F475074

General Info

Members Datasets Scaffolds Average Seq Length
684 469 461 242

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000258|Ga0495638_0000258_30596_31423
Length 275
Sequence LTWSISIDINAYSQEIKEKRAGTLSAAPEEGADMQNQIVSREEWLEARRALLLKEKEATHLRDKVNAERMAMPWVRVDKDYAFDTPQGRKSLSDLFDGRSQLMIYHFMLGPEWTDGCPGCSFLSDHVDGTLPHLNNHDVTWVAVSRAPVEKIEAYKKRMGWKFPWVSSFGSDFNFDYHVSFRPEDLADGKGTYNFTAVTPGTSPDELPGLSAFYKNESGEIFHTYSSYARGPEELIGTLMILDRAPKGRNEDATMNFVRRRDEYEDVQKTQSFCH

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
17 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
18 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
19 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
22 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
26 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
27 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
28 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
29 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
30 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
31 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
32 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
33 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
34 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
35 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
36 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
37 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
38 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
39 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
40 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
41 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
42 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
43 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
44 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
45 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
46 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
47 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
48 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
49 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
50 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
51 2643221584 Caulobacter sp. Root656 Isolate Unclassified
52 2643221599 Rhizobium sp. Root708 Isolate Unclassified
53 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
54 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
55 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
56 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
57 2643221719 Rhizobium sp. Root274 Isolate Unclassified
58 2643221723 Ensifer sp. Root278 Isolate Unclassified
59 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
60 2718217882 Rhizobium sp. N741 Isolate Nodule
61 2718217927 Rhizobium sp. N324 Isolate Nodule
62 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
63 2718218009 Rhizobium sp. N561 Isolate Nodule
64 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
65 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
66 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
67 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
68 2718218363 Rhizobium sp. N113 Isolate Nodule
69 2718218365 Rhizobium sp. N731 Isolate Nodule
70 2718218366 Rhizobium sp. N621 Isolate Nodule
71 2718218423 Rhizobium sp. N941 Isolate Nodule
72 2721755514 Rhizobium sp. N6212 Isolate Nodule
73 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
74 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
75 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
76 2721755809 Rhizobium sp. N541 Isolate Nodule
77 2721755810 Rhizobium sp. N871 Isolate Nodule
78 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
79 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
80 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
81 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
82 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
83 2728369365 Rhizobium sp. N1341 Isolate Nodule
84 2728369397 Rhizobium sp. N1314 Isolate Nodule
85 2738541293 Rhizobium sp. GV031 Isolate Unclassified
86 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
87 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
88 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
89 2791355256 Rhizobium sp. M10 Isolate Nodule
90 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
91 2791355260 Rhizobium sp. L9 Isolate Nodule
92 2791355261 Rhizobium sp. J15 Isolate Nodule
93 2791355262 Rhizobium sp. M1 Isolate Nodule
94 2791355263 Rhizobium chutanense C5 Isolate Nodule
95 2791355264 Rhizobium sp. S9 Isolate Nodule
96 2791355265 Rhizobium sp. H4 Isolate Nodule
97 2791355266 Rhizobium sp. L43 Isolate Nodule
98 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
99 2802429633 Rhizobium anhuiense J3 Isolate Nodule
100 2802429634 Rhizobium anhuiense S10 Isolate Nodule
101 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
102 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
103 2802429637 Rhizobium anhuiense C15 Isolate Nodule
104 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
105 2818991435 Caulobacter henricii 536 Isolate Unclassified
106 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
107 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
108 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
109 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
110 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
111 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
112 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
113 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
114 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
115 2838048938 Rhizobium pisi 27/80 Isolate Nodule
116 2838061910 Rhizobium phaseoli L15 Isolate Nodule
117 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
118 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
119 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
120 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
121 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
122 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
123 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
124 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
125 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
126 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
127 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
128 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
129 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
130 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
131 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
132 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
133 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
134 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
135 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
136 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
137 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
138 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
139 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
140 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
141 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
142 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
143 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
144 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
145 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
146 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
147 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
148 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
149 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
150 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
151 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
152 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
153 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
154 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
155 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
156 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
157 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
158 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
159 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
160 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
161 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
162 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
163 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
164 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
165 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
166 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
167 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
168 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
169 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
170 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
171 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
172 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
173 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
174 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
175 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
176 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
177 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
178 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
179 2933599457 Rhizobium phaseoli M3 Isolate Nodule
180 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
181 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
182 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
183 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
184 2936381700 Rhizobium chutanense C16 Isolate Unclassified
185 2996887358 Rhizobium sp. R711 Isolate Nodule
186 2996893221 Rhizobium sp. R635 Isolate Nodule
187 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
188 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
189 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
190 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
191 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
192 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
193 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
