 202 |
| 185 | 3300005456 | Ga0070678_100065818 | Ga0070678_1000658182 | 202 |
| 186 | 3300005456 | Ga0070678_100196689 | Ga0070678_1001966892 | 202 |
| 187 | 3300005457 | Ga0070662_100004894 | Ga0070662_1000048948 | 202 |
| 188 | 3300005457 | Ga0070662_100008268 | Ga0070662_1000082685 | 202 |
| 189 | 3300005457 | Ga0070662_100009507 | Ga0070662_1000095072 | 202 |
| 190 | 3300005457 | Ga0070662_100021117 | Ga0070662_1000211175 | 202 |
| 191 | 3300005458 | Ga0070681_10103530 | Ga0070681_101035302 | 202 |
| 192 | 3300005459 | Ga0068867_100145558 | Ga0068867_1001455582 | 202 |
| 193 | 3300005459 | Ga0068867_100203179 | Ga0068867_1002031792 | 202 |
| 194 | 3300005530 | Ga0070679_100075000 | Ga0070679_1000750002 | 202 |
| 195 | 3300005530 | Ga0070679_100129217 | Ga0070679_1001292173 | 202 |
| 196 | 3300005535 | Ga0070684_100648527 | Ga0070684_1006485271 | 202 |
| 197 | 3300005539 | Ga0068853_100018513 | Ga0068853_1000185135 | 202 |
| 198 | 3300005543 | Ga0070672_100010078 | Ga0070672_1000100783 | 202 |
| 199 | 3300005543 | Ga0070672_100222162 | Ga0070672_1002221622 | 202 |
| 200 | 3300005543 | Ga0070672_100230499 | Ga0070672_1002304992 | 202 |
| 201 | 3300005544 | Ga0070686_100075696 | Ga0070686_1000756962 | 202 |
| 202 | 3300005548 | Ga0070665_100003221 | Ga0070665_1000032218 | 202 |
| 203 | 3300005548 | Ga0070665_100797092 | Ga0070665_1007970921 | 202 |
| 204 | 3300005563 | Ga0068855_100000300 | Ga0068855_10000030064 | 202 |
| 205 | 3300005564 | Ga0070664_100006228 | Ga0070664_1000062287 | 202 |
| 206 | 3300005564 | Ga0070664_100008802 | Ga0070664_1000088022 | 202 |
| 207 | 3300005564 | Ga0070664_100082623 | Ga0070664_1000826231 | 202 |
| 208 | 3300005577 | Ga0068857_100021293 | Ga0068857_1000212936 | 202 |
| 209 | 3300005577 | Ga0068857_100025988 | Ga0068857_1000259882 | 202 |
| 210 | 3300005578 | Ga0068854_100000728 | Ga0068854_10000072810 | 202 |
| 211 | 3300005578 | Ga0068854_100277704 | Ga0068854_1002777041 | 202 |
| 212 | 3300005614 | Ga0068856_100028489 | Ga0068856_1000284894 | 202 |
| 213 | 3300005614 | Ga0068856_100030135 | Ga0068856_1000301352 | 202 |
| 214 | 3300005614 | Ga0068856_100066022 | Ga0068856_1000660226 | 202 |
| 215 | 3300005614 | Ga0068856_100135622 | Ga0068856_1001356221 | 202 |
| 216 | 3300005614 | Ga0068856_100252822 | Ga0068856_1002528221 | 202 |
| 217 | 3300005616 | Ga0068852_100093936 | Ga0068852_1000939362 | 202 |
| 218 | 3300005616 | Ga0068852_100659547 | Ga0068852_1006595471 | 202 |
| 219 | 3300005617 | Ga0068859_100064821 | Ga0068859_1000648214 | 202 |
| 220 | 3300005617 | Ga0068859_100115375 | Ga0068859_1001153752 | 202 |
| 221 | 3300005618 | Ga0068864_100282586 | Ga0068864_1002825862 | 202 |
| 222 | 3300005618 | Ga0068864_100494293 | Ga0068864_1004942932 | 202 |
| 223 | 3300005718 | Ga0068866_10033567 | Ga0068866_100335672 | 202 |
| 224 | 3300005719 | Ga0068861_100202619 | Ga0068861_1002026192 | 202 |
| 225 | 3300005834 | Ga0068851_10032450 | Ga0068851_100324504 | 202 |
| 226 | 3300005834 | Ga0068851_10069902 | Ga0068851_100699023 | 202 |
| 227 | 3300005834 | Ga0068851_10097261 | Ga0068851_100972612 | 202 |
| 228 | 3300005840 | Ga0068870_10330320 | Ga0068870_103303202 | 202 |
| 229 | 3300005841 | Ga0068863_100161988 | Ga0068863_1001619882 | 202 |
| 230 | 3300005841 | Ga0068863_100166116 | Ga0068863_1001661162 | 202 |
| 231 | 3300005842 | Ga0068858_100004134 | Ga0068858_10000413414 | 202 |
| 232 | 3300005842 | Ga0068858_100101070 | Ga0068858_1001010702 | 202 |
| 233 | 3300005843 | Ga0068860_100206806 | Ga0068860_1002068062 | 202 |
| 234 | 3300005844 | Ga0068862_100056641 | Ga0068862_1000566413 | 202 |
| 235 | 3300005844 | Ga0068862_100186131 | Ga0068862_1001861312 | 202 |
| 236 | 3300005985 | Ga0081539_10023788 | Ga0081539_100237882 | 202 |
| 237 | 3300006028 | Ga0070717_10002352 | Ga0070717_1000235212 | 202 |
| 238 | 3300006028 | Ga0070717_10311119 | Ga0070717_103111191 | 202 |
| 239 | 3300006237 | Ga0097621_100036752 | Ga0097621_1000367522 | 202 |
| 240 | 3300006237 | Ga0097621_100048429 | Ga0097621_1000484292 | 202 |
| 241 | 3300006237 | Ga0097621_100186068 | Ga0097621_1001860682 | 202 |
| 242 | 3300006358 | Ga0068871_100026164 | Ga0068871_1000261644 | 202 |
| 243 | 3300006881 | Ga0068865_100017616 | Ga0068865_1000176163 | 202 |
| 244 | 3300006881 | Ga0068865_100039821 | Ga0068865_1000398212 | 202 |
| 245 | 3300006931 | Ga0097620_100064824 | Ga0097620_1000648244 | 202 |
| 246 | 3300006931 | Ga0097620_100115367 | Ga0097620_1001153672 | 202 |
| 247 | 3300009093 | Ga0105240_10008636 | Ga0105240_100086362 | 202 |
| 248 | 3300009093 | Ga0105240_10109400 | Ga0105240_101094006 | 202 |
| 249 | 3300009093 | Ga0105240_10207308 | Ga0105240_102073082 | 202 |
| 250 | 3300009094 | Ga0111539_10259093 | Ga0111539_102590932 | 202 |
| 251 | 3300009094 | Ga0111539_10583676 | Ga0111539_105836762 | 202 |
| 252 | 3300009098 | Ga0105245_10135945 | Ga0105245_101359452 | 202 |
| 253 | 3300009148 | Ga0105243_10040865 | Ga0105243_100408652 | 202 |
| 254 | 3300009148 | Ga0105243_10078506 | Ga0105243_100785063 | 202 |
| 255 | 3300009176 | Ga0105242_10003245 | Ga0105242_100032457 | 202 |
| 256 | 3300009177 | Ga0105248_10000442 | Ga0105248_1000044237 | 202 |
| 257 | 3300009177 | Ga0105248_10003885 | Ga0105248_100038857 | 202 |
| 258 | 3300009177 | Ga0105248_10042951 | Ga0105248_100429514 | 202 |
| 259 | 3300009177 | Ga0105248_10184947 | Ga0105248_101849473 | 202 |
| 260 | 3300009177 | Ga0105248_10452542 | Ga0105248_104525421 | 202 |
| 261 | 3300009545 | Ga0105237_10734784 | Ga0105237_107347841 | 202 |
| 262 | 3300009551 | Ga0105238_10004331 | Ga0105238_1000433116 | 202 |
| 263 | 3300009551 | Ga0105238_10111619 | Ga0105238_101116191 | 202 |
| 264 | 3300010375 | Ga0105239_10097099 | Ga0105239_100970993 | 202 |
| 265 | 3300010375 | Ga0105239_10189608 | Ga0105239_101896082 | 202 |
| 266 | 3300011119 | Ga0105246_10337381 | Ga0105246_103373812 | 202 |
| 267 | 3300013100 | Ga0157373_10009132 | Ga0157373_100091325 | 202 |
| 268 | 3300013100 | Ga0157373_10010212 | Ga0157373_100102125 | 202 |
| 269 | 3300013100 | Ga0157373_10020611 | Ga0157373_100206112 | 202 |
| 270 | 3300013102 | Ga0157371_10003905 | Ga0157371_100039057 | 202 |
| 271 | 3300013102 | Ga0157371_10030406 | Ga0157371_100304063 | 202 |
| 272 | 3300013102 | Ga0157371_10041019 | Ga0157371_100410193 | 202 |
| 273 | 3300013102 | Ga0157371_10092407 | Ga0157371_100924072 | 202 |
| 274 | 3300013102 | Ga0157371_10139705 | Ga0157371_101397052 | 202 |
| 275 | 3300013102 | Ga0157371_10225805 | Ga0157371_102258052 | 202 |
| 276 | 3300013102 | Ga0157371_10388972 | Ga0157371_103889721 | 202 |
| 277 | 3300013104 | Ga0157370_10076239 | Ga0157370_100762392 | 202 |
| 278 | 3300013104 | Ga0157370_10131571 | Ga0157370_101315712 | 202 |
| 279 | 3300013104 | Ga0157370_10576355 | Ga0157370_105763552 | 202 |
| 280 | 3300013105 | Ga0157369_10001743 | Ga0157369_100017438 | 202 |
| 281 | 3300013105 | Ga0157369_10008003 | Ga0157369_100080039 | 202 |
| 282 | 3300013105 | Ga0157369_10012108 | Ga0157369_100121086 | 202 |
| 283 | 3300013105 | Ga0157369_10146486 | Ga0157369_101464862 | 202 |
| 284 | 3300013105 | Ga0157369_10268978 | Ga0157369_102689781 | 202 |
| 285 | 3300013296 | Ga0157374_10003127 | Ga0157374_100031273 | 202 |
| 286 | 3300013296 | Ga0157374_10113722 | Ga0157374_101137222 | 202 |
| 287 | 3300013296 | Ga0157374_10162164 | Ga0157374_101621642 | 202 |
| 288 | 3300013297 | Ga0157378_10104322 | Ga0157378_101043221 | 202 |
| 289 | 3300013297 | Ga0157378_10160910 | Ga0157378_101609101 | 202 |
| 290 | 3300013307 | Ga0157372_10066311 | Ga0157372_100663112 | 202 |
| 291 | 3300013307 | Ga0157372_10077125 | Ga0157372_100771253 | 202 |
| 292 | 3300013308 | Ga0157375_10296300 | Ga0157375_102963002 | 202 |
| 293 | 3300013308 | Ga0157375_10445469 | Ga0157375_104454691 | 202 |
| 294 | 3300014325 | Ga0163163_10022654 | Ga0163163_100226542 | 202 |
| 295 | 3300014325 | Ga0163163_10060370 | Ga0163163_100603705 | 202 |
| 296 | 3300014745 | Ga0157377_10315766 | Ga0157377_103157661 | 202 |
| 297 | 3300014745 | Ga0157377_10446535 | Ga0157377_104465351 | 202 |
| 298 | 3300014968 | Ga0157379_10095548 | Ga0157379_100955482 | 202 |
| 299 | 3300014968 | Ga0157379_10690849 | Ga0157379_106908491 | 202 |
| 300 | 3300014969 | Ga0157376_10161811 | Ga0157376_101618112 | 202 |
| 301 | 3300017792 | Ga0163161_10001335 | Ga0163161_100013355 | 202 |
| 302 | 3300021388 | Ga0213875_10039040 | Ga0213875_100390402 | 202 |
| 303 | 3300025315 | Ga0207697_10074595 | Ga0207697_100745952 | 202 |
| 304 | 3300025321 | Ga0207656_10033586 | Ga0207656_100335862 | 202 |
| 305 | 3300025893 | Ga0207682_10004604 | Ga0207682_100046043 | 202 |
| 306 | 3300025893 | Ga0207682_10047348 | Ga0207682_100473482 | 202 |
| 307 | 3300025903 | Ga0207680_10001223 | Ga0207680_100012238 | 202 |
| 308 | 3300025903 | Ga0207680_10001981 | Ga0207680_100019818 | 202 |
| 309 | 3300025903 | Ga0207680_10138489 | Ga0207680_101384892 | 202 |
| 310 | 3300025903 | Ga0207680_10284722 | Ga0207680_102847222 | 202 |
| 311 | 3300025904 | Ga0207647_10005192 | Ga0207647_100051926 | 202 |
| 312 | 3300025904 | Ga0207647_10026990 | Ga0207647_100269902 | 202 |
| 313 | 3300025904 | Ga0207647_10107202 | Ga0207647_101072022 | 202 |
| 314 | 3300025907 | Ga0207645_10015870 | Ga0207645_100158704 | 202 |
| 315 | 3300025907 | Ga0207645_10026228 | Ga0207645_100262282 | 202 |
| 316 | 3300025907 | Ga0207645_10080726 | Ga0207645_100807262 | 202 |
| 317 | 3300025908 | Ga0207643_10312897 | Ga0207643_103128971 | 202 |
| 318 | 3300025909 | Ga0207705_10000060 | Ga0207705_1000006072 | 202 |