194 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
195 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
196 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
197 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
198 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
199 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
200 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
201 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
202 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
203 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
204 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
205 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
206 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
207 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
208 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
209 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
210 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
211 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
212 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
213 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
214 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
215 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
216 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
217 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
218 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
219 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
223 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
226 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
227 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
228 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
229 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
230 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
231 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
232 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
233 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
234 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
235 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
236 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
237 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
238 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
239 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
240 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
241 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
242 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
243 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
244 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
245 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
246 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
247 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
248 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
249 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
250 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
251 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
252 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
253 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
254 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
255 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
256 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
257 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
258 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
259 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
260 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
261 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
262 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
264 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
265 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
266 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
267 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
271 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
272 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
275 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
278 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
280 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
283 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
300 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
303 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
304 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
306 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
307 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
310 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
315 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
316 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
317 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
318 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
319 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
320 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
321 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
322 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
323 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
324 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
325 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
328 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
329 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
330 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
331 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
332 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
333 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
334 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
335 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
336 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
339 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
340 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
344 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
345 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
346 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
351 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
364 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
365 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
390 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
393 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
394 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
395 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
396 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
410 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
411 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
415 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
420 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
421 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
422 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
423 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
424 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
425 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
426 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
427 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
428 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
431 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
432 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
436 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
437 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
438 8005258706 Rhizobium sp. R693 Isolate Nodule
439 8005275841 Rhizobium sp. N4311 Isolate Nodule
440 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
441 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
442 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
443 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
444 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
445 8005321885 Rhizobium sp. R72 Isolate Nodule
446 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
447 8005382845 Rhizobium sp. R634 Isolate Nodule
448 8005395548 Rhizobium sp. R339 Isolate Nodule
449 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
450 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
451 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
452 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
453 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
454 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
455 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
456 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
457 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
458 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
459 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
460 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
461 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
462 8018176218 Rhizobium sp. N122 Isolate Nodule
463 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
464 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
465 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
466 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
467 8056382006 Rhizobium croatiense 13T Isolate Nodule
468 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
469 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.96
Metatranscriptomes 0.44
Isolates 32.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.65
Nodule 23.54
Rhizoplane 2.92
Rhizosphere 29.39
Stem 0
Stem Tuber 0
Unclassified 15.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000868 3300001979 Bacteria 13367
2 JGI25155J39150_1000006 3300002704 Bacteria 244109
3 JGI25156J39149_1000544 3300002705 Bacteria 21645
4 JGI25162J39368_1000813 3300002737 Bacteria 20590
5 JGI25162J39368_1001206 3300002737 Bacteria 15067
6 JGI25157J39369_1000581 3300002741 Bacteria 21637
7 JGI25152J39213_1000364 3300002773 Bacteria 28054
8 JGI25152J39213_1007237 3300002773 Bacteria 2899
9 JGI25152J39213_1011124 3300002773 Bacteria 2009
10 JGI25150J39212_1000052 3300002774 Bacteria 72258
11 JGI25150J39212_1001770 3300002774 Bacteria 5751
12 JGI25150J39212_1014594 3300002774 Bacteria 1331
13 JGI25159J45721_1000116 3300002987 Bacteria 38094
14 JGI25159J45721_1000674 3300002987 Bacteria 15077