| 319 | 3300025909 | Ga0207705_10000429 | Ga0207705_1000042930 | 202 |
| 320 | 3300025909 | Ga0207705_10000779 | Ga0207705_100007797 | 202 |
| 321 | 3300025909 | Ga0207705_10006538 | Ga0207705_100065386 | 202 |
| 322 | 3300025909 | Ga0207705_10010399 | Ga0207705_100103994 | 202 |
| 323 | 3300025909 | Ga0207705_10028693 | Ga0207705_100286931 | 202 |
| 324 | 3300025909 | Ga0207705_10051177 | Ga0207705_100511772 | 202 |
| 325 | 3300025909 | Ga0207705_10051439 | Ga0207705_100514392 | 202 |
| 326 | 3300025909 | Ga0207705_10070261 | Ga0207705_100702612 | 202 |
| 327 | 3300025909 | Ga0207705_10178370 | Ga0207705_101783702 | 202 |
| 328 | 3300025909 | Ga0207705_10345107 | Ga0207705_103451072 | 202 |
| 329 | 3300025912 | Ga0207707_10195711 | Ga0207707_101957112 | 202 |
| 330 | 3300025912 | Ga0207707_10477744 | Ga0207707_104777442 | 202 |
| 331 | 3300025913 | Ga0207695_10001996 | Ga0207695_1000199617 | 202 |
| 332 | 3300025913 | Ga0207695_10024085 | Ga0207695_100240856 | 202 |
| 333 | 3300025917 | Ga0207660_10083358 | Ga0207660_100833582 | 202 |
| 334 | 3300025917 | Ga0207660_10450550 | Ga0207660_104505501 | 202 |
| 335 | 3300025918 | Ga0207662_10070400 | Ga0207662_100704002 | 202 |
| 336 | 3300025919 | Ga0207657_10004219 | Ga0207657_100042193 | 202 |
| 337 | 3300025919 | Ga0207657_10004392 | Ga0207657_100043929 | 202 |
| 338 | 3300025919 | Ga0207657_10004601 | Ga0207657_100046017 | 202 |
| 339 | 3300025919 | Ga0207657_10005022 | Ga0207657_100050227 | 202 |
| 340 | 3300025919 | Ga0207657_10044515 | Ga0207657_100445153 | 202 |
| 341 | 3300025919 | Ga0207657_10066869 | Ga0207657_100668693 | 202 |
| 342 | 3300025919 | Ga0207657_10087648 | Ga0207657_100876482 | 202 |
| 343 | 3300025920 | Ga0207649_10000702 | Ga0207649_100007028 | 202 |
| 344 | 3300025920 | Ga0207649_10160693 | Ga0207649_101606932 | 202 |
| 345 | 3300025920 | Ga0207649_10238501 | Ga0207649_102385012 | 202 |
| 346 | 3300025921 | Ga0207652_10187523 | Ga0207652_101875232 | 202 |
| 347 | 3300025921 | Ga0207652_10863604 | Ga0207652_108636041 | 202 |
| 348 | 3300025923 | Ga0207681_10028101 | Ga0207681_100281013 | 202 |
| 349 | 3300025923 | Ga0207681_10033974 | Ga0207681_100339742 | 202 |
| 350 | 3300025923 | Ga0207681_10038492 | Ga0207681_100384923 | 202 |
| 351 | 3300025924 | Ga0207694_10015718 | Ga0207694_100157182 | 202 |
| 352 | 3300025925 | Ga0207650_10003954 | Ga0207650_100039548 | 202 |
| 353 | 3300025925 | Ga0207650_10122814 | Ga0207650_101228142 | 202 |
| 354 | 3300025925 | Ga0207650_10196151 | Ga0207650_101961513 | 202 |
| 355 | 3300025925 | Ga0207650_10226637 | Ga0207650_102266372 | 202 |
| 356 | 3300025925 | Ga0207650_10656957 | Ga0207650_106569571 | 202 |
| 357 | 3300025926 | Ga0207659_10009997 | Ga0207659_100099972 | 202 |
| 358 | 3300025926 | Ga0207659_10291642 | Ga0207659_102916421 | 202 |
| 359 | 3300025928 | Ga0207700_10006689 | Ga0207700_100066895 | 202 |
| 360 | 3300025931 | Ga0207644_10000616 | Ga0207644_100006162 | 202 |
| 361 | 3300025931 | Ga0207644_10003692 | Ga0207644_100036925 | 202 |
| 362 | 3300025931 | Ga0207644_10060563 | Ga0207644_100605633 | 202 |
| 363 | 3300025931 | Ga0207644_10106241 | Ga0207644_101062412 | 202 |
| 364 | 3300025931 | Ga0207644_10150553 | Ga0207644_101505532 | 202 |
| 365 | 3300025931 | Ga0207644_10311361 | Ga0207644_103113612 | 202 |
| 366 | 3300025932 | Ga0207690_10076032 | Ga0207690_100760322 | 202 |
| 367 | 3300025932 | Ga0207690_10095443 | Ga0207690_100954434 | 202 |
| 368 | 3300025932 | Ga0207690_10120416 | Ga0207690_101204162 | 202 |
| 369 | 3300025932 | Ga0207690_10120550 | Ga0207690_101205504 | 202 |
| 370 | 3300025932 | Ga0207690_10297025 | Ga0207690_102970252 | 202 |
| 371 | 3300025932 | Ga0207690_10329131 | Ga0207690_103291312 | 202 |
| 372 | 3300025932 | Ga0207690_10389072 | Ga0207690_103890722 | 202 |
| 373 | 3300025933 | Ga0207706_10000479 | Ga0207706_1000047930 | 202 |
| 374 | 3300025933 | Ga0207706_10002783 | Ga0207706_100027835 | 202 |
| 375 | 3300025933 | Ga0207706_10038708 | Ga0207706_100387082 | 202 |
| 376 | 3300025933 | Ga0207706_10040986 | Ga0207706_100409864 | 202 |
| 377 | 3300025933 | Ga0207706_10045794 | Ga0207706_100457943 | 202 |
| 378 | 3300025933 | Ga0207706_10456867 | Ga0207706_104568672 | 202 |
| 379 | 3300025935 | Ga0207709_10011963 | Ga0207709_100119632 | 202 |
| 380 | 3300025937 | Ga0207669_10032531 | Ga0207669_100325313 | 202 |
| 381 | 3300025937 | Ga0207669_10034651 | Ga0207669_100346512 | 202 |
| 382 | 3300025937 | Ga0207669_10053893 | Ga0207669_100538932 | 202 |
| 383 | 3300025938 | Ga0207704_10013390 | Ga0207704_100133903 | 202 |
| 384 | 3300025938 | Ga0207704_10457906 | Ga0207704_104579061 | 202 |
| 385 | 3300025940 | Ga0207691_10008185 | Ga0207691_100081855 | 202 |