15 JGI25151J46595_10000101 3300003187 Bacteria 115630
16 JGI25151J46595_10005461 3300003187 Bacteria 6565
17 JGI25151J46595_10012998 3300003187 Bacteria 3762
18 JGI25165J46597_1000468 3300003214 Bacteria 39852
19 JGI25165J46597_1002308 3300003214 Bacteria 6496
20 JGI25165J46597_1006743 3300003214 Bacteria 1999
21 JGI25153J46596_10000899 3300003215 Bacteria 18109
22 JGI25153J46596_10005779 3300003215 Bacteria 6438
23 JGI25153J46596_10022873 3300003215 Bacteria 2293
24 JGI25153J46596_10069812 3300003215 Bacteria 914
25 rootH1_10040817 3300003316 Bacteria 1617
26 rootH2_10011935 3300003320 Bacteria 14983
27 rootH2_10109795 3300003320 Bacteria 1621
28 rootH2_10166166 3300003320 Bacteria 2951
29 rootL2_10101089 3300003322 Bacteria 8853
30 rootL2_10143212 3300003322 Bacteria 1126
31 JGI25160J50197_1000009 3300003354 Bacteria 282862
32 JGI25160J50197_1000047 3300003354 Bacteria 136499
33 JGI25160J50197_1016758 3300003354 Bacteria 2348
34 JGI25160J50197_1022036 3300003354 Bacteria 1876
35 JGI25161J50226_1000033 3300003374 Bacteria 136499
36 JGI25161J50226_1000121 3300003374 Bacteria 56946
37 JGI25161J50226_1000425 3300003374 Bacteria 20141
38 JGI25161J50226_1001798 3300003374 Bacteria 6025
39 Ga0006780_1032801 3300003735 Bacteria 1065
40 Ga0055526_1002297 3300003771 Bacteria 13042
41 Ga0055526_1003720 3300003771 Bacteria 9526
42 Ga0055526_1009248 3300003771 Bacteria 4781
43 Ga0055526_1009458 3300003771 Bacteria 4682
44 Ga0055526_1015830 3300003771 Bacteria 2999
45 Ga0055524_1006117 3300003775 Bacteria 5265
46 Ga0055524_1008352 3300003775 Bacteria 4307
47 Ga0055524_1008551 3300003775 Bacteria 4244
48 Ga0055524_1011344 3300003775 Bacteria 3492
49 Ga0055524_1018725 3300003775 Bacteria 2394
50 Ga0055524_1018752 3300003775 Bacteria 2392
51 Ga0055524_1028527 3300003775 Bacteria 1670
52 Ga0055536_1004548 3300003781 Bacteria 7049
53 Ga0055536_1018192 3300003781 Bacteria 2263
54 Ga0055528_1000092 3300003790 Bacteria 71565
55 Ga0055528_1000788 3300003790 Bacteria 21984
56 Ga0055528_1003309 3300003790 Bacteria 8172
57 Ga0055528_1008756 3300003790 Bacteria 4290
58 Ga0055528_1019587 3300003790 Bacteria 2235
59 Ga0055530_10031403 3300003791 Bacteria 1394
60 Ga0055540_1010475 3300003792 Bacteria 3083
61 Ga0055540_1010772 3300003792 Bacteria 3017
62 Ga0055540_1018204 3300003792 Bacteria 1931
63 Ga0055531_10001415 3300003794 Bacteria 17729
64 Ga0055531_10043312 3300003794 Bacteria 1275
65 Ga0055543_1000055 3300004625 Bacteria 103837
66 Ga0055543_1000075 3300004625 Bacteria 87163
67 Ga0055543_1000176 3300004625 Bacteria 53419
68 Ga0055543_1000855 3300004625 Bacteria 14669
69 Ga0065165_1000020 3300005262 Bacteria 265570
70 Ga0065165_1000227 3300005262 Bacteria 98928
71 Ga0065165_1000750 3300005262 Bacteria 44415
72 Ga0065165_1013436 3300005262 Bacteria 3254
73 Ga0065165_1032480 3300005262 Bacteria 1635
74 Ga0070675_100094580 3300005354 Bacteria 2508
75 Ga0070671_100087696 3300005355 Bacteria 2604
76 Ga0070684_100064667 3300005535 Bacteria 3209
77 Ga0070665_100090422 3300005548 Bacteria 3067
78 Ga0070665_100156091 3300005548 Bacteria 2284
79 Ga0068855_100083426 3300005563 Bacteria 3702
80 Ga0068855_100204606 3300005563 Bacteria 2221
81 Ga0068854_100089535 3300005578 Bacteria 2287
82 Ga0068856_100080215 3300005614 Bacteria 3237
83 Ga0068852_100074685 3300005616 Bacteria 2987
84 Ga0068851_10102718 3300005834 Bacteria 1518
85 Ga0081455_10001255 3300005937 Bacteria 31699
86 Ga0081455_10277038 3300005937 Bacteria 1213
87 Ga0081538_10110745 3300005981 Bacteria 1348
88 Ga0075365_10068699 3300006038 Bacteria 2381
89 Ga0075365_10082716 3300006038 Bacteria 2177
90 Ga0075368_10054374 3300006042 Bacteria 1595
91 Ga0075364_10266280 3300006051 Bacteria 1165
92 Ga0075362_10011352 3300006177 Bacteria 3508
93 Ga0075367_10006121 3300006178 Bacteria 6050
94 Ga0075369_10019216 3300006186 Bacteria 2788
95 Ga0075369_10051238 3300006186 Bacteria 1787
96 Ga0075366_10039352 3300006195 Bacteria 2796
97 Ga0075366_10061016 3300006195 Bacteria 2240
98 Ga0068871_100254588 3300006358 Bacteria 1530
99 Ga0075428_100028442 3300006844 Bacteria 6185
100 Ga0075434_100017060 3300006871 Bacteria 6986
101 Ga0075435_100218348 3300007076 Bacteria 1619
102 Ga0099794_10007808 3300007265 Bacteria 4417
103 Ga0099795_10027703 3300007788 Bacteria 1919
104 Ga0105244_10058648 3300009036 Bacteria 1941
105 Ga0105240_10000027 3300009093 Bacteria 348486
106 Ga0111539_10205957 3300009094 Bacteria 2293
107 Ga0111539_11310179 3300009094 Bacteria 841
108 Ga0114129_10090320 3300009147 Bacteria 4247
109 Ga0114129_10130194 3300009147 Bacteria 3457
110 Ga0105243_10359978 3300009148 Bacteria 1339
111 Ga0105248_10355544 3300009177 Bacteria 1649
112 Ga0105237_10022479 3300009545 Bacteria 6471
113 Ga0105237_10190045 3300009545 Bacteria 2054
114 Ga0105237_10384167 3300009545 Bacteria 1409
115 Ga0105238_10437942 3300009551 Bacteria 1303
116 Ga0099796_10063130 3300010159 Bacteria 1318
117 Ga0105239_10006063 3300010375 Bacteria 14074
118 Ga0105239_10066724 3300010375 Bacteria 3952
119 Ga0157370_10000177 3300013104 Bacteria 79598
120 Ga0157369_10090937 3300013105 Bacteria 3258
121 Ga0163162_10807697 3300013306 Bacteria 1055
122 Ga0157372_10503180 3300013307 Bacteria 1413
123 Ga0163163_10711441 3300014325 Bacteria 1068
124 Ga0182007_10005294 3300015262 Bacteria 5691
125 Ga0163161_10239524 3300017792 Bacteria 1411
126 Ga0214542_1000095 3300021321 Bacteria 116012
127 Ga0214543_1000026 3300021327 Bacteria 220652
128 Ga0209435_100011 3300025206 Bacteria 413027
129 Ga0209436_100002 3300025208 Bacteria 222172
130 Ga0209436_102212 3300025208 Bacteria 6053
131 Ga0209436_108415 3300025208 Bacteria 2057
132 Ga0207427_108599 3300025231 Bacteria 1129
133 Ga0209437_100033 3300025233 Bacteria 512520
134 Ga0209437_100036 3300025233 Bacteria 469153
135 Ga0209437_103117 3300025233 Bacteria 3054
136 Ga0207425_1000071 3300025245 Bacteria 116125
137 Ga0207425_1003316 3300025245 Bacteria 5205
138 Ga0207425_1015737 3300025245 Bacteria 1691
139 Ga0207425_1021226 3300025245 Bacteria 1378
140 Ga0207425_1025189 3300025245 Bacteria 1230
141 Ga0207425_1027737 3300025245 Bacteria 1154
142 Ga0209646_1000024 3300025246 Bacteria 413027
143 Ga0209026_1000009 3300025250 Bacteria 531812
144 Ga0209677_100358 3300025253 Bacteria 28237
145 Ga0209148_1009859 3300025254 Bacteria 1837
146 Ga0209759_1000011 3300025256 Bacteria 413027
147 Ga0209129_1000019 3300025258 Bacteria 460802
148 Ga0209129_1000143 3300025258 Bacteria 116125
149 Ga0209129_1000496 3300025258 Bacteria 28663
150 Ga0209129_1000848 3300025258 Bacteria 19154
151 Ga0209129_1001052 3300025258 Bacteria 16291
152 Ga0209129_1001675 3300025258 Bacteria 12010
153 Ga0209129_1006821 3300025258 Bacteria 3571
154 Ga0209129_1007477 3300025258 Bacteria 3247
155 Ga0209129_1015364 3300025258 Bacteria 1580
156 Ga0209233_1000056 3300025261 Bacteria 438104
157 Ga0209233_1000064 3300025261 Bacteria 392156
158 Ga0209233_1000152 3300025261 Bacteria 175910
159 Ga0209565_1000127 3300025263 Bacteria 109900
160 Ga0209673_1000054 3300025273 Bacteria 279116
161 Ga0209673_1000169 3300025273 Bacteria 134216
162 Ga0209673_1002697 3300025273 Bacteria 11783
163 Ga0209673_1002736 3300025273 Bacteria 11613
164 Ga0209673_1005198 3300025273 Bacteria 6642
165 Ga0209673_1005377 3300025273 Bacteria 6463
166 Ga0209673_1014167 3300025273 Bacteria 3098
167 Ga0209673_1016193 3300025273 Bacteria 2799
168 Ga0209673_1019083 3300025273 Bacteria 2473
169 Ga0209673_1046928 3300025273 Bacteria 1175
170 Ga0209130_1000015 3300025284 Bacteria 409631
171 Ga0209130_1000037 3300025284 Bacteria 284019
172 Ga0209130_1000038 3300025284 Bacteria 264226
173 Ga0209130_1034862 3300025284 Bacteria 1010
174 Ga0209675_1005946 3300025291 Bacteria 5002
175 Ga0209676_1003650 3300025292 Bacteria 9237
176 Ga0209025_1000196 3300025294 Bacteria 147356
177 Ga0209025_1000280 3300025294 Bacteria 116125
178 Ga0209025_1000412 3300025294 Bacteria 86006
179 Ga0209025_1002425 3300025294 Bacteria 19791
180 Ga0209025_1005584 3300025294 Bacteria 10177
181 Ga0209025_1006112 3300025294 Bacteria 9500
182 Ga0209025_1008268 3300025294 Bacteria 7519
183 Ga0209025_1015277 3300025294 Bacteria 4643
184 Ga0209025_1021711 3300025294 Bacteria 3443
185 Ga0209564_1000086 3300025295 Bacteria 251385
186 Ga0209564_1000286 3300025295 Bacteria 102405
187 Ga0209564_1000944 3300025295 Bacteria 37475
188 Ga0209564_1001832 3300025295 Bacteria 19479
189 Ga0209564_1002869 3300025295 Bacteria 12641
190 Ga0209564_1012179 3300025295 Bacteria 3771
191 Ga0209564_1042433 3300025295 Bacteria 1206
192 Ga0209758_1000148 3300025297 Bacteria 166232
193 Ga0209758_1000235 3300025297 Bacteria 116093
194 Ga0209758_1000467 3300025297 Bacteria 66705
195 Ga0209758_1000486 3300025297 Bacteria 65083
196 Ga0209758_1000879 3300025297 Bacteria 41269
197 Ga0209758_1002245 3300025297 Bacteria 20050
198 Ga0209758_1002569 3300025297 Bacteria 18240
199 Ga0209758_1003193 3300025297 Bacteria 15296
200 Ga0209758_1034294 3300025297 Bacteria 2022
201 Ga0209050_1012232 3300025298 Bacteria 3960
202 Ga0209050_1021522 3300025298 Bacteria 2348
203 Ga0209256_1001962 3300025299 Bacteria 18584
204 Ga0209256_1002631 3300025299 Bacteria 14154
205 Ga0209256_1003042 3300025299 Bacteria 12364
206 Ga0209256_1003101 3300025299 Bacteria 12158
207 Ga0209256_1003230 3300025299 Bacteria 11761
208 Ga0209256_1003481 3300025299 Bacteria 10992
209 Ga0209256_1008269 3300025299 Bacteria 4866
210 Ga0209256_1009637 3300025299 Bacteria 4195
211 Ga0209256_1039502 3300025299 Bacteria 1213
212 Ga0207426_1000048 3300025302 Bacteria 409127
213 Ga0207426_1000081 3300025302 Bacteria 304502
214 Ga0207426_1000122 3300025302 Bacteria 218307
215 Ga0207426_1000146 3300025302 Bacteria 190683
216 Ga0207426_1002423 3300025302 Bacteria 11942
217 Ga0209051_1002236 3300025303 Bacteria 14267
218 Ga0209051_1004573 3300025303 Bacteria 8459
219 Ga0209051_1023174 3300025303 Bacteria 2589
220 Ga0209051_1039636 3300025303 Bacteria 1698
221 Ga0209051_1041432 3300025303 Bacteria 1638
222 Ga0209051_1061112 3300025303 Bacteria 1185
223 Ga0209257_1000159 3300025304 Bacteria 178767
224 Ga0209257_1004801 3300025304 Bacteria 10062
225 Ga0209257_1015490 3300025304 Bacteria 3168
226 Ga0209257_1033329 3300025304 Bacteria 1621
227 Ga0209257_1050101 3300025304 Bacteria 1184
228 Ga0207656_10062818 3300025321 Bacteria 1633
229 Ga0207643_10079924 3300025908 Bacteria 1893
230 Ga0207705_10541665 3300025909 Bacteria 905
231 Ga0207695_10000024 3300025913 Bacteria 632311
232 Ga0207671_10001001 3300025914 Bacteria 34722
233 Ga0207671_10323749 3300025914 Bacteria 1220
234 Ga0207671_10390481 3300025914 Bacteria 1106
235 Ga0207657_10054676 3300025919 Bacteria 3451
236 Ga0207681_10164501 3300025923 Bacteria 1676
237 Ga0207667_10063151 3300025949 Bacteria 3870
238 Ga0207667_10084444 3300025949 Bacteria 3287
239 Ga0207640_10106144 3300025981 Bacteria 1981
240 Ga0207678_10117679 3300026067 Bacteria 2267
241 Ga0207702_10348290 3300026078 Bacteria 1417
242 Ga0207676_10204559 3300026095 Bacteria 1747
243 Ga0207683_10160763 3300026121 Bacteria 2030
244 Ga0207698_10139540 3300026142 Bacteria 2086
245 Ga0209281_1000078 3300027111 Bacteria 261622
246 Ga0209371_1003389 3300027312 Bacteria 7810
247 Ga0209588_1016680 3300027671 Bacteria 2270
248 Ga0209813_10069693 3300027866 Bacteria 1141
249 Ga0207428_10250420 3300027907 Bacteria 1321
250 Ga0268266_10134751 3300028379 Bacteria 2211
251 Ga0268266_10221302 3300028379 Bacteria 1740
252 Ga0268266_10355547 3300028379 Bacteria 1377
253 Ga0307515_10000263 3300028794 Bacteria 130303
254 Ga0307515_10015158 3300028794 Bacteria 14217
255 Ga0307515_10074869 3300028794 Bacteria 4520
256 Ga0307513_10002589 3300031456 Bacteria 24996
257 Ga0307406_10042318 3300031901 Bacteria 2843
258 Ga0307412_10001652 3300031911 Bacteria 12316
259 Ga0307416_100190647 3300032002 Bacteria 1933
260 Ga0307414_10681990 3300032004 Bacteria 929
261 Ga0373931_0097033 3300035691 Bacteria 1652
262 Ga0395900_0582901 3300037418 Bacteria 1060
263 Ga0395898_0136896 3300037466 Bacteria 2345
264 Ga0400483_067410 3300039062 Plasmid 2569
265 Ga0400483_071423 3300039062 Bacteria 11134
266 Ga0400483_171694 3300039062 Bacteria 2821
267 Ga0400483_282390 3300039062 Bacteria 26477
268 Ga0439436_0051227 3300041404 Bacteria 1166
269 Ga0439438_058567 3300041405 Bacteria 968
270 Ga0439461_0049447 3300041410 Bacteria 929
271 Ga0439466_0066410 3300041411 Bacteria 1155
272 Ga0439465_0002035 3300041413 Bacteria 6626
273 Ga0439465_0018724 3300041413 Bacteria 2163
274 Ga0439465_0051505 3300041413 Bacteria 1349
275 Ga0451795_1255473 3300041456 Bacteria 2307
276 Ga0451833_0019537 3300041491 Bacteria 3259
277 Ga0451839_1229881 3300041496 Bacteria 1085
278 Ga0451841_1065715 3300041498 Bacteria 3006
279 Ga0451849_1298498 3300041505 Bacteria 2315
280 Ga0451851_0897106 3300041507 Bacteria 2651
281 Ga0451853_0071671 3300041512 Bacteria 3483
282 Ga0452268_45485 3300041907 Bacteria 804
283 Ga0439431_0052808 3300041997 Bacteria 1057
284 Ga0439445_0018489 3300042004 Bacteria 1731
285 Ga0439432_065097 3300042006 Bacteria 1118
286 Ga0439449_0019084 3300042007 Bacteria 2572
287 Ga0439434_0021882 3300042435 Bacteria 1921
288 Ga0466963_0016724 3300044694 Bacteria 4564
289 Ga0466964_0049239 3300044706 Bacteria 1725
290 Ga0466970_0002608 3300044765 Bacteria 8691
291 Ga0466958_0120326 3300045836 Bacteria 1643
292 Ga0495590_0087619 3300046457 Bacteria 1100
293 Ga0495638_0000258 3300046460 Bacteria 71672
294 Ga0495638_0002001 3300046460 Bacteria 17396
295 Ga0495638_0002440 3300046460 Bacteria 15176
296 Ga0495638_0107432 3300046460 Bacteria 1662
297 Ga0495650_0000007 3300046471 Bacteria 718072
298 Ga0495605_0006150 3300046474 Bacteria 6920
299 Ga0495584_0114469 3300046491 Bacteria 1365
300 Ga0495585_0003640 3300046492 Bacteria 10315
301 Ga0495585_0184499 3300046492 Bacteria 1071
302 Ga0495596_0054131 3300046500 Bacteria 1570
303 Ga0495607_0052687 3300046501 Bacteria 2355
304 Ga0495583_0003393 3300046506 Bacteria 12195
305 Ga0495606_0002344 3300046507 Bacteria 22278
306 Ga0495606_0014022 3300046507 Bacteria 6284
307 Ga0495610_0000299 3300046512 Bacteria 52173
308 Ga0495610_0034335 3300046512 Bacteria 2613
309 Ga0495616_0000044 3300046513 Bacteria 117255
310 Ga0495620_0010695 3300046515 Bacteria 4829
311 Ga0495620_0050057 3300046515 Bacteria 1784
312 Ga0495631_0001280 3300046518 Bacteria 15490
313 Ga0495631_0039054 3300046518 Bacteria 2108
314 Ga0495632_0000642 3300046519 Bacteria 32043
315 Ga0495632_0011131 3300046519 Bacteria 5269
316 Ga0495632_0027837 3300046519 Bacteria 2955
317 Ga0495632_0040313 3300046519 Bacteria 2353
318 Ga0495632_0051992 3300046519 Bacteria 2015
319 Ga0495637_0010786 3300046520 Bacteria 4406
320 Ga0495643_0067800 3300046522 Bacteria 1879
321 Ga0495643_0124609 3300046522 Bacteria 1298
322 Ga0495648_0058458 3300046524 Bacteria 2306
323 Ga0495654_0000054 3300046530 Bacteria 144303
324 Ga0495587_0080121 3300046536 Bacteria 1893
325 Ga0495609_0012348 3300046538 Bacteria 4052
326 Ga0495597_0036396 3300046542 Bacteria 2216
327 Ga0495633_0007292 3300046558 Bacteria 6385
328 Ga0495668_0017651 3300046616 Bacteria 4135
329 Ga0495668_0019572 3300046616 Bacteria 3900
330 Ga0495668_0046857 3300046616 Bacteria 2401
331 Ga0495668_0075552 3300046616 Bacteria 1850
332 Ga0495611_0009173 3300046648 Bacteria 4178
333 Ga0495625_0000415 3300046660 Bacteria 64352
334 Ga0495625_0001128 3300046660 Bacteria 34558
335 Ga0495625_0001676 3300046660 Bacteria 25857
336 Ga0495625_0059998 3300046660 Bacteria 2696
337 Ga0495625_0100012 3300046660 Bacteria 1993
338 Ga0495625_0173028 3300046660 Bacteria 1441
339 Ga0495661_0183342 3300046665 Bacteria 1108
340 Ga0495623_0020238 3300046679 Bacteria 4301
341 Ga0495649_0161350 3300046694 Bacteria 1175
342 Ga0495660_0005582 3300046810 Bacteria 7528
343 Ga0495660_0022306 3300046810 Bacteria 3614
344 Ga0495660_0158476 3300046810 Bacteria 1112
345 Ga0495636_0024472 3300047318 Bacteria 2449
346 Ga0495672_0001161 3300047320 Bacteria 26641
347 Ga0495672_0009333 3300047320 Bacteria 7121
348 Ga0495687_021815 3300047443 Bacteria 3087
349 Ga0495681_0031656 3300047470 Bacteria 2674
350 Ga0495681_0041022 3300047470 Bacteria 2250
351 Ga0495686_0001242 3300047472 Bacteria 29062
352 Ga0495686_0001402 3300047472 Bacteria 26629
353 Ga0495686_0002598 3300047472 Bacteria 16765
354 Ga0495686_0072983 3300047472 Bacteria 2109
355 Ga0495686_0097555 3300047472 Bacteria 1776
356 Ga0495593_0082950 3300047673 Bacteria 1657
357 Ga0495602_0025111 3300048088 Bacteria 5772
358 Ga0495626_0053050 3300048091 Bacteria 1868
359 Ga0496100_0143665 3300048903 Bacteria 1694
360 Ga0496102_0058214 3300048905 Bacteria 3531
361 Ga0496103_0014591 3300048906 Bacteria 4667
362 Ga0496103_0025436 3300048906 Bacteria 3578
363 Ga0496104_0000873 3300048907 Bacteria 25934
364 Ga0496105_0001981 3300048908 Bacteria 14741
365 Ga0496106_0000170 3300048909 Bacteria 47443
366 Ga0496106_0061350 3300048909 Bacteria 2852
367 Ga0496107_0040312 3300048910 Bacteria 3352
368 Ga0496107_0236534 3300048910 Bacteria 1359
369 Ga0496108_0002042 3300048911 Bacteria 16189
370 Ga0496109_0000836 3300048912 Bacteria 25684
371 Ga0496110_0003885 3300048913 Bacteria 11497
372 Ga0496111_0001512 3300048914 Bacteria 13339
373 Ga0496112_0000112 3300048915 Bacteria 50370
374 Ga0496114_0244231 3300048917 Bacteria 1579
375 Ga0496115_0001540 3300048918 Bacteria 16535
376 Ga0496115_0135221 3300048918 Bacteria 2032
377 Ga0496116_0000957 3300048919 Bacteria 35617
378 Ga0496116_0054003 3300048919 Bacteria 2650
379 Ga0496116_0150662 3300048919 Bacteria 1292
380 Ga0496117_0000337 3300048920 Bacteria 82874
381 Ga0496117_0005186 3300048920 Bacteria 13879
382 Ga0496117_0059422 3300048920 Bacteria 2641
383 Ga0496118_0001216 3300048921 Bacteria 39616
384 Ga0496118_0001474 3300048921 Bacteria 35225
385 Ga0496118_0055204 3300048921 Bacteria 3000
386 Ga0496118_0089176 3300048921 Bacteria 2130
387 Ga0496118_0153795 3300048921 Bacteria 1435
388 Ga0496119_0015532 3300048922 Bacteria 5852
389 Ga0496119_0076818 3300048922 Bacteria 1936
390 Ga0496120_0173582 3300048923 Bacteria 1064
391 Ga0496121_0000889 3300048924 Bacteria 53924
392 Ga0496121_0002268 3300048924 Bacteria 29933
393 Ga0496121_0009836 3300048924 Bacteria 10915
394 Ga0496121_0014692 3300048924 Bacteria 8276
395 Ga0496121_0021705 3300048924 Bacteria 6274
396 Ga0496121_0031740 3300048924 Bacteria 4818
397 Ga0496121_0036885 3300048924 Bacteria 4350
398 Ga0496122_0010817 3300048925 Bacteria 9346
399 Ga0496122_0019943 3300048925 Bacteria 6096
400 Ga0496122_0052189 3300048925 Bacteria 3098
401 Ga0496123_0003388 3300048926 Bacteria 17975
402 Ga0496123_0011184 3300048926 Bacteria 7811
403 Ga0496123_0059814 3300048926 Bacteria 2460
404 Ga0496123_0081441 3300048926 Bacteria 1967
405 Ga0496123_0242757 3300048926 Bacteria 893
406 Ga0496124_0001104 3300048927 Bacteria 42442
407 Ga0496124_0015505 3300048927 Bacteria 7296
408 Ga0496124_0035693 3300048927 Bacteria 4348
409 Ga0496124_0080965 3300048927 Bacteria 2671
410 Ga0496124_0170748 3300048927 Bacteria 1684
411 Ga0496124_0244124 3300048927 Bacteria 1333
412 Ga0496125_0008314 3300048928 Bacteria 10894
413 Ga0496125_0017088 3300048928 Bacteria 6932
414 Ga0496125_0065574 3300048928 Bacteria 2875
415 Ga0496125_0140876 3300048928 Bacteria 1677
416 Ga0496126_0072565 3300048929 Bacteria 3062
417 Ga0495678_003727 3300049459 Bacteria 9216
418 Ga0495682_0026181 3300049460 Bacteria 2168
419 Ga0501031_0338158 3300049568 Bacteria 975
420 Ga0501032_0041521 3300049569 Bacteria 3123
421 Ga0501034_0262191 3300049571 Bacteria 1671
422 Ga0501038_0098492 3300049574 Bacteria 2438
423 Ga0501039_0238557 3300049575 Bacteria 1430
424 Ga0501043_0028289 3300049579 Bacteria 4400
425 Ga0501047_0068688 3300049581 Bacteria 3413
426 Ga0501067_0098390 3300049583 Bacteria 1625
427 Ga0501238_001476 3300049671 Bacteria 2732
428 Ga0501238_001481 3300049671 Bacteria 2728
429 Ga0501280_002980 3300049776 Bacteria 2685
430 Ga0501044_0148073 3300049823 Bacteria 2331
431 nmdc:mga0yw44_25297_c1 3300050492 Bacteria 3373
432 nmdc:mga0k408_14920_c1 3300050493 Bacteria 4290
433 nmdc:mga0k408_45323_c1 3300050493 Bacteria 2537
434 nmdc:mga04h51_91804_c1 3300050495 Bacteria 1094
435 nmdc:mga0sz30_14596_c1 3300050516 Bacteria 3095
436 Ga0500610_0026045 3300053079 Bacteria 2924
437 Ga0495619_0249890 3300053085 Bacteria 1229
438 Ga0500578_0166119 3300053086 Bacteria 1367
439 Ga0500643_038768 3300053087 Bacteria 1411
440 Ga0500651_0156026 3300053093 Bacteria 1367
441 Ga0500556_0000932 3300053104 Bacteria 15848