| 386 | 3300025940 | Ga0207691_10015613 | Ga0207691_100156132 | 202 |
| 387 | 3300025940 | Ga0207691_10171780 | Ga0207691_101717802 | 202 |
| 388 | 3300025941 | Ga0207711_10000526 | Ga0207711_100005268 | 202 |
| 389 | 3300025941 | Ga0207711_10002857 | Ga0207711_1000285715 | 202 |
| 390 | 3300025941 | Ga0207711_10308580 | Ga0207711_103085802 | 202 |
| 391 | 3300025944 | Ga0207661_10015344 | Ga0207661_100153443 | 202 |
| 392 | 3300025944 | Ga0207661_10476366 | Ga0207661_104763662 | 202 |
| 393 | 3300025945 | Ga0207679_10004129 | Ga0207679_100041294 | 202 |
| 394 | 3300025945 | Ga0207679_10028047 | Ga0207679_100280475 | 202 |
| 395 | 3300025945 | Ga0207679_10148717 | Ga0207679_101487172 | 202 |
| 396 | 3300025949 | Ga0207667_10000187 | Ga0207667_1000018771 | 202 |
| 397 | 3300025949 | Ga0207667_10047524 | Ga0207667_100475242 | 202 |
| 398 | 3300025949 | Ga0207667_10230028 | Ga0207667_102300283 | 202 |
| 399 | 3300025960 | Ga0207651_10001053 | Ga0207651_1000105310 | 202 |
| 400 | 3300025960 | Ga0207651_10109559 | Ga0207651_101095594 | 202 |
| 401 | 3300025960 | Ga0207651_10434429 | Ga0207651_104344292 | 202 |
| 402 | 3300025972 | Ga0207668_10533687 | Ga0207668_105336872 | 202 |
| 403 | 3300025981 | Ga0207640_10000830 | Ga0207640_1000083015 | 202 |
| 404 | 3300025981 | Ga0207640_10021319 | Ga0207640_100213193 | 202 |
| 405 | 3300025986 | Ga0207658_10001939 | Ga0207658_1000193911 | 202 |
| 406 | 3300025986 | Ga0207658_10017829 | Ga0207658_100178293 | 202 |
| 407 | 3300025986 | Ga0207658_10046725 | Ga0207658_100467252 | 202 |
| 408 | 3300025986 | Ga0207658_10101906 | Ga0207658_101019062 | 202 |
| 409 | 3300025986 | Ga0207658_10105929 | Ga0207658_101059292 | 202 |
| 410 | 3300026023 | Ga0207677_10001135 | Ga0207677_100011359 | 202 |
| 411 | 3300026023 | Ga0207677_10001443 | Ga0207677_1000144311 | 202 |
| 412 | 3300026035 | Ga0207703_10002018 | Ga0207703_100020185 | 202 |
| 413 | 3300026035 | Ga0207703_10002744 | Ga0207703_100027446 | 202 |
| 414 | 3300026041 | Ga0207639_10149300 | Ga0207639_101493002 | 202 |
| 415 | 3300026067 | Ga0207678_10002632 | Ga0207678_100026328 | 202 |
| 416 | 3300026067 | Ga0207678_10003960 | Ga0207678_100039608 | 202 |
| 417 | 3300026067 | Ga0207678_10016075 | Ga0207678_100160756 | 202 |
| 418 | 3300026067 | Ga0207678_10138649 | Ga0207678_101386492 | 202 |
| 419 | 3300026078 | Ga0207702_10022091 | Ga0207702_100220912 | 202 |
| 420 | 3300026078 | Ga0207702_10150514 | Ga0207702_101505143 | 202 |
| 421 | 3300026088 | Ga0207641_10084623 | Ga0207641_100846233 | 202 |
| 422 | 3300026088 | Ga0207641_10111335 | Ga0207641_101113352 | 202 |
| 423 | 3300026088 | Ga0207641_10195067 | Ga0207641_101950671 | 202 |
| 424 | 3300026089 | Ga0207648_10005222 | Ga0207648_1000522215 | 202 |
| 425 | 3300026089 | Ga0207648_10671450 | Ga0207648_106714502 | 202 |
| 426 | 3300026095 | Ga0207676_10036937 | Ga0207676_100369374 | 202 |
| 427 | 3300026095 | Ga0207676_10172957 | Ga0207676_101729572 | 202 |
| 428 | 3300026095 | Ga0207676_10422001 | Ga0207676_104220012 | 202 |
| 429 | 3300026116 | Ga0207674_10010957 | Ga0207674_100109573 | 202 |
| 430 | 3300026116 | Ga0207674_10013241 | Ga0207674_100132412 | 202 |
| 431 | 3300026118 | Ga0207675_100181159 | Ga0207675_1001811592 | 202 |
| 432 | 3300026121 | Ga0207683_10120822 | Ga0207683_101208222 | 202 |
| 433 | 3300026142 | Ga0207698_10009005 | Ga0207698_100090051 | 202 |
| 434 | 3300026142 | Ga0207698_10119154 | Ga0207698_101191542 | 202 |
| 435 | 3300026142 | Ga0207698_10476135 | Ga0207698_104761353 | 202 |
| 436 | 3300026142 | Ga0207698_10511774 | Ga0207698_105117742 | 202 |
| 437 | 3300027665 | Ga0209983_1025505 | Ga0209983_10255052 | 202 |
| 438 | 3300027682 | Ga0209971_1022315 | Ga0209971_10223153 | 202 |
| 439 | 3300027876 | Ga0209974_10001664 | Ga0209974_100016645 | 202 |
| 440 | 3300027876 | Ga0209974_10061469 | Ga0209974_100614692 | 202 |
| 441 | 3300028379 | Ga0268266_10007662 | Ga0268266_100076625 | 202 |
| 442 | 3300028379 | Ga0268266_10428874 | Ga0268266_104288741 | 202 |
| 443 | 3300028380 | Ga0268265_10020526 | Ga0268265_100205262 | 202 |
| 444 | 3300028380 | Ga0268265_10026561 | Ga0268265_100265613 | 202 |
| 445 | 3300030742 | Ga0316183_1201056 | Ga0316183_12010562 | 202 |
| 446 | 3300030745 | Ga0316182_1043585 | Ga0316182_10435852 | 202 |
| 447 | 3300031548 | Ga0307408_100005051 | Ga0307408_1000050517 | 202 |
| 448 | 3300031548 | Ga0307408_100018438 | Ga0307408_1000184384 | 202 |
| 449 | 3300031548 | Ga0307408_100058940 | Ga0307408_1000589402 | 202 |
| 450 | 3300031548 | Ga0307408_100650732 | Ga0307408_1006507321 | 202 |
| 451 | 3300031731 | Ga0307405_10008142 | Ga0307405_100081422 | 202 |
| 452 | 3300031731 | Ga0307405_10102656 | Ga0307405_101026563 | 202 |
| 453 | 3300031731 | Ga0307405_10105492 | Ga0307405_101054923 | 202 |