442 Ga0500557_000725 3300053105 Bacteria 4665
443 Ga0500569_007842 3300053109 Bacteria 2416
444 Ga0500569_118545 3300053109 Bacteria 879
445 Ga0500608_020412 3300053122 Bacteria 3047
446 Ga0500618_008736 3300053125 Bacteria 2804
447 Ga0500658_0000556 3300053134 Bacteria 15709
448 Ga0500658_0006639 3300053134 Bacteria 4286
449 Ga0500658_0007876 3300053134 Bacteria 3937
450 Ga0500659_0055927 3300053135 Bacteria 2115
451 Ga0500568_0000408 3300053139 Bacteria 32817
452 Ga0500568_0001998 3300053139 Bacteria 12425
453 Ga0500604_0005833 3300053151 Bacteria 3255
454 Ga0500616_0001011 3300053153 Bacteria 30104
455 Ga0500616_0181691 3300053153 Bacteria 946
456 Ga0500622_0001317 3300053156 Bacteria 20196
457 Ga0500645_004647 3300053730 Bacteria 5225
458 Ga0500645_020191 3300053730 Bacteria 2066
459 Ga0587083_0060720 3300059505 Bacteria 851
460 Ga0466962_0032268 3300061719 Bacteria 2507
461 Ga0530510_0090260 3300061734 Bacteria 2235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10384167 Ga0105237_103841672 214
2 3300025914 Ga0207671_10323749 Ga0207671_103237492 214
3 3300003316 rootH1_10040817 rootH1_100408171 217
4 3300025297 Ga0209758_1002245 Ga0209758_100224510 217
5 3300046616 Ga0495668_0017651 Ga0495668_0017651_1851_2591 217
6 3300048910 Ga0496107_0236534 Ga0496107_0236534_214_954 217
7 3300053087 Ga0500643_038768 Ga0500643_038768_368_1105 217
8 3300003794 Ga0055531_10001415 Ga0055531_1000141521 218
9 3300025298 Ga0209050_1021522 Ga0209050_10215222 218
10 3300025304 Ga0209257_1000159 Ga0209257_100015968 218
11 3300046460 Ga0495638_0002001 Ga0495638_0002001_7396_8133 218
12 3300046460 Ga0495638_0002440 Ga0495638_0002440_5194_5931 218
13 3300046512 Ga0495610_0000299 Ga0495610_0000299_26701_27438 218
14 3300046513 Ga0495616_0000044 Ga0495616_0000044_88156_88893 218
15 3300046519 Ga0495632_0000642 Ga0495632_0000642_21471_22208 218
16 3300046519 Ga0495632_0027837 Ga0495632_0027837_1711_2448 218
17 3300046522 Ga0495643_0067800 Ga0495643_0067800_538_1275 218
18 3300046524 Ga0495648_0058458 Ga0495648_0058458_270_1007 218
19 3300046616 Ga0495668_0046857 Ga0495668_0046857_1201_1938 218
20 3300046616 Ga0495668_0075552 Ga0495668_0075552_826_1563 218
21 3300047320 Ga0495672_0001161 Ga0495672_0001161_8106_8846 218
22 3300047470 Ga0495681_0041022 Ga0495681_0041022_147_887 218
23 3300048929 Ga0496126_0072565 Ga0496126_0072565_672_1412 218
24 3300049671 Ga0501238_001476 Ga0501238_001476_1876_2619 218
25 3300053134 Ga0500658_0006639 Ga0500658_0006639_747_1484 218
26 3300053730 Ga0500645_020191 Ga0500645_020191_858_1598 218
27 3300049575 Ga0501039_0238557 Ga0501039_0238557_551_1321 220
28 3300046507 Ga0495606_0014022 Ga0495606_0014022_1796_2518 222
29 3300048924 Ga0496121_0014692 Ga0496121_0014692_4519_5241 222
30 3300041405 Ga0439438_058567 Ga0439438_058567_149_880 223
31 3300025294 Ga0209025_1015277 Ga0209025_10152776 224
32 3300032002 Ga0307416_100190647 Ga0307416_1001906472 224
33 3300041404 Ga0439436_0051227 Ga0439436_0051227_277_1008 224
34 3300041411 Ga0439466_0066410 Ga0439466_0066410_373_1104 224
35 3300041413 Ga0439465_0018724 Ga0439465_0018724_1312_2043 224
36 3300042007 Ga0439449_0019084 Ga0439449_0019084_41_772 224
37 3300042435 Ga0439434_0021882 Ga0439434_0021882_293_1024 224
38 3300013306 Ga0163162_10807697 Ga0163162_108076972 225
39 3300025919 Ga0207657_10054676 Ga0207657_100546762 225
40 3300041410 Ga0439461_0049447 Ga0439461_0049447_75_812 225
41 3300048928 Ga0496125_0140876 Ga0496125_0140876_10_687 225
42 3300028794 Ga0307515_10074869 Ga0307515_100748692 226
43 3300039062 Ga0400483_067410 Ga0400483_067410_1042_1743 226
44 3300039062 Ga0400483_171694 Ga0400483_171694_1829_2530 226
45 3300032004 Ga0307414_10681990 Ga0307414_106819901 227
46 3300049671 Ga0501238_001481 Ga0501238_001481_58_795 227
47 3300009094 Ga0111539_11310179 Ga0111539_113101791 228
48 3300027907 Ga0207428_10250420 Ga0207428_102504202 228
49 3300035691 Ga0373931_0097033 Ga0373931_0097033_378_1112 228
50 3300046810 Ga0495660_0158476 Ga0495660_0158476_78_815 229
51 3300005355 Ga0070671_100087696 Ga0070671_1000876965 230
52 3300005563 Ga0068855_100204606 Ga0068855_1002046062 230
53 3300005937 Ga0081455_10001255 Ga0081455_1000125511 230
54 3300006358 Ga0068871_100254588 Ga0068871_1002545882 230
55 3300013307 Ga0157372_10503180 Ga0157372_105031801 230
56 3300025949 Ga0207667_10063151 Ga0207667_100631513 230
57 3300026121 Ga0207683_10160763 Ga0207683_101607631 230
58 3300028794 Ga0307515_10000263 Ga0307515_1000026365 230
59 3300031456 Ga0307513_10002589 Ga0307513_100025894 230
60 3300039062 Ga0400483_071423 Ga0400483_071423_8394_9101 230
61 3300039062 Ga0400483_282390 Ga0400483_282390_10601_11308 230
62 3300049568 Ga0501031_0338158 Ga0501031_0338158_186_956 230
63 3300025304 Ga0209257_1033329 Ga0209257_10333292 231
64 3300049776 Ga0501280_002980 Ga0501280_002980_1321_2052 232
65 iso_pu_bacteria 2582581280 2585154124 233
66 iso_pu_bacteria 2582581293 2585197520 233
67 iso_pu_bacteria 2643221545 2643747528 233
68 iso_pu_bacteria 2643221552 2643778637 233
69 iso_pu_bacteria 2643221584 2643931212 233
70 iso_pu_bacteria 2643221691 2644509476 233
71 iso_pu_bacteria 2818991435 2819538802 233
72 iso_pu_bacteria 2818991454 2819648569 233
73 3300042004 Ga0439445_0018489 Ga0439445_0018489_927_1661 234
74 iso_pu_bacteria 2913295892 2913299831 234
75 3300003775 Ga0055524_1006117 Ga0055524_10061174 235
76 3300003775 Ga0055524_1011344 Ga0055524_10113442 235
77 3300003790 Ga0055528_1003309 Ga0055528_10033095 235
78 3300005262 Ga0065165_1000750 Ga0065165_100075020 235
79 3300006195 Ga0075366_10039352 Ga0075366_100393523 235
80 3300021321 Ga0214542_1000095 Ga0214542_10000959 235
81 3300021327 Ga0214543_1000026 Ga0214543_10000269 235
82 3300025263 Ga0209565_1000127 Ga0209565_100012758 235
83 3300025273 Ga0209673_1005198 Ga0209673_100519811 235
84 3300025273 Ga0209673_1014167 Ga0209673_10141673 235
85 3300025291 Ga0209675_1005946 Ga0209675_10059464 235
86 3300025295 Ga0209564_1002869 Ga0209564_100286912 235
87 3300025297 Ga0209758_1002569 Ga0209758_10025693 235
88 3300025299 Ga0209256_1001962 Ga0209256_100196212 235
89 3300025299 Ga0209256_1003481 Ga0209256_100348115 235
90 3300046471 Ga0495650_0000007 Ga0495650_0000007_277881_278621 235
91 3300046507 Ga0495606_0002344 Ga0495606_0002344_10356_11096 235
92 3300046515 Ga0495620_0010695 Ga0495620_0010695_3257_3997 235
93 3300046519 Ga0495632_0040313 Ga0495632_0040313_754_1494 235
94 3300046520 Ga0495637_0010786 Ga0495637_0010786_2159_2896 235
95 3300046530 Ga0495654_0000054 Ga0495654_0000054_37635_38375 235
96 3300046660 Ga0495625_0000415 Ga0495625_0000415_2546_3286 235
97 3300046660 Ga0495625_0001128 Ga0495625_0001128_8669_9409 235
98 3300046660 Ga0495625_0100012 Ga0495625_0100012_665_1405 235
99 3300047470 Ga0495681_0031656 Ga0495681_0031656_1629_2369 235
100 3300047472 Ga0495686_0001242 Ga0495686_0001242_21255_21995 235
101 3300048918 Ga0496115_0001540 Ga0496115_0001540_6273_7013 235
102 3300050493 nmdc:mga0k408_45323_c1 nmdc:mga0k408_45323_c1_788_1528 235
103 3300053086 Ga0500578_0166119 Ga0500578_0166119_325_1065 235
104 3300053104 Ga0500556_0000932 Ga0500556_0000932_3292_4029 235
105 3300053730 Ga0500645_004647 Ga0500645_004647_2603_3340 235
106 iso_pu_bacteria 2802429268 2804753312 235
107 3300009177 Ga0105248_10355544 Ga0105248_103555442 236
108 3300009545 Ga0105237_10190045 Ga0105237_101900453 236
109 3300025908 Ga0207643_10079924 Ga0207643_100799242 236
110 iso_pu_bacteria 2582581308 2585278714 236
111 iso_pu_bacteria 2582581315 2585325671 236
112 iso_pu_bacteria 2585427527 2585535824 236
113 iso_pu_bacteria 2585427530 2585554095 236
114 iso_pu_bacteria 2615840626 2616306012 236
115 iso_pu_bacteria 2643221723 2644676756 236
116 iso_pu_bacteria 2818991453 2819639443 236
117 3300003354 JGI25160J50197_1000009 JGI25160J50197_100000970 237
118 3300003374 JGI25161J50226_1000425 JGI25161J50226_10004258 237
119 3300003775 Ga0055524_1028527 Ga0055524_10285272 237
120 3300003781 Ga0055536_1004548 Ga0055536_10045481 237
121 3300003781 Ga0055536_1018192 Ga0055536_10181921 237
122 3300003791 Ga0055530_10031403 Ga0055530_100314032 237
123 3300004625 Ga0055543_1000055 Ga0055543_100005571 237
124 3300005262 Ga0065165_1000020 Ga0065165_1000020199 237
125 3300025208 Ga0209436_102212 Ga0209436_1022124 237
126 3300025284 Ga0209130_1000037 Ga0209130_1000037199 237
127 3300025292 Ga0209676_1003650 Ga0209676_10036506 237
128 3300025294 Ga0209025_1000196 Ga0209025_100019681 237
129 3300025295 Ga0209564_1000086 Ga0209564_100008671 237
130 3300025298 Ga0209050_1012232 Ga0209050_10122323 237
131 3300025299 Ga0209256_1003101 Ga0209256_10031017 237
132 3300025302 Ga0207426_1000048 Ga0207426_1000048239 237
133 3300025303 Ga0209051_1039636 Ga0209051_10396362 237
134 3300025304 Ga0209257_1004801 Ga0209257_10048014 237
135 iso_pu_bacteria 2510461069 2510840159 237
136 iso_pu_bacteria 2513237144 2513907785 237
137 iso_pu_bacteria 2513237146 2513927402 237
138 iso_pu_bacteria 2524023209 2524457829 237
139 iso_pu_bacteria 2582581294 2585204173 237
140 iso_pu_bacteria 2599185170 2599418829 237
141 iso_pu_bacteria 2615840698 2616553742 237
142 iso_pu_bacteria 2617270742 2617382002 237
143 iso_pu_bacteria 2643221599 2644007675 237
144 iso_pu_bacteria 2667528174 2671112676 237
145 iso_pu_bacteria 2718217997 2719664372 237
146 iso_pu_bacteria 2718218199 2720490792 237
147 iso_pu_bacteria 2718218232 2720612156 237
148 iso_pu_bacteria 2718218235 2720630395 237
149 iso_pu_bacteria 2718218269 2720774089 237
150 iso_pu_bacteria 2721755556 2723025816 237
151 iso_pu_bacteria 2721755684 2723559358 237
152 iso_pu_bacteria 2721755685 2723565977 237
153 iso_pu_bacteria 2721755819 2724088696 237
154 iso_pu_bacteria 2721755822 2724103242 237
155 iso_pu_bacteria 2721755823 2724109073 237
156 iso_pu_bacteria 2728369352 2730106752 237
157 iso_pu_bacteria 2765235942 2766062534 237
158 iso_pu_bacteria 2775507266 2778177285 237
159 iso_pu_bacteria 2818991448 2819612580 237
160 iso_pu_bacteria 2838016132 2838017038 237
161 iso_pu_bacteria 2838029111 2838031229 237
162 iso_pu_bacteria 2838035591 2838037483 237
163 iso_pu_bacteria 2838048938 2838054879 237
164 iso_pu_bacteria 2838061910 2838067799 237
165 iso_pu_bacteria 2838068647 2838073085 237
166 iso_pu_bacteria 2838661181 2838663371 237