| 454 | 3300031824 | Ga0307413_10001109 | Ga0307413_100011096 | 202 |
| 455 | 3300031824 | Ga0307413_10003856 | Ga0307413_100038565 | 202 |
| 456 | 3300031824 | Ga0307413_10003892 | Ga0307413_100038924 | 202 |
| 457 | 3300031824 | Ga0307413_10017918 | Ga0307413_100179182 | 202 |
| 458 | 3300031824 | Ga0307413_10149107 | Ga0307413_101491072 | 202 |
| 459 | 3300031824 | Ga0307413_10310922 | Ga0307413_103109222 | 202 |
| 460 | 3300031824 | Ga0307413_10324467 | Ga0307413_103244671 | 202 |
| 461 | 3300031824 | Ga0307413_10337151 | Ga0307413_103371512 | 202 |
| 462 | 3300031824 | Ga0307413_10652382 | Ga0307413_106523821 | 202 |
| 463 | 3300031852 | Ga0307410_10005778 | Ga0307410_100057785 | 202 |
| 464 | 3300031852 | Ga0307410_10008421 | Ga0307410_100084214 | 202 |
| 465 | 3300031852 | Ga0307410_10012417 | Ga0307410_100124172 | 202 |
| 466 | 3300031852 | Ga0307410_10042354 | Ga0307410_100423543 | 202 |
| 467 | 3300031852 | Ga0307410_10061682 | Ga0307410_100616822 | 202 |
| 468 | 3300031852 | Ga0307410_10118517 | Ga0307410_101185172 | 202 |
| 469 | 3300031852 | Ga0307410_10183245 | Ga0307410_101832452 | 202 |
| 470 | 3300031901 | Ga0307406_10005891 | Ga0307406_100058913 | 202 |
| 471 | 3300031901 | Ga0307406_10011121 | Ga0307406_100111213 | 202 |
| 472 | 3300031903 | Ga0307407_10020959 | Ga0307407_100209592 | 202 |
| 473 | 3300031903 | Ga0307407_10112853 | Ga0307407_101128531 | 202 |
| 474 | 3300031903 | Ga0307407_10122080 | Ga0307407_101220803 | 202 |
| 475 | 3300031903 | Ga0307407_10166545 | Ga0307407_101665451 | 202 |
| 476 | 3300031903 | Ga0307407_10199643 | Ga0307407_101996432 | 202 |
| 477 | 3300031903 | Ga0307407_10223930 | Ga0307407_102239302 | 202 |
| 478 | 3300031911 | Ga0307412_10022884 | Ga0307412_100228842 | 202 |
| 479 | 3300031911 | Ga0307412_10062139 | Ga0307412_100621393 | 202 |
| 480 | 3300031911 | Ga0307412_10246262 | Ga0307412_102462622 | 202 |
| 481 | 3300031911 | Ga0307412_10328498 | Ga0307412_103284982 | 202 |
| 482 | 3300031995 | Ga0307409_100010810 | Ga0307409_1000108104 | 202 |
| 483 | 3300031995 | Ga0307409_100029005 | Ga0307409_1000290052 | 202 |
| 484 | 3300031995 | Ga0307409_100030515 | Ga0307409_1000305152 | 202 |
| 485 | 3300031995 | Ga0307409_100031412 | Ga0307409_1000314122 | 202 |
| 486 | 3300031995 | Ga0307409_100175326 | Ga0307409_1001753262 | 202 |
| 487 | 3300031995 | Ga0307409_100294960 | Ga0307409_1002949602 | 202 |
| 488 | 3300031995 | Ga0307409_100530263 | Ga0307409_1005302631 | 202 |
| 489 | 3300031995 | Ga0307409_100563629 | Ga0307409_1005636292 | 202 |
| 490 | 3300031995 | Ga0307409_100646404 | Ga0307409_1006464041 | 202 |
| 491 | 3300032002 | Ga0307416_100013083 | Ga0307416_1000130832 | 202 |
| 492 | 3300032002 | Ga0307416_100072582 | Ga0307416_1000725822 | 202 |
| 493 | 3300032002 | Ga0307416_100362859 | Ga0307416_1003628592 | 202 |
| 494 | 3300032002 | Ga0307416_100961959 | Ga0307416_1009619592 | 202 |
| 495 | 3300032004 | Ga0307414_10014565 | Ga0307414_100145654 | 202 |
| 496 | 3300032004 | Ga0307414_10018498 | Ga0307414_100184982 | 202 |
| 497 | 3300032004 | Ga0307414_10032075 | Ga0307414_100320753 | 202 |
| 498 | 3300032004 | Ga0307414_10051350 | Ga0307414_100513501 | 202 |
| 499 | 3300032004 | Ga0307414_10057266 | Ga0307414_100572661 | 202 |
| 500 | 3300032004 | Ga0307414_10105146 | Ga0307414_101051461 | 202 |
| 501 | 3300032004 | Ga0307414_10114095 | Ga0307414_101140952 | 202 |
| 502 | 3300032004 | Ga0307414_10270341 | Ga0307414_102703412 | 202 |
| 503 | 3300032005 | Ga0307411_10001594 | Ga0307411_100015946 | 202 |
| 504 | 3300032005 | Ga0307411_10006301 | Ga0307411_100063012 | 202 |
| 505 | 3300032005 | Ga0307411_10012113 | Ga0307411_100121132 | 202 |
| 506 | 3300032005 | Ga0307411_10049123 | Ga0307411_100491232 | 202 |
| 507 | 3300032005 | Ga0307411_10061029 | Ga0307411_100610292 | 202 |
| 508 | 3300032005 | Ga0307411_10131723 | Ga0307411_101317233 | 202 |
| 509 | 3300032005 | Ga0307411_10151765 | Ga0307411_101517651 | 202 |
| 510 | 3300032005 | Ga0307411_10155053 | Ga0307411_101550532 | 202 |
| 511 | 3300032005 | Ga0307411_10324951 | Ga0307411_103249512 | 202 |
| 512 | 3300032005 | Ga0307411_10680636 | Ga0307411_106806361 | 202 |
| 513 | 3300032126 | Ga0307415_100002637 | Ga0307415_1000026374 | 202 |
| 514 | 3300032126 | Ga0307415_100008661 | Ga0307415_1000086614 | 202 |
| 515 | 3300032126 | Ga0307415_100012704 | Ga0307415_1000127044 | 202 |
| 516 | 3300032126 | Ga0307415_100157115 | Ga0307415_1001571152 | 202 |
| 517 | 3300032126 | Ga0307415_100161090 | Ga0307415_1001610902 | 202 |
| 518 | 3300032126 | Ga0307415_100237428 | Ga0307415_1002374282 | 202 |
| 519 | 3300032126 | Ga0307415_100435260 | Ga0307415_1004352602 | 202 |
| 520 | 3300034957 | Ga0373938_0053078 | Ga0373938_0053078_129_845 | 202 |