167 iso_pu_bacteria 2842110456 2842115840 237
168 iso_pu_bacteria 2842264693 2842269807 237
169 iso_pu_bacteria 2842298080 2842300556 237
170 iso_pu_bacteria 2842357229 2842358326 237
171 iso_pu_bacteria 2842422224 2842426742 237
172 iso_pu_bacteria 2842428310 2842433692 237
173 iso_pu_bacteria 2842434925 2842440020 237
174 iso_pu_bacteria 2842441272 2842446625 237
175 iso_pu_bacteria 2842447887 2842452158 237
176 iso_pu_bacteria 2842462802 2842468079 237
177 iso_pu_bacteria 2842469257 2842474605 237
178 iso_pu_bacteria 2842475841 2842478176 237
179 iso_pu_bacteria 2842482326 2842482665 237
180 iso_pu_bacteria 2842502639 2842504985 237
181 iso_pu_bacteria 2857516855 2857523199 237
182 iso_pu_bacteria 2919408235 2919409113 237
183 iso_pu_bacteria 2933586486 2933592199 237
184 iso_pu_bacteria 2933599457 2933603277 237
185 iso_pu_bacteria 3005409236 3005411521 237
186 iso_pu_bacteria 3005416602 3005417661 237
187 iso_pu_bacteria 8005282627 8005283995 237
188 iso_pu_bacteria 8005314921 8005315016 237
189 iso_pu_bacteria 8005430974 8005432479 237
190 iso_pu_bacteria 8005484373 8005485821 237
191 iso_pu_bacteria 8005497431 8005499087 237
192 iso_pu_bacteria 8005619151 8005620276 237
193 iso_pu_bacteria 8005645114 8005645689 237
194 iso_pu_bacteria 8005668836 8005670502 237
195 iso_pu_bacteria 8005682033 8005684794 237
196 iso_pu_bacteria 8046767195 8046770102 237
197 iso_pu_bacteria 8057575449 8057579006 237
198 iso_pu_bacteria 2509276033 2509443569 238
199 iso_pu_bacteria 2510065019 2510132042 238
200 iso_pu_bacteria 2510461076 2510898345 238
201 iso_pu_bacteria 2510917028 2511183135 238
202 iso_pu_bacteria 2513237084 2513568865 238
203 iso_pu_bacteria 2513237085 2513579893 238
204 iso_pu_bacteria 2513237088 2513600051 238
205 iso_pu_bacteria 2513237093 2513634541 238
206 iso_pu_bacteria 2513237103 2513709482 238
207 iso_pu_bacteria 2513237138 2513871751 238
208 iso_pu_bacteria 2513237162 2514022856 238
209 iso_pu_bacteria 2515075009 2515111004 238
210 iso_pu_bacteria 2515154113 2515638830 238
211 iso_pu_bacteria 2515154114 2515646566 238
212 iso_pu_bacteria 2515154116 2515661749 238
213 iso_pu_bacteria 2515154134 2515743062 238
214 iso_pu_bacteria 2516653077 2517039664 238
215 iso_pu_bacteria 2516653085 2517075185 238
216 iso_pu_bacteria 2517093000 2517093789 238
217 iso_pu_bacteria 2517287029 2517405602 238
218 iso_pu_bacteria 2529292951 2530644155 238
219 iso_pu_bacteria 2534681796 2535515446 238
220 iso_pu_bacteria 2582581299 2585230635 238
221 iso_pu_bacteria 2582581304 2585256860 238
222 iso_pu_bacteria 2582581867 2585405176 238
223 iso_pu_bacteria 2585427526 2585525370 238
224 iso_pu_bacteria 2585427528 2585542523 238
225 iso_pu_bacteria 2585427590 2585823101 238
226 iso_pu_bacteria 2585427593 2585838126 238
227 iso_pu_bacteria 2585427594 2585844304 238
228 iso_pu_bacteria 2643221634 2644190922 238
229 iso_pu_bacteria 2643221643 2644241232 238
230 iso_pu_bacteria 2718217882 2719180026 238
231 iso_pu_bacteria 2718217927 2719384624 238
232 iso_pu_bacteria 2718218009 2719730775 238
233 iso_pu_bacteria 2718218363 2721146119 238
234 iso_pu_bacteria 2718218365 2721157638 238
235 iso_pu_bacteria 2718218366 2721162999 238
236 iso_pu_bacteria 2718218423 2721398334 238
237 iso_pu_bacteria 2721755514 2722839169 238
238 iso_pu_bacteria 2721755809 2724037147 238
239 iso_pu_bacteria 2721755810 2724043531 238
240 iso_pu_bacteria 2724679232 2725946823 238
241 iso_pu_bacteria 2728369365 2730163263 238
242 iso_pu_bacteria 2728369397 2730297270 238
243 iso_pu_bacteria 2738541293 2738802515 238
244 iso_pu_bacteria 2738541333 2739035007 238
245 iso_pu_bacteria 2791355256 2793298901 238
246 iso_pu_bacteria 2791355260 2793322867 238
247 iso_pu_bacteria 2791355261 2793330303 238
248 iso_pu_bacteria 2791355262 2793337454 238
249 iso_pu_bacteria 2791355263 2793344061 238
250 iso_pu_bacteria 2791355264 2793349226 238
251 iso_pu_bacteria 2791355265 2793355898 238
252 iso_pu_bacteria 2791355266 2793363300 238
253 iso_pu_bacteria 2802429633 2806044286 238
254 iso_pu_bacteria 2802429634 2806051903 238
255 iso_pu_bacteria 2802429635 2806058205 238
256 iso_pu_bacteria 2802429636 2806069085 238
257 iso_pu_bacteria 2802429637 2806075872 238
258 iso_pu_bacteria 2818991272 2819242834 238
259 iso_pu_bacteria 2838022645 2838028994 238
260 iso_pu_bacteria 2838680041 2838681050 238
261 iso_pu_bacteria 2838686498 2838688899 238
262 iso_pu_bacteria 2838694306 2838694917 238
263 iso_pu_bacteria 2838707686 2838708293 238
264 iso_pu_bacteria 2838729681 2838731194 238
265 iso_pu_bacteria 2838742623 2838743912 238
266 iso_pu_bacteria 2841851746 2841857122 238
267 iso_pu_bacteria 2842077413 2842080473 238
268 iso_pu_bacteria 2842118031 2842121092 238
269 iso_pu_bacteria 2842156927 2842159763 238
270 iso_pu_bacteria 2842163707 2842169360 238
271 iso_pu_bacteria 2842180545 2842183620 238
272 iso_pu_bacteria 2842192696 2842193387 238
273 iso_pu_bacteria 2842198810 2842205132 238
274 iso_pu_bacteria 2842205361 2842207949 238
275 iso_pu_bacteria 2842217011 2842220849 238
276 iso_pu_bacteria 2842229732 2842233900 238
277 iso_pu_bacteria 2842237096 2842237705 238
278 iso_pu_bacteria 2842243621 2842245376 238
279 iso_pu_bacteria 2842257432 2842259974 238
280 iso_pu_bacteria 2842271015 2842274813 238
281 iso_pu_bacteria 2842278818 2842281256 238
282 iso_pu_bacteria 2842285085 2842290532 238
283 iso_pu_bacteria 2842291075 2842294132 238
284 iso_pu_bacteria 2842304105 2842307059 238
285 iso_pu_bacteria 2842370503 2842371513 238
286 iso_pu_bacteria 2842377471 2842380529 238
287 iso_pu_bacteria 2842384541 2842387600 238
288 iso_pu_bacteria 2842395702 2842401096 238
289 iso_pu_bacteria 2842402390 2842408370 238
290 iso_pu_bacteria 2842409023 2842415045 238
291 iso_pu_bacteria 2842415677 2842421674 238
292 iso_pu_bacteria 2844454524 2844455424 238
293 iso_pu_bacteria 2933570622 2933572827 238
294 iso_pu_bacteria 2935894831 2935895439 238
295 iso_pu_bacteria 2935901341 2935906574 238
296 iso_pu_bacteria 2936367885 2936368411 238
297 iso_pu_bacteria 2936375103 2936376239 238
298 iso_pu_bacteria 2936381700 2936386991 238
299 iso_pu_bacteria 2996893221 2996893780 238
300 iso_pu_bacteria 3005452660 3005453192 238
301 iso_pu_bacteria 639633055 639647182 238
302 iso_pu_bacteria 8005275841 8005279339 238
303 iso_pu_bacteria 8005289223 8005292538 238
304 iso_pu_bacteria 8005301065 8005304305 238
305 iso_pu_bacteria 8005307578 8005311470 238
306 iso_pu_bacteria 8005376324 8005376899 238
307 iso_pu_bacteria 8005382845 8005386235 238
308 iso_pu_bacteria 8005395548 8005397367 238
309 iso_pu_bacteria 8005460587 8005461641 238
310 iso_pu_bacteria 8005570704 8005577410 238
311 iso_pu_bacteria 8005688590 8005690727 238
312 iso_pu_bacteria 8005695170 8005698334 238
313 iso_pu_bacteria 8018163183 8018168452 238
314 iso_pu_bacteria 8018176218 8018178151 238
315 iso_pu_bacteria 8023680758 8023687276 238
316 iso_pu_bacteria 8024479707 8024480808 238
317 iso_pu_bacteria 8056382006 8056385003 238
318 iso_pu_bacteria 8057874678 8057881708 238
319 3300005981 Ga0081538_10110745 Ga0081538_101107452 239
320 3300007265 Ga0099794_10007808 Ga0099794_100078086 239
321 3300007788 Ga0099795_10027703 Ga0099795_100277032 239
322 3300009147 Ga0114129_10130194 Ga0114129_101301943 239
323 3300010159 Ga0099796_10063130 Ga0099796_100631302 239
324 3300027671 Ga0209588_1016680 Ga0209588_10166802 239
325 3300037418 Ga0395900_0582901 Ga0395900_0582901_39_785 239
326 3300037466 Ga0395898_0136896 Ga0395898_0136896_1172_1918 239
327 3300046536 Ga0495587_0080121 Ga0495587_0080121_549_1322 239
328 3300046679 Ga0495623_0020238 Ga0495623_0020238_991_1764 239
329 3300048088 Ga0495602_0025111 Ga0495602_0025111_1095_1868 239
330 3300061734 Ga0530510_0090260 Ga0530510_0090260_312_1064 239
331 iso_pu_bacteria 2923556063 2923561497 239
332 iso_pu_bacteria 2996887358 2996889385 239
333 iso_pu_bacteria 8005258706 8005260732 239
334 iso_pu_bacteria 8005321885 8005323912 239
335 iso_pu_bacteria 8005542996 8005544066 239
336 iso_pu_bacteria 8054558443 8054560582 239
337 3300003214 JGI25165J46597_1006743 JGI25165J46597_10067433 240
338 3300003320 rootH2_10011935 rootH2_100119353 240
339 3300003320 rootH2_10109795 rootH2_101097951 240
340 3300005354 Ga0070675_100094580 Ga0070675_1000945802 240
341 3300005535 Ga0070684_100064667 Ga0070684_1000646671 240
342 3300005563 Ga0068855_100083426 Ga0068855_1000834263 240
343 3300005578 Ga0068854_100089535 Ga0068854_1000895353 240
344 3300005616 Ga0068852_100074685 Ga0068852_1000746853 240
345 3300005834 Ga0068851_10102718 Ga0068851_101027182 240
346 3300006038 Ga0075365_10082716 Ga0075365_100827162 240
347 3300006844 Ga0075428_100028442 Ga0075428_1000284426 240
348 3300006871 Ga0075434_100017060 Ga0075434_1000170603 240
349 3300007076 Ga0075435_100218348 Ga0075435_1002183482 240
350 3300009093 Ga0105240_10000027 Ga0105240_10000027220 240
351 3300009094 Ga0111539_10205957 Ga0111539_102059573 240
352 3300009147 Ga0114129_10090320 Ga0114129_100903205 240
353 3300009148 Ga0105243_10359978 Ga0105243_103599782 240
354 3300009545 Ga0105237_10022479 Ga0105237_100224795 240
355 3300009551 Ga0105238_10437942 Ga0105238_104379421 240
356 3300010375 Ga0105239_10006063 Ga0105239_100060632 240
357 3300010375 Ga0105239_10066724 Ga0105239_100667243 240
358 3300013104 Ga0157370_10000177 Ga0157370_1000017763 240
359 3300013105 Ga0157369_10090937 Ga0157369_100909374 240
360 3300015262 Ga0182007_10005294 Ga0182007_100052945 240
361 3300025233 Ga0209437_103117 Ga0209437_1031172 240
362 3300025253 Ga0209677_100358 Ga0209677_10035824 240
363 3300025261 Ga0209233_1000064 Ga0209233_1000064344 240
364 3300025273 Ga0209673_1046928 Ga0209673_10469282 240
365 3300025321 Ga0207656_10062818 Ga0207656_100628181 240
366 3300025909 Ga0207705_10541665 Ga0207705_105416651 240
367 3300025913 Ga0207695_10000024 Ga0207695_10000024411 240
368 3300025914 Ga0207671_10001001 Ga0207671_1000100115 240
369 3300025914 Ga0207671_10390481 Ga0207671_103904812 240
370 3300025923 Ga0207681_10164501 Ga0207681_101645012 240
371 3300025949 Ga0207667_10084444 Ga0207667_100844443 240
372 3300025981 Ga0207640_10106144 Ga0207640_101061443 240
373 3300026067 Ga0207678_10117679 Ga0207678_101176793 240