| 521 | 3300035114 | Ga0373939_0051434 | Ga0373939_0051434_234_950 | 202 |
| 522 | 3300035691 | Ga0373931_0075600 | Ga0373931_0075600_974_1690 | 202 |
| 523 | 3300035692 | Ga0373935_0627991 | Ga0373935_0627991_41_757 | 202 |
| 524 | 3300037312 | Ga0395899_0006041 | Ga0395899_0006041_3625_4335 | 202 |
| 525 | 3300037312 | Ga0395899_0011706 | Ga0395899_0011706_2203_2919 | 202 |
| 526 | 3300037312 | Ga0395899_0046336 | Ga0395899_0046336_23_739 | 202 |
| 527 | 3300037312 | Ga0395899_0078148 | Ga0395899_0078148_1376_2104 | 202 |
| 528 | 3300037312 | Ga0395899_0116335 | Ga0395899_0116335_325_1035 | 202 |
| 529 | 3300037312 | Ga0395899_0185596 | Ga0395899_0185596_705_1421 | 202 |
| 530 | 3300037312 | Ga0395899_0265781 | Ga0395899_0265781_50_766 | 202 |
| 531 | 3300037418 | Ga0395900_0012046 | Ga0395900_0012046_37_753 | 202 |
| 532 | 3300037418 | Ga0395900_0033578 | Ga0395900_0033578_1422_2135 | 202 |
| 533 | 3300037418 | Ga0395900_0067116 | Ga0395900_0067116_329_1045 | 202 |
| 534 | 3300037418 | Ga0395900_0075135 | Ga0395900_0075135_2355_3071 | 202 |
| 535 | 3300037418 | Ga0395900_0081617 | Ga0395900_0081617_2304_3020 | 202 |
| 536 | 3300037418 | Ga0395900_0086448 | Ga0395900_0086448_1227_1943 | 202 |
| 537 | 3300037418 | Ga0395900_0121484 | Ga0395900_0121484_37_753 | 202 |
| 538 | 3300037418 | Ga0395900_0163883 | Ga0395900_0163883_500_1216 | 202 |
| 539 | 3300037418 | Ga0395900_0164250 | Ga0395900_0164250_524_1240 | 202 |
| 540 | 3300037418 | Ga0395900_0220048 | Ga0395900_0220048_482_1198 | 202 |
| 541 | 3300037418 | Ga0395900_0251151 | Ga0395900_0251151_610_1326 | 202 |
| 542 | 3300037418 | Ga0395900_0272079 | Ga0395900_0272079_353_1063 | 202 |
| 543 | 3300037418 | Ga0395900_0353061 | Ga0395900_0353061_525_1241 | 202 |
| 544 | 3300037418 | Ga0395900_0383674 | Ga0395900_0383674_149_865 | 202 |
| 545 | 3300037418 | Ga0395900_0424389 | Ga0395900_0424389_168_884 | 202 |
| 546 | 3300037418 | Ga0395900_0745332 | Ga0395900_0745332_73_789 | 202 |
| 547 | 3300037466 | Ga0395898_0002752 | Ga0395898_0002752_8200_8916 | 202 |
| 548 | 3300037466 | Ga0395898_0015887 | Ga0395898_0015887_1059_1775 | 202 |
| 549 | 3300037466 | Ga0395898_0023552 | Ga0395898_0023552_3559_4269 | 202 |
| 550 | 3300037466 | Ga0395898_0038075 | Ga0395898_0038075_2360_3070 | 202 |
| 551 | 3300037466 | Ga0395898_0086016 | Ga0395898_0086016_1918_2634 | 202 |
| 552 | 3300037466 | Ga0395898_0138627 | Ga0395898_0138627_946_1662 | 202 |
| 553 | 3300037466 | Ga0395898_0148137 | Ga0395898_0148137_884_1594 | 202 |
| 554 | 3300037466 | Ga0395898_0300187 | Ga0395898_0300187_424_1140 | 202 |
| 555 | 3300037466 | Ga0395898_0468829 | Ga0395898_0468829_24_740 | 202 |
| 556 | 3300037466 | Ga0395898_0514898 | Ga0395898_0514898_202_918 | 202 |
| 557 | 3300037466 | Ga0395898_0680098 | Ga0395898_0680098_12_725 | 202 |
| 558 | 3300037471 | Ga0395905_0001949 | Ga0395905_0001949_18153_18869 | 202 |
| 559 | 3300037471 | Ga0395905_0002085 | Ga0395905_0002085_7925_8641 | 202 |
| 560 | 3300037471 | Ga0395905_0002354 | Ga0395905_0002354_14424_15140 | 202 |
| 561 | 3300037471 | Ga0395905_0004344 | Ga0395905_0004344_9151_9867 | 202 |
| 562 | 3300037471 | Ga0395905_0023342 | Ga0395905_0023342_3371_4087 | 202 |
| 563 | 3300037471 | Ga0395905_0059803 | Ga0395905_0059803_23_739 | 202 |
| 564 | 3300037471 | Ga0395905_0062683 | Ga0395905_0062683_636_1352 | 202 |
| 565 | 3300037471 | Ga0395905_0169949 | Ga0395905_0169949_1418_2029 | 202 |
| 566 | 3300037471 | Ga0395905_0199777 | Ga0395905_0199777_37_753 | 202 |
| 567 | 3300037471 | Ga0395905_0245036 | Ga0395905_0245036_32_748 | 202 |
| 568 | 3300037471 | Ga0395905_0282647 | Ga0395905_0282647_323_1039 | 202 |
| 569 | 3300037471 | Ga0395905_0354439 | Ga0395905_0354439_522_1238 | 202 |
| 570 | 3300037471 | Ga0395905_0651032 | Ga0395905_0651032_203_919 | 202 |
| 571 | 3300037853 | Ga0436364_1467667 | Ga0436364_1467667_4853_5569 | 202 |
| 572 | 3300038443 | Ga0395901_0019953 | Ga0395901_0019953_4723_5439 | 202 |
| 573 | 3300038443 | Ga0395901_0024645 | Ga0395901_0024645_1729_2445 | 202 |
| 574 | 3300038443 | Ga0395901_0036995 | Ga0395901_0036995_2041_2757 | 202 |
| 575 | 3300038443 | Ga0395901_0043000 | Ga0395901_0043000_3884_4600 | 202 |
| 576 | 3300038443 | Ga0395901_0045097 | Ga0395901_0045097_325_1035 | 202 |
| 577 | 3300038443 | Ga0395901_0056704 | Ga0395901_0056704_23_739 | 202 |
| 578 | 3300038443 | Ga0395901_0079393 | Ga0395901_0079393_1494_2210 | 202 |
| 579 | 3300038443 | Ga0395901_0120186 | Ga0395901_0120186_1891_2607 | 202 |
| 580 | 3300038443 | Ga0395901_0193330 | Ga0395901_0193330_829_1542 | 202 |
| 581 | 3300038443 | Ga0395901_0231156 | Ga0395901_0231156_325_1041 | 202 |
| 582 | 3300038443 | Ga0395901_0245020 | Ga0395901_0245020_846_1562 | 202 |
| 583 | 3300038443 | Ga0395901_0260179 | Ga0395901_0260179_738_1454 | 202 |
| 584 | 3300038443 | Ga0395901_0260622 | Ga0395901_0260622_564_1280 | 202 |
| 585 | 3300038443 | Ga0395901_0286477 | Ga0395901_0286477_83_799 | 202 |
| 586 | 3300042000 | Ga0439437_001938 | Ga0439437_001938_546_1262 | 202 |
| 587 | 3300042006 | Ga0439432_016256 | Ga0439432_016256_539_1255 | 202 |
| 588 | 3300042006 | Ga0439432_108353 | Ga0439432_108353_10_726 | 202 |
| 589 | 3300042012 | Ga0439455_0002616 | Ga0439455_0002616_1071_1784 | 202 |
| 590 | 3300042132 | Ga0450895_007553 | Ga0450895_007553_95_811 | 202 |
| 591 | 3300042145 | Ga0450906_014645 | Ga0450906_014645_68_784 | 202 |
| 592 | 3300042157 | Ga0439458_0000679 | Ga0439458_0000679_6902_7618 | 202 |
| 593 | 3300042157 | Ga0439458_0009670 | Ga0439458_0009670_127_843 | 202 |
| 594 | 3300042876 | Ga0451577_0474463 | Ga0451577_0474463_181_897 | 202 |
| 595 | 3300044656 | Ga0466969_0001359 | Ga0466969_0001359_10573_11283 | 202 |
| 596 | 3300044684 | Ga0466966_0000001 | Ga0466966_0000001_209290_210000 | 202 |
| 597 | 3300044684 | Ga0466966_0217631 | Ga0466966_0217631_254_964 | 202 |
| 598 | 3300044693 | Ga0466961_0004065 | Ga0466961_0004065_5114_5824 | 202 |
| 599 | 3300044693 | Ga0466961_0044556 | Ga0466961_0044556_888_1604 | 202 |
| 600 | 3300044693 | Ga0466961_0117927 | Ga0466961_0117927_719_1438 | 202 |
| 601 | 3300044694 | Ga0466963_0032241 | Ga0466963_0032241_2153_2863 | 202 |
| 602 | 3300044694 | Ga0466963_0040516 | Ga0466963_0040516_1631_2341 | 202 |
| 603 | 3300044694 | Ga0466963_0165159 | Ga0466963_0165159_498_1214 | 202 |
| 604 | 3300044694 | Ga0466963_0262409 | Ga0466963_0262409_114_830 | 202 |
| 605 | 3300044719 | Ga0466971_0004819 | Ga0466971_0004819_4462_5172 | 202 |
| 606 | 3300044719 | Ga0466971_0043076 | Ga0466971_0043076_944_1660 | 202 |
| 607 | 3300044765 | Ga0466970_0002777 | Ga0466970_0002777_4396_5106 | 202 |
| 608 | 3300044842 | Ga0466957_0001016 | Ga0466957_0001016_8350_9060 | 202 |
| 609 | 3300044842 | Ga0466957_0028790 | Ga0466957_0028790_1065_1781 | 202 |
| 610 | 3300044842 | Ga0466957_0042385 | Ga0466957_0042385_11_622 | 202 |
| 611 | 3300044842 | Ga0466957_0063940 | Ga0466957_0063940_602_1318 | 202 |
| 612 | 3300044842 | Ga0466957_0127568 | Ga0466957_0127568_513_1229 | 202 |
| 613 | 3300045049 | Ga0466959_0098283 | Ga0466959_0098283_477_1193 | 202 |
| 614 | 3300045049 | Ga0466959_0148018 | Ga0466959_0148018_535_1251 | 202 |
| 615 | 3300045049 | Ga0466959_0215057 | Ga0466959_0215057_488_1198 | 202 |
| 616 | 3300045836 | Ga0466958_0019300 | Ga0466958_0019300_3068_3778 | 202 |
| 617 | 3300045836 | Ga0466958_0035396 | Ga0466958_0035396_1609_2325 | 202 |
| 618 | 3300045836 | Ga0466958_0237934 | Ga0466958_0237934_361_1077 | 202 |
| 619 | 3300045836 | Ga0466958_0271492 | Ga0466958_0271492_157_873 | 202 |
| 620 | 3300045836 | Ga0466958_0317337 | Ga0466958_0317337_54_767 | 202 |
| 621 | 3300045976 | Ga0466967_0022899 | Ga0466967_0022899_1338_2054 | 202 |
| 622 | 3300045976 | Ga0466967_0034090 | Ga0466967_0034090_2363_3079 | 202 |
| 623 | 3300045976 | Ga0466967_0179801 | Ga0466967_0179801_706_1422 | 202 |
| 624 | 3300046537 | Ga0495598_0137298 | Ga0495598_0137298_100_816 | 202 |
| 625 | 3300046616 | Ga0495668_0048011 | Ga0495668_0048011_371_1087 | 202 |
| 626 | 3300046684 | Ga0495669_0094186 | Ga0495669_0094186_147_863 | 202 |
| 627 | 3300046691 | Ga0495670_0102076 | Ga0495670_0102076_657_1373 | 202 |
| 628 | 3300048904 | Ga0496101_0049454 | Ga0496101_0049454_1413_2129 | 202 |
| 629 | 3300048904 | Ga0496101_0093823 | Ga0496101_0093823_653_1369 | 202 |
| 630 | 3300048905 | Ga0496102_0150383 | Ga0496102_0150383_291_1007 | 202 |
| 631 | 3300048906 | Ga0496103_0517714 | Ga0496103_0517714_24_704 | 202 |
| 632 | 3300048907 | Ga0496104_0128694 | Ga0496104_0128694_1413_2129 | 202 |
| 633 | 3300048908 | Ga0496105_0084391 | Ga0496105_0084391_1121_1837 | 202 |
| 634 | 3300048908 | Ga0496105_0112299 | Ga0496105_0112299_1332_2048 | 202 |
| 635 | 3300048909 | Ga0496106_0066213 | Ga0496106_0066213_1001_1717 | 202 |
| 636 | 3300048909 | Ga0496106_0129690 | Ga0496106_0129690_748_1464 | 202 |
| 637 | 3300048910 | Ga0496107_0015391 | Ga0496107_0015391_765_1484 | 202 |
| 638 | 3300048910 | Ga0496107_0071527 | Ga0496107_0071527_1761_2477 | 202 |
| 639 | 3300048910 | Ga0496107_0408690 | Ga0496107_0408690_69_785 | 202 |
| 640 | 3300048910 | Ga0496107_0479089 | Ga0496107_0479089_45_761 | 202 |
| 641 | 3300048911 | Ga0496108_0105817 | Ga0496108_0105817_771_1487 | 202 |
| 642 | 3300048911 | Ga0496108_0188003 | Ga0496108_0188003_72_788 | 202 |
| 643 | 3300048911 | Ga0496108_0454371 | Ga0496108_0454371_242_961 | 202 |
| 644 | 3300048913 | Ga0496110_0046380 | Ga0496110_0046380_1941_2660 | 202 |
| 645 | 3300048913 | Ga0496110_0110014 | Ga0496110_0110014_642_1358 | 202 |