374 3300026078 Ga0207702_10348290 Ga0207702_103482902 240
375 3300026095 Ga0207676_10204559 Ga0207676_102045592 240
376 3300026142 Ga0207698_10139540 Ga0207698_101395402 240
377 3300041413 Ga0439465_0002035 Ga0439465_0002035_4648_5373 240
378 3300041997 Ga0439431_0052808 Ga0439431_0052808_131_856 240
379 3300042006 Ga0439432_065097 Ga0439432_065097_224_949 240
380 3300046492 Ga0495585_0184499 Ga0495585_0184499_331_1053 240
381 3300047472 Ga0495686_0001402 Ga0495686_0001402_18478_19200 240
382 3300047673 Ga0495593_0082950 Ga0495593_0082950_734_1477 240
383 3300048903 Ga0496100_0143665 Ga0496100_0143665_217_939 240
384 3300048905 Ga0496102_0058214 Ga0496102_0058214_2094_2816 240
385 3300048906 Ga0496103_0014591 Ga0496103_0014591_1695_2417 240
386 3300048906 Ga0496103_0025436 Ga0496103_0025436_168_911 240
387 3300048907 Ga0496104_0000873 Ga0496104_0000873_22700_23446 240
388 3300048908 Ga0496105_0001981 Ga0496105_0001981_4882_5625 240
389 3300048909 Ga0496106_0061350 Ga0496106_0061350_298_1065 240
390 3300048910 Ga0496107_0040312 Ga0496107_0040312_409_1152 240
391 3300048911 Ga0496108_0002042 Ga0496108_0002042_2701_3447 240
392 3300048912 Ga0496109_0000836 Ga0496109_0000836_23473_24219 240
393 3300048913 Ga0496110_0003885 Ga0496110_0003885_9286_10032 240
394 3300048914 Ga0496111_0001512 Ga0496111_0001512_1124_1870 240
395 3300048915 Ga0496112_0000112 Ga0496112_0000112_42875_43621 240
396 3300048917 Ga0496114_0244231 Ga0496114_0244231_414_1136 240
397 3300048918 Ga0496115_0135221 Ga0496115_0135221_914_1657 240
398 3300048919 Ga0496116_0150662 Ga0496116_0150662_536_1258 240
399 3300048920 Ga0496117_0000337 Ga0496117_0000337_63262_63984 240
400 3300048921 Ga0496118_0001216 Ga0496118_0001216_18891_19613 240
401 3300048922 Ga0496119_0076818 Ga0496119_0076818_1184_1906 240
402 3300048924 Ga0496121_0002268 Ga0496121_0002268_10319_11041 240
403 3300048926 Ga0496123_0003388 Ga0496123_0003388_10496_11218 240
404 3300048926 Ga0496123_0242757 Ga0496123_0242757_41_808 240
405 3300048927 Ga0496124_0015505 Ga0496124_0015505_5540_6262 240
406 3300048927 Ga0496124_0170748 Ga0496124_0170748_142_909 240
407 3300048928 Ga0496125_0065574 Ga0496125_0065574_1998_2720 240
408 3300049823 Ga0501044_0148073 Ga0501044_0148073_135_905 240
409 3300053085 Ga0495619_0249890 Ga0495619_0249890_205_948 240
410 3300001979 JGI24740J21852_10000868 JGI24740J21852_1000086813 241
411 3300002704 JGI25155J39150_1000006 JGI25155J39150_100000610 241
412 3300002705 JGI25156J39149_1000544 JGI25156J39149_100054412 241
413 3300002737 JGI25162J39368_1000813 JGI25162J39368_100081323 241
414 3300002737 JGI25162J39368_1001206 JGI25162J39368_100120617 241
415 3300002741 JGI25157J39369_1000581 JGI25157J39369_100058112 241
416 3300002773 JGI25152J39213_1000364 JGI25152J39213_10003643 241
417 3300002773 JGI25152J39213_1007237 JGI25152J39213_10072374 241
418 3300002773 JGI25152J39213_1011124 JGI25152J39213_10111241 241
419 3300002774 JGI25150J39212_1000052 JGI25150J39212_100005272 241
420 3300002774 JGI25150J39212_1001770 JGI25150J39212_10017707 241
421 3300002774 JGI25150J39212_1014594 JGI25150J39212_10145942 241
422 3300002987 JGI25159J45721_1000116 JGI25159J45721_100011639 241
423 3300002987 JGI25159J45721_1000674 JGI25159J45721_100067412 241
424 3300003187 JGI25151J46595_10000101 JGI25151J46595_1000010181 241
425 3300003187 JGI25151J46595_10005461 JGI25151J46595_100054612 241
426 3300003187 JGI25151J46595_10012998 JGI25151J46595_100129983 241
427 3300003214 JGI25165J46597_1000468 JGI25165J46597_100046843 241
428 3300003214 JGI25165J46597_1002308 JGI25165J46597_10023084 241
429 3300003215 JGI25153J46596_10000899 JGI25153J46596_1000089913 241
430 3300003215 JGI25153J46596_10005779 JGI25153J46596_100057794 241
431 3300003215 JGI25153J46596_10022873 JGI25153J46596_100228734 241
432 3300003215 JGI25153J46596_10069812 JGI25153J46596_100698121 241
433 3300003320 rootH2_10166166 rootH2_101661663 241
434 3300003322 rootL2_10101089 rootL2_1010108911 241
435 3300003322 rootL2_10143212 rootL2_101432122 241
436 3300003354 JGI25160J50197_1000047 JGI25160J50197_100004766 241
437 3300003354 JGI25160J50197_1016758 JGI25160J50197_10167583 241
438 3300003354 JGI25160J50197_1022036 JGI25160J50197_10220362 241
439 3300003374 JGI25161J50226_1000033 JGI25161J50226_100003366 241
440 3300003374 JGI25161J50226_1000121 JGI25161J50226_10001219 241
441 3300003374 JGI25161J50226_1001798 JGI25161J50226_10017983 241
442 3300003735 Ga0006780_1032801 Ga0006780_10328011 241
443 3300003771 Ga0055526_1002297 Ga0055526_10022974 241
444 3300003771 Ga0055526_1003720 Ga0055526_100372012 241
445 3300003771 Ga0055526_1009248 Ga0055526_10092484 241
446 3300003771 Ga0055526_1009458 Ga0055526_10094589 241
447 3300003771 Ga0055526_1015830 Ga0055526_10158305 241
448 3300003775 Ga0055524_1008352 Ga0055524_10083524 241
449 3300003775 Ga0055524_1008551 Ga0055524_10085513 241
450 3300003775 Ga0055524_1018725 Ga0055524_10187253 241
451 3300003775 Ga0055524_1018752 Ga0055524_10187524 241
452 3300003790 Ga0055528_1000092 Ga0055528_100009242 241
453 3300003790 Ga0055528_1000788 Ga0055528_10007885 241
454 3300003790 Ga0055528_1008756 Ga0055528_10087564 241
455 3300003790 Ga0055528_1019587 Ga0055528_10195873 241
456 3300003792 Ga0055540_1010475 Ga0055540_10104753 241
457 3300003792 Ga0055540_1010772 Ga0055540_10107723 241
458 3300003792 Ga0055540_1018204 Ga0055540_10182043 241
459 3300003794 Ga0055531_10043312 Ga0055531_100433122 241
460 3300004625 Ga0055543_1000075 Ga0055543_100007591 241
461 3300004625 Ga0055543_1000176 Ga0055543_10001764 241
462 3300004625 Ga0055543_1000855 Ga0055543_10008557 241
463 3300005262 Ga0065165_1000227 Ga0065165_100022723 241
464 3300005262 Ga0065165_1013436 Ga0065165_10134363 241
465 3300005262 Ga0065165_1032480 Ga0065165_10324802 241
466 3300005548 Ga0070665_100090422 Ga0070665_1000904223 241
467 3300005548 Ga0070665_100156091 Ga0070665_1001560913 241
468 3300005614 Ga0068856_100080215 Ga0068856_1000802152 241
469 3300005937 Ga0081455_10277038 Ga0081455_102770382 241
470 3300006038 Ga0075365_10068699 Ga0075365_100686992 241
471 3300006042 Ga0075368_10054374 Ga0075368_100543741 241
472 3300006051 Ga0075364_10266280 Ga0075364_102662802 241
473 3300006177 Ga0075362_10011352 Ga0075362_100113523 241
474 3300006178 Ga0075367_10006121 Ga0075367_100061219 241
475 3300006186 Ga0075369_10019216 Ga0075369_100192162 241
476 3300006186 Ga0075369_10051238 Ga0075369_100512382 241
477 3300006195 Ga0075366_10061016 Ga0075366_100610164 241
478 3300009036 Ga0105244_10058648 Ga0105244_100586483 241
479 3300014325 Ga0163163_10711441 Ga0163163_107114411 241
480 3300017792 Ga0163161_10239524 Ga0163161_102395242 241
481 3300025206 Ga0209435_100011 Ga0209435_10001111 241
482 3300025208 Ga0209436_100002 Ga0209436_100002165 241
483 3300025208 Ga0209436_108415 Ga0209436_1084151 241
484 3300025231 Ga0207427_108599 Ga0207427_1085991 241
485 3300025233 Ga0209437_100033 Ga0209437_10003388 241
486 3300025233 Ga0209437_100036 Ga0209437_100036342 241
487 3300025245 Ga0207425_1000071 Ga0207425_100007184 241
488 3300025245 Ga0207425_1003316 Ga0207425_10033165 241
489 3300025245 Ga0207425_1015737 Ga0207425_10157371 241
490 3300025245 Ga0207425_1021226 Ga0207425_10212261 241
491 3300025245 Ga0207425_1025189 Ga0207425_10251892 241
492 3300025245 Ga0207425_1027737 Ga0207425_10277372 241
493 3300025246 Ga0209646_1000024 Ga0209646_1000024400 241
494 3300025250 Ga0209026_1000009 Ga0209026_1000009515 241
495 3300025254 Ga0209148_1009859 Ga0209148_10098592 241
496 3300025256 Ga0209759_1000011 Ga0209759_100001111 241
497 3300025258 Ga0209129_1000019 Ga0209129_100001973 241
498 3300025258 Ga0209129_1000143 Ga0209129_100014384 241
499 3300025258 Ga0209129_1000496 Ga0209129_100049626 241
500 3300025258 Ga0209129_1000848 Ga0209129_100084814 241
501 3300025258 Ga0209129_1001052 Ga0209129_10010523 241
502 3300025258 Ga0209129_1001675 Ga0209129_100167511 241
503 3300025258 Ga0209129_1006821 Ga0209129_10068214 241
504 3300025258 Ga0209129_1007477 Ga0209129_10074773 241
505 3300025258 Ga0209129_1015364 Ga0209129_10153642 241
506 3300025261 Ga0209233_1000056 Ga0209233_1000056250 241
507 3300025261 Ga0209233_1000152 Ga0209233_100015291 241
508 3300025273 Ga0209673_1000054 Ga0209673_1000054135 241
509 3300025273 Ga0209673_1000169 Ga0209673_1000169103 241
510 3300025273 Ga0209673_1002697 Ga0209673_10026974 241
511 3300025273 Ga0209673_1002736 Ga0209673_10027364 241
512 3300025273 Ga0209673_1005377 Ga0209673_10053773 241
513 3300025273 Ga0209673_1016193 Ga0209673_10161931 241
514 3300025273 Ga0209673_1019083 Ga0209673_10190832 241
515 3300025284 Ga0209130_1000015 Ga0209130_1000015162 241
516 3300025284 Ga0209130_1000038 Ga0209130_1000038199 241
517 3300025284 Ga0209130_1034862 Ga0209130_10348622 241
518 3300025294 Ga0209025_1000280 Ga0209025_100028084 241
519 3300025294 Ga0209025_1000412 Ga0209025_100041258 241
520 3300025294 Ga0209025_1002425 Ga0209025_100242515 241
521 3300025294 Ga0209025_1005584 Ga0209025_10055844 241
522 3300025294 Ga0209025_1006112 Ga0209025_100611210 241
523 3300025294 Ga0209025_1008268 Ga0209025_10082685 241
524 3300025294 Ga0209025_1021711 Ga0209025_10217114 241
525 3300025295 Ga0209564_1000286 Ga0209564_100028644 241
526 3300025295 Ga0209564_1000944 Ga0209564_100094427 241
527 3300025295 Ga0209564_1001832 Ga0209564_10018325 241
528 3300025295 Ga0209564_1012179 Ga0209564_10121794 241
529 3300025295 Ga0209564_1042433 Ga0209564_10424332 241
530 3300025297 Ga0209758_1000148 Ga0209758_1000148129 241
531 3300025297 Ga0209758_1000235 Ga0209758_100023584 241
532 3300025297 Ga0209758_1000467 Ga0209758_100046735 241
533 3300025297 Ga0209758_1000486 Ga0209758_100048633 241
534 3300025297 Ga0209758_1000879 Ga0209758_100087938 241
535 3300025297 Ga0209758_1003193 Ga0209758_100319313 241
536 3300025297 Ga0209758_1034294 Ga0209758_10342942 241
537 3300025299 Ga0209256_1002631 Ga0209256_100263111 241
538 3300025299 Ga0209256_1003042 Ga0209256_10030427 241
539 3300025299 Ga0209256_1003230 Ga0209256_100323016 241
540 3300025299 Ga0209256_1008269 Ga0209256_10082695 241
541 3300025299 Ga0209256_1009637 Ga0209256_10096373 241
542 3300025299 Ga0209256_1039502 Ga0209256_10395022 241
543 3300025302 Ga0207426_1000081 Ga0207426_1000081239 241
544 3300025302 Ga0207426_1000122 Ga0207426_100012270 241
545 3300025302 Ga0207426_1000146 Ga0207426_100014689 241
546 3300025302 Ga0207426_1002423 Ga0207426_10024234 241
547 3300025303 Ga0209051_1002236 Ga0209051_10022369 241
548 3300025303 Ga0209051_1004573 Ga0209051_100457310 241
549 3300025303 Ga0209051_1023174 Ga0209051_10231743 241
550 3300025303 Ga0209051_1041432 Ga0209051_10414323 241
551 3300025303 Ga0209051_1061112 Ga0209051_10611122 241
552 3300025304 Ga0209257_1015490 Ga0209257_10154903 241
553 3300025304 Ga0209257_1050101 Ga0209257_10501012 241
554 3300027111 Ga0209281_1000078 Ga0209281_1000078139 241
555 3300027312 Ga0209371_1003389 Ga0209371_10033898 241
556 3300027866 Ga0209813_10069693 Ga0209813_100696931 241
557 3300028379 Ga0268266_10134751 Ga0268266_101347513 241
558 3300028379 Ga0268266_10221302 Ga0268266_102213021 241
559 3300028379 Ga0268266_10355547 Ga0268266_103555472 241
560 3300028794 Ga0307515_10015158 Ga0307515_1001515812 241
561 3300031901 Ga0307406_10042318 Ga0307406_100423184 241
562 3300031911 Ga0307412_10001652 Ga0307412_100016523 241
563 3300041413 Ga0439465_0051505 Ga0439465_0051505_494_1237 241
564 3300041456 Ga0451795_1255473 Ga0451795_1255473_1443_2171 241
565 3300041491 Ga0451833_0019537 Ga0451833_0019537_2246_2974 241
566 3300041496 Ga0451839_1229881 Ga0451839_1229881_85_813 241
567 3300041498 Ga0451841_1065715 Ga0451841_1065715_1098_1826 241
568 3300041505 Ga0451849_1298498 Ga0451849_1298498_1526_2254 241
569 3300041507 Ga0451851_0897106 Ga0451851_0897106_1886_2614 241
570 3300041512 Ga0451853_0071671 Ga0451853_0071671_537_1265 241
571 3300041907 Ga0452268_45485 Ga0452268_45485_52_780 241
572 3300044694 Ga0466963_0016724 Ga0466963_0016724_94_819 241
573 3300044706 Ga0466964_0049239 Ga0466964_0049239_304_1029 241
574 3300044765 Ga0466970_0002608 Ga0466970_0002608_1784_2509 241
575 3300045836 Ga0466958_0120326 Ga0466958_0120326_833_1558 241
576 3300046457 Ga0495590_0087619 Ga0495590_0087619_209_952 241
577 3300046460 Ga0495638_0000258 Ga0495638_0000258_30596_31423 241
578 3300046460 Ga0495638_0107432 Ga0495638_0107432_623_1351 241
579 3300046474 Ga0495605_0006150 Ga0495605_0006150_2346_3173 241
580 3300046491 Ga0495584_0114469 Ga0495584_0114469_70_897 241
581 3300046492 Ga0495585_0003640 Ga0495585_0003640_7301_8128 241
582 3300046500 Ga0495596_0054131 Ga0495596_0054131_498_1226 241
583 3300046501 Ga0495607_0052687 Ga0495607_0052687_1205_1933 241
584 3300046506 Ga0495583_0003393 Ga0495583_0003393_9730_10458 241
585 3300046512 Ga0495610_0034335 Ga0495610_0034335_1356_2084 241
586 3300046515 Ga0495620_0050057 Ga0495620_0050057_992_1720 241
587 3300046518 Ga0495631_0001280 Ga0495631_0001280_2874_3701 241
588 3300046518 Ga0495631_0039054 Ga0495631_0039054_529_1257 241
589 3300046519 Ga0495632_0011131 Ga0495632_0011131_3292_4020 241
590 3300046519 Ga0495632_0051992 Ga0495632_0051992_818_1546 241
591 3300046522 Ga0495643_0124609 Ga0495643_0124609_391_1119 241
592 3300046538 Ga0495609_0012348 Ga0495609_0012348_1097_1924 241
593 3300046542 Ga0495597_0036396 Ga0495597_0036396_741_1469 241
594 3300046558 Ga0495633_0007292 Ga0495633_0007292_1718_2446 241
595 3300046616 Ga0495668_0019572 Ga0495668_0019572_2073_2801 241
596 3300046648 Ga0495611_0009173 Ga0495611_0009173_2893_3720 241
597 3300046660 Ga0495625_0001676 Ga0495625_0001676_5609_6436 241
598 3300046660 Ga0495625_0059998 Ga0495625_0059998_86_814 241
599 3300046660 Ga0495625_0173028 Ga0495625_0173028_510_1277 241
600 3300046665 Ga0495661_0183342 Ga0495661_0183342_212_940 241
601 3300046694 Ga0495649_0161350 Ga0495649_0161350_341_1069 241
602 3300046810 Ga0495660_0005582 Ga0495660_0005582_6335_7063 241
603 3300046810 Ga0495660_0022306 Ga0495660_0022306_875_1702 241
604 3300047318 Ga0495636_0024472 Ga0495636_0024472_1354_2181 241
605 3300047320 Ga0495672_0009333 Ga0495672_0009333_4213_5040 241
606 3300047443 Ga0495687_021815 Ga0495687_021815_1080_1808 241
607 3300047472 Ga0495686_0002598 Ga0495686_0002598_12965_13693 241
608 3300047472 Ga0495686_0072983 Ga0495686_0072983_80_808 241
609 3300047472 Ga0495686_0097555 Ga0495686_0097555_742_1470 241
610 3300048091 Ga0495626_0053050 Ga0495626_0053050_116_844 241
611 3300048909 Ga0496106_0000170 Ga0496106_0000170_29601_30344 241
612 3300048919 Ga0496116_0000957 Ga0496116_0000957_30283_31011 241
613 3300048919 Ga0496116_0054003 Ga0496116_0054003_200_943 241
614 3300048920 Ga0496117_0005186 Ga0496117_0005186_11184_11912 241
615 3300048920 Ga0496117_0059422 Ga0496117_0059422_183_908 241
616 3300048921 Ga0496118_0001474 Ga0496118_0001474_4814_5542 241
617 3300048921 Ga0496118_0055204 Ga0496118_0055204_894_1622 241
618 3300048921 Ga0496118_0089176 Ga0496118_0089176_600_1343 241
619 3300048921 Ga0496118_0153795 Ga0496118_0153795_683_1408 241
620 3300048922 Ga0496119_0015532 Ga0496119_0015532_3272_3997 241
621 3300048923 Ga0496120_0173582 Ga0496120_0173582_283_1008 241
622 3300048924 Ga0496121_0000889 Ga0496121_0000889_49594_50361 241
623 3300048924 Ga0496121_0009836 Ga0496121_0009836_527_1291 241
624 3300048924 Ga0496121_0021705 Ga0496121_0021705_1200_1928 241
625 3300048924 Ga0496121_0031740 Ga0496121_0031740_842_1585 241
626 3300048924 Ga0496121_0036885 Ga0496121_0036885_1451_2176 241
627 3300048925 Ga0496122_0010817 Ga0496122_0010817_7531_8259 241
628 3300048925 Ga0496122_0019943 Ga0496122_0019943_4374_5099 241
629 3300048925 Ga0496122_0052189 Ga0496122_0052189_1216_1944 241
630 3300048926 Ga0496123_0011184 Ga0496123_0011184_4705_5433 241
631 3300048926 Ga0496123_0059814 Ga0496123_0059814_1481_2224 241
632 3300048926 Ga0496123_0081441 Ga0496123_0081441_1087_1812 241
633 3300048927 Ga0496124_0001104 Ga0496124_0001104_3168_3896 241
634 3300048927 Ga0496124_0035693 Ga0496124_0035693_710_1453 241
635 3300048927 Ga0496124_0080965 Ga0496124_0080965_1737_2501 241
636 3300048927 Ga0496124_0244124 Ga0496124_0244124_556_1281 241
637 3300048928 Ga0496125_0008314 Ga0496125_0008314_1503_2246 241
638 3300048928 Ga0496125_0017088 Ga0496125_0017088_3064_3792 241
639 3300049459 Ga0495678_003727 Ga0495678_003727_3207_4034 241
640 3300049460 Ga0495682_0026181 Ga0495682_0026181_57_785 241
641 3300049569 Ga0501032_0041521 Ga0501032_0041521_1953_2696 241
642 3300049571 Ga0501034_0262191 Ga0501034_0262191_723_1466 241
643 3300049574 Ga0501038_0098492 Ga0501038_0098492_91_822 241
644 3300049579 Ga0501043_0028289 Ga0501043_0028289_2666_3409 241
645 3300049581 Ga0501047_0068688 Ga0501047_0068688_74_817 241
646 3300049583 Ga0501067_0098390 Ga0501067_0098390_760_1503 241
647 3300050492 nmdc:mga0yw44_25297_c1 nmdc:mga0yw44_25297_c1_13_741 241
648 3300050493 nmdc:mga0k408_14920_c1 nmdc:mga0k408_14920_c1_1223_1951 241
649 3300050495 nmdc:mga04h51_91804_c1 nmdc:mga04h51_91804_c1_63_791 241
650 3300050516 nmdc:mga0sz30_14596_c1 nmdc:mga0sz30_14596_c1_1540_2268 241
651 3300053079 Ga0500610_0026045 Ga0500610_0026045_351_1178 241
652 3300053093 Ga0500651_0156026 Ga0500651_0156026_10_753 241
653 3300053105 Ga0500557_000725 Ga0500557_000725_1972_2799 241
654 3300053109 Ga0500569_007842 Ga0500569_007842_444_1271 241
655 3300053109 Ga0500569_118545 Ga0500569_118545_85_813 241
656 3300053122 Ga0500608_020412 Ga0500608_020412_952_1680 241
657 3300053125 Ga0500618_008736 Ga0500618_008736_475_1203 241
658 3300053134 Ga0500658_0000556 Ga0500658_0000556_7663_8391 241
659 3300053134 Ga0500658_0007876 Ga0500658_0007876_226_969 241
660 3300053135 Ga0500659_0055927 Ga0500659_0055927_810_1538 241
661 3300053139 Ga0500568_0000408 Ga0500568_0000408_3158_3985 241
662 3300053139 Ga0500568_0001998 Ga0500568_0001998_5687_6430 241
663 3300053151 Ga0500604_0005833 Ga0500604_0005833_1813_2556 241
664 3300053153 Ga0500616_0001011 Ga0500616_0001011_6800_7627 241
665 3300053153 Ga0500616_0181691 Ga0500616_0181691_39_767 241
666 3300053156 Ga0500622_0001317 Ga0500622_0001317_17967_18710 241
667 3300059505 Ga0587083_0060720 Ga0587083_0060720_20_763 241
668 3300061719 Ga0466962_0032268 Ga0466962_0032268_878_1603 241
669 iso_pu_bacteria 2510917030 2511196568 241
670 iso_pu_bacteria 2582581298 2585225558 241
671 iso_pu_bacteria 2585427529 2585548167 241
672 iso_pu_bacteria 2643221653 2644297144 241
673 iso_pu_bacteria 2643221719 2644655397 241
674 iso_pu_bacteria 2791355259 2793318390 241
675 iso_pu_bacteria 2818991461 2819684354 241
676 iso_pu_bacteria 2821123053 2821123968 241
677 iso_pu_bacteria 2838736955 2838739002 241
678 iso_pu_bacteria 2841840854 2841842900 241
679 iso_pu_bacteria 2842140634 2842142681 241
680 iso_pu_bacteria 2854896431 2854898601 241
681 iso_pu_bacteria 2854916844 2854921798 241
682 iso_pu_bacteria 2857531043 2857531530 241
683 iso_pu_bacteria 2919100787 2919100955 241
684 iso_pu_bacteria 3005445848 3005446472 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

33

264

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.8016 41 194
2a4v-assembly1.cif.gz_A crystal structure of a truncated mutant of yeast nuclear thiol peroxidase 0.7741 38 202
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.7623 38 198
3k3p-assembly1.cif.gz_A crystal structure of the apo form of d-alanine:d-alanine ligase (ddl) from streptococcus mutans 0.7581 169 194
3gl3-assembly1.cif.gz_A crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum 0.7481 38 194
ID Description Score Start End Superfamily
af_P21264_187_380_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.854 172 194 3.30.470.20
af_A0A0R0J7I7_6_131_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8392 173 195 2.60.40.150
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8016 41 194 3.40.30.10
af_I1LDI2_1041_1096_3.30.160.70 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain 0.7837 175 196 3.30.160.70
af_X1WDE8_1_116_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7782 173 194 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2S6R5Q2-F1-model_v4 Thioredoxin domain-containing protein 0.9893 1 182
AF-A0A7W6R958-F1-model_v4 Putative dithiol-disulfide oxidoreductase (DUF899 family) 0.9875 1 171
AF-A0A535QUL9-F1-model_v4 DUF899 domain-containing protein 0.9813 1 196
AF-A0A7Y3K0R7-F1-model_v4 DUF899 domain-containing protein 0.9812 1 163
AF-A0A443G402-F1-model_v4 deleted 0.9797 1 164

Feature Viewer

pLDDT pTM Quality
93.64 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map