| 646 | 3300048913 | Ga0496110_0295173 | Ga0496110_0295173_62_778 | 202 |
| 647 | 3300048915 | Ga0496112_0000602 | Ga0496112_0000602_23741_24457 | 202 |
| 648 | 3300048915 | Ga0496112_0048688 | Ga0496112_0048688_700_1416 | 202 |
| 649 | 3300048915 | Ga0496112_0645636 | Ga0496112_0645636_41_757 | 202 |
| 650 | 3300048916 | Ga0496113_0147461 | Ga0496113_0147461_444_1160 | 202 |
| 651 | 3300048917 | Ga0496114_0012266 | Ga0496114_0012266_2324_3043 | 202 |
| 652 | 3300048917 | Ga0496114_0510746 | Ga0496114_0510746_130_846 | 202 |
| 653 | 3300053134 | Ga0500658_0003570 | Ga0500658_0003570_118_834 | 202 |
| 654 | 3300061719 | Ga0466962_0006762 | Ga0466962_0006762_3088_3804 | 202 |
| 655 | 3300005339 | Ga0070660_100077617 | Ga0070660_1000776172 | 203 |
| 656 | 3300025926 | Ga0207659_10070580 | Ga0207659_100705804 | 203 |
| 657 | 3300032126 | Ga0307415_100079876 | Ga0307415_1000798762 | 204 |
| 658 | 3300032126 | Ga0307415_100440177 | Ga0307415_1004401772 | 204 |
| 659 | 3300035111 | Ga0373923_0068276 | Ga0373923_0068276_521_1225 | 204 |
| 660 | 3300005327 | Ga0070658_10292838 | Ga0070658_102928382 | 205 |
| 661 | 3300013296 | Ga0157374_10149969 | Ga0157374_101499692 | 205 |
| 662 | 3300031548 | Ga0307408_100083961 | Ga0307408_1000839613 | 206 |
| 663 | 3300031824 | Ga0307413_10042672 | Ga0307413_100426722 | 206 |
| 664 | 3300032126 | Ga0307415_100151259 | Ga0307415_1001512592 | 206 |
| 665 | 3300005436 | Ga0070713_100238374 | Ga0070713_1002383742 | 210 |
| 666 | 3300037312 | Ga0395899_0004509 | Ga0395899_0004509_5225_5965 | 210 |
| 667 | 3300037466 | Ga0395898_0007693 | Ga0395898_0007693_5649_6389 | 210 |
| 668 | 3300037471 | Ga0395905_0006447 | Ga0395905_0006447_5340_6080 | 210 |
| 669 | 3300037471 | Ga0395905_0071127 | Ga0395905_0071127_1169_1909 | 210 |
| 670 | 3300001979 | JGI24740J21852_10019537 | JGI24740J21852_100195372 | 211 |
| 671 | 3300001990 | JGI24737J22298_10004000 | JGI24737J22298_100040002 | 211 |
| 672 | 3300005457 | Ga0070662_100153785 | Ga0070662_1001537852 | 211 |
| 673 | 3300005530 | Ga0070679_100111295 | Ga0070679_1001112952 | 211 |
| 674 | 3300010375 | Ga0105239_10500934 | Ga0105239_105009341 | 211 |
| 675 | 3300013100 | Ga0157373_10028202 | Ga0157373_100282023 | 211 |
| 676 | 3300013307 | Ga0157372_10153558 | Ga0157372_101535582 | 211 |
| 677 | 3300025921 | Ga0207652_10580523 | Ga0207652_105805231 | 211 |
| 678 | 3300025933 | Ga0207706_10153509 | Ga0207706_101535092 | 211 |
| 679 | 3300025949 | Ga0207667_10441964 | Ga0207667_104419642 | 211 |
| 680 | 3300037312 | Ga0395899_0000416 | Ga0395899_0000416_2805_3548 | 211 |
| 681 | 3300001904 | JGI24736J21556_1005791 | JGI24736J21556_10057912 | 215 |
| 682 | 3300005344 | Ga0070661_100494182 | Ga0070661_1004941822 | 215 |
| 683 | 3300005455 | Ga0070663_100020888 | Ga0070663_1000208884 | 215 |
| 684 | 3300005614 | Ga0068856_100004105 | Ga0068856_1000041053 | 215 |
| 685 | 3300026067 | Ga0207678_10365789 | Ga0207678_103657892 | 215 |
| 686 | 3300026142 | Ga0207698_10010670 | Ga0207698_100106703 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i1j-assembly1.cif.gz_A | structure of a putative short chain dehydrogenase from pseudomonas syringae | 0.8867 | 5 | 199 |
| 3gy0-assembly1.cif.gz_A-2 | crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 complexed with nadp | 0.8863 | 6 | 199 |
| 3g1t-assembly1.cif.gz_A-2 | crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 | 0.8856 | 5 | 199 |
| 4z0t-assembly1.cif.gz_A | crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis | 0.8848 | 5 | 199 |
| 3gz4-assembly1.cif.gz_B | crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with nadph | 0.8834 | 6 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4z0tA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8848 | 5 | 199 | 3.40.50.720 |
| 3i1jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8668 | 5 | 201 | 3.40.50.720 |
| af_Q9VR28_44_308_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8637 | 7 | 200 | 3.40.50.720 |
| af_Q9T0G0_32_314_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8584 | 3 | 160 | 3.40.50.720 |
| af_Q3B7V0_30_291_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8582 | 5 | 200 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3CU73-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9387 | 62 | 201 |
GO:0016491
|
| AF-A0A2G1YM31-F1-model_v4 | Oxidoreductase | 0.9273 | 11 | 201 |
GO:0016491
|
| AF-A0A4Q3C5C6-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.925 | 48 | 201 |
GO:0016491
|
| AF-A0A5C6TX84-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9248 | 5 | 201 |
GO:0016020
GO:0016491 |
| AF-A0A7T2LMA6-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9247 | 5 | 201 |
GO:0016020
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar