F475068

General Info

Members Datasets Scaffolds Average Seq Length
684 349 684 115

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_3038749|Ga0451853_3038749_28_450
Length 140
Sequence VAGSSTSSSATEGHAAGIPAAQEERTVTDDEVVPETRGVTAQELATVDLGPEIEGMEGRRLRMRMFTFEPGAVFGPVHDHVGRPGTVYVLQGTITDHRDGVATDYGPGVGWPEDRDTNHWLENRGRVPAVEISVDIVNPA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
144 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
145 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
180 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
181 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
182 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
183 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
184 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
330 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.78
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_7184 2124908027 Bacteria 2394
2 MRS2a_Contig_735 2124908027 Bacteria 3129
3 SwRhRL2b_contig_974593 2162886007 Bacteria 14964
4 Ga0006562J51391_1018001 3300003578 Bacteria 830
5 Ga0058860_12119322 3300004801 Bacteria 503
6 Ga0065714_10319798 3300005288 Bacteria 670
7 Ga0065715_10144632 3300005293 Bacteria 1804
8 Ga0070658_10131006 3300005327 Bacteria 2090
9 Ga0070676_10134016 3300005328 Bacteria 1570
10 Ga0070683_100018314 3300005329 Bacteria 6200
11 Ga0070683_100070062 3300005329 Bacteria 3271
12 Ga0070683_101148749 3300005329 Bacteria 746
13 Ga0070680_101659160 3300005336 Bacteria 554
14 Ga0070682_100047913 3300005337 Unclassified 2659
15 Ga0070689_100302389 3300005340 Bacteria 1332
16 Ga0070661_100054711 3300005344 Bacteria 2923
17 Ga0070661_100565448 3300005344 Bacteria 916
18 Ga0070668_100128389 3300005347 Bacteria 2032
19 Ga0070671_100308466 3300005355 Bacteria 1348
20 Ga0070674_100005238 3300005356 Bacteria 7462
21 Ga0070674_100512866 3300005356 Bacteria 1000
22 Ga0070667_100422406 3300005367 Bacteria 1215
23 Ga0070714_100238001 3300005435 Bacteria 1679
24 Ga0070714_100736248 3300005435 Bacteria 953
25 Ga0070714_100810961 3300005435 Bacteria 907
26 Ga0070701_10720222 3300005438 Bacteria 673
27 Ga0070705_100150622 3300005440 Bacteria 1543
28 Ga0070705_100812651 3300005440 Bacteria 745
29 Ga0070694_100441168 3300005444 Bacteria 1026
30 Ga0070678_100123621 3300005456 Bacteria 2044
31 Ga0070681_10021936 3300005458 Bacteria 6406
32 Ga0068867_100727925 3300005459 Bacteria 878
33 Ga0070685_10818577 3300005466 Bacteria 688
34 Ga0070684_100009533 3300005535 Bacteria 7651
35 Ga0070684_101489452 3300005535 Bacteria 638
36 Ga0070697_100251111 3300005536 Bacteria 1512
37 Ga0070672_100129839 3300005543 Bacteria 2070
38 Ga0070695_100348229 3300005545 Bacteria 1109
39 Ga0070696_100040092 3300005546 Bacteria 3233
40 Ga0070696_100588205 3300005546 Bacteria 896
41 Ga0070696_101485845 3300005546 Bacteria 580
42 Ga0070696_101528144 3300005546 Bacteria 572
43 Ga0070665_100001218 3300005548 Bacteria 31350
44 Ga0070665_100043339 3300005548 Bacteria 4522
45 Ga0070704_100387488 3300005549 Bacteria 1189
46 Ga0070704_100641789 3300005549 Bacteria 937
47 Ga0070664_100000674 3300005564 Bacteria 26089
48 Ga0070664_101391985 3300005564 Bacteria 663
49 Ga0068854_100194277 3300005578 Bacteria 1592
50 Ga0070702_101492291 3300005615 Bacteria 556
51 Ga0068852_101349404 3300005616 Bacteria 735
52 Ga0068859_101344144 3300005617 Bacteria 788
53 Ga0068861_101186331 3300005719 Bacteria 737
54 Ga0068863_100047720 3300005841 Bacteria 4062
55 Ga0068863_101673403 3300005841 Bacteria 646
56 Ga0068860_100494291 3300005843 Bacteria 1221
57 Ga0068862_100776677 3300005844 Bacteria 934
58 Ga0068862_101036645 3300005844 Bacteria 813
59 Ga0075432_10000086 3300006058 Bacteria 19052
60 Ga0075428_101926837 3300006844 Bacteria 614
61 Ga0075433_11677197 3300006852 Bacteria 547
62 Ga0075434_100019668 3300006871 Bacteria 6535
63 Ga0075436_100102834 3300006914 Bacteria 1990
64 Ga0097620_101344140 3300006931 Bacteria 788
65 Ga0105244_10442256 3300009036 Bacteria 598
66 Ga0105250_10302955 3300009092 Bacteria 691
67 Ga0105240_10015390 3300009093 Bacteria 10398
68 Ga0105240_10428764 3300009093 Unclassified 1484
69 Ga0105245_10040933 3300009098 Bacteria 4129
70 Ga0105245_10272063 3300009098 Bacteria 1652
71 Ga0114129_10033074 3300009147 Bacteria 7308
72 Ga0114129_12774695 3300009147 Bacteria 583
73 Ga0105243_11779898 3300009148 Bacteria 647
74 Ga0105242_10536006 3300009176 Bacteria 1120
75 Ga0105242_10581894 3300009176 Bacteria 1078
76 Ga0105237_10334012 3300009545 Bacteria 1520
77 Ga0105237_11448005 3300009545 Bacteria 693
78 Ga0105249_10062257 3300009553 Bacteria 3426
79 Ga0105239_10391863 3300010375 Bacteria 1571
80 Ga0105239_13124259 3300010375 Bacteria 539
81 Ga0105246_10372626 3300011119 Bacteria 1177
82 Ga0105246_10418803 3300011119 Unclassified 1117
83 Ga0105246_10741793 3300011119 Bacteria 865
84 Ga0105246_12208178 3300011119 Bacteria 536
85 Ga0157328_1008953 3300012478 Bacteria 665
86 Ga0157373_10337198 3300013100 Bacteria 1074
87 Ga0157369_10317302 3300013105 Bacteria 1620
88 Ga0157369_10394703 3300013105 Bacteria 1435
89 Ga0157374_10126997 3300013296 Bacteria 2465
90 Ga0157378_10380623 3300013297 Bacteria 1386
91 Ga0157378_10544232 3300013297 Bacteria 1165
92 Ga0163162_12095936 3300013306 Bacteria 649
93 Ga0163162_12659815 3300013306 Bacteria 576
94 Ga0157372_10014769 3300013307 Bacteria 8358
95 Ga0157372_10854950 3300013307 Bacteria 1056
96 Ga0157372_12349680 3300013307 Bacteria 612
97 Ga0157372_12511967 3300013307 Bacteria 591
98 Ga0157375_10058265 3300013308 Bacteria 3821
99 Ga0157375_10175081 3300013308 Bacteria 2295
100 Ga0157375_11906387 3300013308 Bacteria 705
101 Ga0163163_11340648 3300014325 Bacteria 777
102 Ga0182008_10006943 3300014497 Bacteria 6284
103 Ga0182007_10009622 3300015262 Bacteria 3881
104 Ga0182005_1001133 3300015265 Bacteria 11128
105 Ga0163161_10536614 3300017792 Bacteria 957
106 Ga0207697_10048149 3300025315 Bacteria 1758
107 Ga0207655_1001872 3300025728 Bacteria 18118
108 Ga0207655_1012569 3300025728 Bacteria 4937
109 Ga0207713_1005277 3300025735 Bacteria 8127
110 Ga0207713_1005486 3300025735 Bacteria 7919
111 Ga0207653_10031202 3300025885 Bacteria 1721
112 Ga0207688_10018309 3300025901 Bacteria 3811
113 Ga0207705_10209112 3300025909 Bacteria 1480
114 Ga0207707_10222566 3300025912 Unclassified 1643
115 Ga0207707_11663451 3300025912 Bacteria 501
116 Ga0207695_10017147 3300025913 Bacteria 8442
117 Ga0207695_10149559 3300025913 Bacteria 2275
118 Ga0207695_10505700 3300025913 Bacteria 1090
119 Ga0207649_10045760 3300025920 Bacteria 2684
120 Ga0207694_10497398 3300025924 Bacteria 1021
121 Ga0207687_10013465 3300025927 Bacteria 5340
122 Ga0207687_10030892 3300025927 Bacteria 3616
123 Ga0207687_11687537 3300025927 Bacteria 543
124 Ga0207664_10072849 3300025929 Bacteria 2771
125 Ga0207690_10592233 3300025932 Bacteria 904
126 Ga0207686_10570194 3300025934 Bacteria 887
127 Ga0207686_11849667 3300025934 Bacteria 500
128 Ga0207669_10174441 3300025937 Bacteria 1534
129 Ga0207669_10221677 3300025937 Bacteria 1388
130 Ga0207669_10727246 3300025937 Bacteria 818
131 Ga0207704_10279428 3300025938 Bacteria 1268
132 Ga0207704_11900249 3300025938 Bacteria 512
133 Ga0207691_10133892 3300025940 Bacteria 2188
134 Ga0207661_10027333 3300025944 Bacteria 4357
135 Ga0207661_10828800 3300025944 Bacteria 852
136 Ga0207679_10001427 3300025945 Bacteria 15032
137 Ga0207679_10058784 3300025945 Bacteria 2851
138 Ga0207712_10514311 3300025961 Bacteria 1025
139 Ga0207668_10097263 3300025972 Bacteria 2178
140 Ga0207640_10086703 3300025981 Bacteria 2156
141 Ga0207703_10014401 3300026035 Bacteria 6166
142 Ga0207639_10000118 3300026041 Bacteria 60793
143 Ga0207708_10273312 3300026075 Bacteria 1367
144 Ga0207708_11372693 3300026075 Bacteria 620
145 Ga0207641_10124578 3300026088 Bacteria 2305
146 Ga0207648_10530546 3300026089 Bacteria 1079
147 Ga0207648_11422241 3300026089 Bacteria 652
148 Ga0207676_10808687 3300026095 Bacteria 915
149 Ga0207674_10027486 3300026116 Bacteria 6017
150 Ga0207675_100019647 3300026118 Bacteria 6305
151 Ga0207683_10000961 3300026121 Bacteria 26403
152 Ga0207683_12114510 3300026121 Bacteria 511
153 Ga0209969_1005739 3300027360 Bacteria 1747
154 Ga0209982_1004337 3300027552 Bacteria 2032
155 Ga0210002_1028865 3300027617 Bacteria 917
156 Ga0209983_1003298 3300027665 Bacteria 3465
157 Ga0209971_1011721 3300027682 Bacteria 2077
158 Ga0209966_1011716 3300027695 Bacteria 1601
159 Ga0209998_10014095 3300027717 Bacteria 1668
160 Ga0209974_10016737 3300027876 Bacteria 2433
161 Ga0207428_10161782 3300027907 Bacteria 1699
162 Ga0207428_10397783 3300027907 Bacteria 1009
163 Ga0268266_10000211 3300028379 Bacteria 101045
164 Ga0268266_10083004 3300028379 Bacteria 2796
165 Ga0268265_10204108 3300028380 Bacteria 1717
166 Ga0268265_11038605 3300028380 Bacteria 811
167 Ga0268265_11173996 3300028380 Bacteria 764
168 Ga0265337_1005753 3300028556 Bacteria 4871
169 Ga0265326_10006088 3300028558 Bacteria 3770
170 Ga0265319_1069098 3300028563 Bacteria 1134
171 Ga0265323_10108718 3300028653 Bacteria 911
172 Ga0265322_10115346 3300028654 Bacteria 765
173 Ga0265336_10008131 3300028666 Bacteria 3695
174 Ga0265338_10009948 3300028800 Bacteria 11244
175 Ga0265338_10766096 3300028800 Bacteria 663
176 Ga0265332_10197602 3300031238 Bacteria 836
177 Ga0265329_10014704 3300031242 Bacteria 2756
178 Ga0265331_10086542 3300031250 Bacteria 1452
179 Ga0265327_10043787 3300031251 Bacteria 2392
180 Ga0265316_10020698 3300031344 Bacteria 5593
181 Ga0265316_10189656 3300031344 Bacteria 1528
182 Ga0265316_10203575 3300031344 Bacteria 1466
183 Ga0307408_100010466 3300031548 Bacteria 6115
184 Ga0307408_100044564 3300031548 Bacteria 3162
185 Ga0265313_10122177 3300031595 Bacteria 1135
186 Ga0316575_10030305 3300031665 Bacteria 2114
187 Ga0265314_10006988 3300031711 Bacteria 9872
188 Ga0265314_10318496 3300031711 Bacteria 866
189 Ga0265342_10018637 3300031712 Bacteria 4488
190 Ga0265342_10536310 3300031712 Bacteria 594
191 Ga0316576_10035561 3300031727 Bacteria 3556
192 Ga0316576_10191294 3300031727 Bacteria 1542
193 Ga0316578_10013590 3300031728 Bacteria 4322
194 Ga0307405_10000703 3300031731 Bacteria 12993
195 Ga0307413_10567245 3300031824 Bacteria 924
196 Ga0307413_10983392 3300031824 Bacteria 722
197 Ga0307410_10302614 3300031852 Bacteria 1262
198 Ga0307410_10657087 3300031852 Bacteria 880
199 Ga0307406_10002856 3300031901 Bacteria 9406
200 Ga0307406_10066387 3300031901 Bacteria 2348
201 Ga0307406_10456548 3300031901 Bacteria 1026
202 Ga0307407_10174984 3300031903 Bacteria 1417
203 Ga0307412_10081175 3300031911 Bacteria 2242
204 Ga0307412_11390352 3300031911 Bacteria 635
205 Ga0307409_100025273 3300031995 Bacteria 4161
206 Ga0307416_100010142 3300032002 Bacteria 6209
207 Ga0307416_100265316 3300032002 Bacteria 1681
208 Ga0307416_100312084 3300032002 Bacteria 1570
209 Ga0307411_11288890 3300032005 Bacteria 665
210 Ga0307415_100055278 3300032126 Bacteria 2715
211 Ga0307415_100089070 3300032126 Bacteria 2228
212 Ga0307415_101788686 3300032126 Bacteria 594
213 Ga0316585_10029518 3300032137 Bacteria 1717
214 Ga0316580_10007098 3300032139 Bacteria 3325
215 Ga0316588_1072889 3300033528 Bacteria 845
216 Ga0373941_0146082 3300035115 Bacteria 864
217 Ga0373945_0338093 3300035116 Bacteria 651
218 Ga0373957_0340200 3300035120 Bacteria 640
219 Ga0373960_0107129 3300035121 Bacteria 913
220 Ga0373943_0434469 3300035170 Bacteria 761
221 Ga0373943_0649289 3300035170 Bacteria 623
222 Ga0373946_0155439 3300035171 Bacteria 1070
223 Ga0373955_0334543 3300035172 Bacteria 916
224 Ga0316574_0128792 3300035398 Bacteria 1628
225 Ga0316574_0297689 3300035398 Bacteria 1026
226 Ga0316574_0405226 3300035398 Bacteria 858
227 Ga0316574_0540186 3300035398 Bacteria 724
228 Ga0373931_0148259 3300035691 Bacteria 1365
229 Ga0373933_0105349 3300035724 Bacteria 1754
230 Ga0373933_0157090 3300035724 Bacteria 1443
231 Ga0373947_0059869 3300035725 Bacteria 2310
232 Ga0373947_0979420 3300035725 Bacteria 577
233 Ga0373937_0667196 3300036401 Bacteria 986
234 Ga0373937_1428642 3300036401 Bacteria 639
235 Ga0316582_0132368 3300036647 Bacteria 1676
236 Ga0316582_0201834 3300036647 Bacteria 1357
237 Ga0316582_0251201 3300036647 Bacteria 1212
238 Ga0316582_0265351 3300036647 Bacteria 1177
239 Ga0316582_0279606 3300036647 Bacteria 1145
240 Ga0316584_0007219 3300036712 Bacteria 7581
241 Ga0316584_0064691 3300036712 Bacteria 2738
242 Ga0316584_0068312 3300036712 Bacteria 2663
243 Ga0316584_0138656 3300036712 Bacteria 1815
244 Ga0316584_0391085 3300036712 Bacteria 992
245 Ga0373925_0427070 3300037068 Bacteria 1083
246 Ga0395899_0026680 3300037312 Bacteria 4358
247 Ga0395899_0315319 3300037312 Bacteria 1055
248 Ga0395898_0051869 3300037466 Bacteria 4009
249 Ga0395898_0687101 3300037466 Bacteria 965
250 Ga0395905_0236363 3300037471 Bacteria 1708
251 Ga0316581_0149995 3300037588 Bacteria 719
252 Ga0395901_0047032 3300038443 Bacteria 4482
253 Ga0395901_0387095 3300038443 Bacteria 1438
254 Ga0395901_2043160 3300038443 Bacteria 519
255 Ga0439438_001013 3300041405 Bacteria 12531
256 Ga0439447_000666 3300041407 Bacteria 12740
257 Ga0439466_0002641 3300041411 Bacteria 7009
258 Ga0439466_0106712 3300041411 Bacteria 870
259 Ga0439465_0005161 3300041413 Bacteria 4191
260 Ga0451800_1247482 3300041459 Bacteria 743
261 Ga0451802_0496456 3300041460 Bacteria 606
262 Ga0451849_0145583 3300041505 Bacteria 1099
263 Ga0451851_0964593 3300041507 Bacteria 583
264 Ga0451853_3038749 3300041512 Bacteria 522
265 Ga0451853_3458816 3300041512 Bacteria 2308
266 Ga0439448_0027212 3300042005 Bacteria 1801
267 Ga0439432_010667 3300042006 Bacteria 3178
268 Ga0439451_002482 3300042009 Bacteria 3740
269 Ga0439451_002901 3300042009 Bacteria 3482
270 Ga0439452_021999 3300042010 Bacteria 1654
271 Ga0439454_089355 3300042011 Bacteria 568
272 Ga0439456_000443 3300042013 Bacteria 9164
273 Ga0439456_086210 3300042013 Bacteria 703
274 Ga0439463_008507 3300042016 Bacteria 2529
275 Ga0450911_000802 3300042115 Bacteria 8637
276 Ga0450890_000175 3300042127 Bacteria 9686
277 Ga0450903_000125 3300042138 Bacteria 16677
278 Ga0450906_000150 3300042145 Bacteria 12876
279 Ga0450907_000264 3300042146 Bacteria 17813
280 Ga0450910_043876 3300042147 Bacteria 727
281 Ga0439446_0000262 3300042156 Bacteria 9800
282 Ga0450908_000323 3300042184 Bacteria 9397
283 Ga0450909_000146 3300042185 Bacteria 7468
284 Ga0439434_0004261 3300042435 Bacteria 4181
285 Ga0439464_0001496 3300042439 Bacteria 5522
286 Ga0439460_0015634 3300042461 Bacteria 2011
287 Ga0439460_0068874 3300042461 Bacteria 1092
288 Ga0451577_0000491 3300042876 Bacteria 67041
289 Ga0451577_0007478 3300042876 Bacteria 10728
290 Ga0451577_0011620 3300042876 Bacteria 8314
291 Ga0451577_0037350 3300042876 Bacteria 4372
292 Ga0451577_0064223 3300042876 Bacteria 3274
293 Ga0451577_0140824 3300042876 Bacteria 2167
294 Ga0451577_0188018 3300042876 Bacteria 1863
295 Ga0451577_0306388 3300042876 Bacteria 1439
296 Ga0451577_0491503 3300042876 Bacteria 1114
297 Ga0451577_0656716 3300042876 Bacteria 951
298 Ga0439440_0000067 3300042993 Bacteria 13146
299 Ga0453683_0073361 3300044673 Bacteria 2142
300 Ga0453683_0232474 3300044673 Bacteria 1173
301 Ga0453684_0000176 3300044712 Bacteria 283097
302 Ga0453684_0001325 3300044712 Bacteria 73132
303 Ga0453684_0001444 3300044712 Bacteria 67679
304 Ga0453684_0002706 3300044712 Bacteria 42066
305 Ga0453684_0004431 3300044712 Bacteria 29651
306 Ga0453684_0022734 3300044712 Bacteria 9286
307 Ga0453684_0057653 3300044712 Bacteria 5024
308 Ga0453684_0077750 3300044712 Bacteria 4156
309 Ga0453684_0136906 3300044712 Bacteria 2930
310 Ga0453684_0166280 3300044712 Bacteria 2603
311 Ga0453684_0541964 3300044712 Bacteria 1283
312 Ga0453684_0724825 3300044712 Bacteria 1078
313 Ga0453684_1047084 3300044712 Unclassified 865
314 Ga0451576_0009820 3300045051 Bacteria 11061
315 Ga0451576_0084645 3300045051 Bacteria 3299
316 Ga0451576_0109245 3300045051 Bacteria 2878
317 Ga0451576_0125358 3300045051 Bacteria 2676
318 Ga0451576_0296552 3300045051 Bacteria 1690
319 Ga0451576_1113040 3300045051 Bacteria 826
320 Ga0495617_000613 3300046452 Bacteria 17917
321 Ga0495617_002742 3300046452 Bacteria 6811
322 Ga0495617_003910 3300046452 Bacteria 5490
323 Ga0495617_052845 3300046452 Bacteria 1349
324 Ga0495627_042401 3300046453 Bacteria 1395
325 Ga0495592_0060527 3300046454 Bacteria 2785
326 Ga0495603_0000256 3300046455 Bacteria 27948
327 Ga0495603_0193271 3300046455 Bacteria 1176
328 Ga0495590_0000339 3300046457 Bacteria 24297
329 Ga0495590_0007354 3300046457 Bacteria 4252
330 Ga0495590_0013132 3300046457 Bacteria 3052
331 Ga0495591_000266 3300046458 Bacteria 49608
332 Ga0495591_097381 3300046458 Bacteria 732
333 Ga0495629_0016696 3300046459 Bacteria 5268
334 Ga0495638_0025626 3300046460 Bacteria 3830
335 Ga0495638_0052167 3300046460 Bacteria 2548
336 Ga0495651_0157474 3300046462 Bacteria 1631
337 Ga0495653_0493811 3300046463 Bacteria 764
338 Ga0495653_0511841 3300046463 Bacteria 747
339 Ga0495650_0000531 3300046471 Bacteria 55413
340 Ga0495650_0003945 3300046471 Bacteria 10454
341 Ga0495650_0028492 3300046471 Bacteria 2562
342 Ga0495582_0007727 3300046473 Bacteria 5944
343 Ga0495605_0000526 3300046474 Bacteria 32322
344 Ga0495605_0001754 3300046474 Bacteria 13901
345 Ga0495605_0007320 3300046474 Bacteria 6269
346 Ga0495605_0031768 3300046474 Bacteria 2694
347 Ga0495605_0050064 3300046474 Bacteria 2039
348 Ga0495605_0128959 3300046474 Bacteria 1141
349 Ga0495639_0008154 3300046475 Bacteria 4498
350 Ga0495662_0045390 3300046476 Bacteria 2121
351 Ga0495584_0001430 3300046491 Bacteria 14368
352 Ga0495584_0002117 3300046491 Bacteria 11362
353 Ga0495584_0014843 3300046491 Bacteria 3970
354 Ga0495584_0040286 3300046491 Bacteria 2358
355 Ga0495584_0311391 3300046491 Bacteria 799
356 Ga0495584_0343133 3300046491 Bacteria 758
357 Ga0495585_0003604 3300046492 Bacteria 10382
358 Ga0495585_0091794 3300046492 Bacteria 1634
359 Ga0495585_0187634 3300046492 Bacteria 1059
360 Ga0495594_0002357 3300046499 Bacteria 9835
361 Ga0495594_0002788 3300046499 Bacteria 9066
362 Ga0495607_0000637 3300046501 Bacteria 34042
363 Ga0495607_0054893 3300046501 Bacteria 2294
364 Ga0495607_0060485 3300046501 Bacteria 2155
365 Ga0495607_0101490 3300046501 Bacteria 1540
366 Ga0495583_0000921 3300046506 Bacteria 34568
367 Ga0495583_0017824 3300046506 Bacteria 3757
368 Ga0495583_0031567 3300046506 Bacteria 2567
369 Ga0495583_0031659 3300046506 Bacteria 2561
370 Ga0495583_0102598 3300046506 Bacteria 1219
371 Ga0495606_0021952 3300046507 Bacteria 4667
372 Ga0495606_0031391 3300046507 Bacteria 3694
373 Ga0495606_0042204 3300046507 Bacteria 3052
374 Ga0495608_0073084 3300046511 Bacteria 2236
375 Ga0495608_0360385 3300046511 Bacteria 894
376 Ga0495610_0067998 3300046512 Bacteria 1671
377 Ga0495616_0000245 3300046513 Bacteria 44179
378 Ga0495616_0001526 3300046513 Bacteria 15942
379 Ga0495616_0026197 3300046513 Bacteria 3106
380 Ga0495616_0131878 3300046513 Bacteria 1144
381 Ga0495616_0422167 3300046513 Bacteria 544
382 Ga0495618_0775290 3300046514 Bacteria 560
383 Ga0495620_0002926 3300046515 Bacteria 9814
384 Ga0495620_0026987 3300046515 Bacteria 2693
385 Ga0495630_0003131 3300046517 Bacteria 11476
386 Ga0495630_0144308 3300046517 Bacteria 1810
387 Ga0495631_0000005 3300046518 Bacteria 159179
388 Ga0495631_0006594 3300046518 Bacteria 5974
389 Ga0495631_0020944 3300046518 Bacteria 3048
390 Ga0495631_0168696 3300046518 Bacteria 939
391 Ga0495632_0000166 3300046519 Bacteria 68543
392 Ga0495632_0002218 3300046519 Bacteria 14977
393 Ga0495632_0002362 3300046519 Bacteria 14436
394 Ga0495637_0000440 3300046520 Bacteria 30318
395 Ga0495637_0000804 3300046520 Bacteria 20840
396 Ga0495637_0001706 3300046520 Bacteria 12687
397 Ga0495637_0004378 3300046520 Bacteria 7325
398 Ga0495637_0011362 3300046520 Bacteria 4281
399 Ga0495643_0353435 3300046522 Bacteria 657
400 Ga0495643_0465043 3300046522 Bacteria 548
401 Ga0495644_0029822 3300046523 Bacteria 2060
402 Ga0495648_0031213 3300046524 Bacteria 3511
403 Ga0495648_0045833 3300046524 Bacteria 2716
404 Ga0495648_0046838 3300046524 Bacteria 2677
405 Ga0495648_0148046 3300046524 Bacteria 1227
406 Ga0495648_0331568 3300046524 Bacteria 701
407 Ga0495666_0013364 3300046526 Bacteria 4093
408 Ga0495666_0063468 3300046526 Bacteria 1763
409 Ga0495642_0000016 3300046528 Bacteria 114282
410 Ga0495642_0001529 3300046528 Bacteria 10268
411 Ga0495652_0188854 3300046529 Bacteria 1574
412 Ga0495654_0012576 3300046530 Bacteria 4542
413 Ga0495654_0016537 3300046530 Bacteria 3897
414 Ga0495654_0017220 3300046530 Bacteria 3803
415 Ga0495654_0017344 3300046530 Bacteria 3787
416 Ga0495654_0072543 3300046530 Bacteria 1629
417 Ga0495654_0174176 3300046530 Bacteria 936
418 Ga0495640_0080680 3300046533 Bacteria 2163
419 Ga0495640_0352524 3300046533 Bacteria 908
420 Ga0495586_0004702 3300046535 Bacteria 7299
421 Ga0495586_0040651 3300046535 Bacteria 2503
422 Ga0495587_0000877 3300046536 Bacteria 19880
423 Ga0495609_0000186 3300046538 Bacteria 62251
424 Ga0495609_0001638 3300046538 Bacteria 14592
425 Ga0495597_0011750 3300046542 Bacteria 4239
426 Ga0495597_0016091 3300046542 Bacteria 3536
427 Ga0495597_0066164 3300046542 Bacteria 1566
428 Ga0495597_0134012 3300046542 Bacteria 1025
429 Ga0495622_0060030 3300046557 Bacteria 1760
430 Ga0495622_0060449 3300046557 Bacteria 1754
431 Ga0495622_0067344 3300046557 Bacteria 1654
432 Ga0495633_0001867 3300046558 Bacteria 15451
433 Ga0495633_0011205 3300046558 Bacteria 4850
434 Ga0495633_0218800 3300046558 Bacteria 872
435 Ga0495667_0045894 3300046559 Bacteria 2890
436 Ga0495667_0068510 3300046559 Bacteria 2317
437 Ga0495667_0862348 3300046559 Bacteria 556
438 Ga0495656_0000395 3300046615 Bacteria 14474
439 Ga0495656_0024969 3300046615 Bacteria 2365
440 Ga0495668_0112920 3300046616 Bacteria 1486
441 Ga0495668_0702680 3300046616 Bacteria 559
442 Ga0495634_0065328 3300046642 Bacteria 2412
443 Ga0495634_0289089 3300046642 Bacteria 994
444 Ga0495611_0412822 3300046648 Bacteria 616
445 Ga0495625_0005814 3300046660 Bacteria 11130
446 Ga0495625_0007010 3300046660 Bacteria 9923
447 Ga0495625_0011080 3300046660 Bacteria 7385
448 Ga0495625_0103755 3300046660 Bacteria 1949
449 Ga0495625_0201910 3300046660 Bacteria 1311
450 Ga0495625_0338195 3300046660 Bacteria 954
451 Ga0495635_0000594 3300046663 Bacteria 23281
452 Ga0495659_0000335 3300046664 Bacteria 18557
453 Ga0495659_0002744 3300046664 Bacteria 5662
454 Ga0495659_0121412 3300046664 Bacteria 1029
455 Ga0495661_0001171 3300046665 Bacteria 22887
456 Ga0495661_0075198 3300046665 Bacteria 1963
457 Ga0495661_0165283 3300046665 Bacteria 1184
458 Ga0495588_0019674 3300046674 Bacteria 3309
459 Ga0495599_0064397 3300046678 Bacteria 2290
460 Ga0495623_0089739 3300046679 Bacteria 1889
461 Ga0495646_0006790 3300046680 Bacteria 7260
462 Ga0495669_0001951 3300046684 Bacteria 8476
463 Ga0495669_0247177 3300046684 Bacteria 856
464 Ga0495669_0400030 3300046684 Bacteria 665
465 Ga0495613_0053677 3300046689 Bacteria 2964
466 Ga0495670_0000215 3300046691 Bacteria 26202
467 Ga0495670_0055484 3300046691 Bacteria 1986
468 Ga0495670_0108359 3300046691 Bacteria 1436
469 Ga0495670_0621826 3300046691 Bacteria 588
470 Ga0495670_0833621 3300046691 Bacteria 503
471 Ga0495671_0091763 3300046692 Bacteria 1486
472 Ga0495671_0203276 3300046692 Bacteria 960
473 Ga0495671_0477053 3300046692 Bacteria 595
474 Ga0495649_0000086 3300046694 Bacteria 80528
475 Ga0495649_0001882 3300046694 Bacteria 15353
476 Ga0495649_0016341 3300046694 Bacteria 4206
477 Ga0495649_0056999 3300046694 Bacteria 2107
478 Ga0495649_0109500 3300046694 Bacteria 1465
479 Ga0495649_0144826 3300046694 Bacteria 1249
480 Ga0495589_0000636 3300046794 Bacteria 23067
481 Ga0495589_0000799 3300046794 Bacteria 19935
482 Ga0495589_0008326 3300046794 Bacteria 5417
483 Ga0495589_0065008 3300046794 Bacteria 1788
484 Ga0495600_0002600 3300046809 Bacteria 10405
485 Ga0495600_0235469 3300046809 Bacteria 1168
486 Ga0495660_0055284 3300046810 Bacteria 2149
487 Ga0495660_0120606 3300046810 Bacteria 1327
488 Ga0495581_0010345 3300047315 Bacteria 5398
489 Ga0495581_0021045 3300047315 Bacteria 3783
490 Ga0495604_0001248 3300047317 Bacteria 20850
491 Ga0495604_0186990 3300047317 Bacteria 1446
492 Ga0495636_0001197 3300047318 Bacteria 9805
493 Ga0495636_0043209 3300047318 Bacteria 1874
494 Ga0495674_0545469 3300047319 Bacteria 923
495 Ga0495674_0620722 3300047319 Bacteria 855
496 Ga0495672_0001126 3300047320 Bacteria 27097
497 Ga0495672_0007895 3300047320 Bacteria 7937
498 Ga0495672_0010752 3300047320 Bacteria 6495
499 Ga0495672_0040511 3300047320 Bacteria 2824
500 Ga0495672_0357778 3300047320 Bacteria 676
501 Ga0495672_0392912 3300047320 Bacteria 636
502 Ga0495676_0065572 3300047321 Bacteria 2818
503 Ga0495676_0070380 3300047321 Bacteria 2695
504 Ga0495680_0000029 3300047322 Bacteria 112033
505 Ga0495680_0065586 3300047322 Bacteria 2780
506 Ga0495680_0358077 3300047322 Bacteria 1015
507 Ga0495683_0000010 3300047323 Bacteria 223494
508 Ga0495683_0003697 3300047323 Bacteria 8858
509 Ga0495683_0047247 3300047323 Bacteria 2160
510 Ga0495683_0059918 3300047323 Bacteria 1887
511 Ga0495687_001073 3300047443 Bacteria 26922
512 Ga0495687_008040 3300047443 Bacteria 6095
513 Ga0495677_0000135 3300047445 Bacteria 35127
514 Ga0495685_066449 3300047447 Bacteria 1211
515 Ga0495685_091689 3300047447 Bacteria 1007
516 Ga0495673_0000636 3300047469 Bacteria 34509
517 Ga0495673_0001177 3300047469 Bacteria 22089
518 Ga0495673_0011065 3300047469 Bacteria 4876
519 Ga0495673_0039221 3300047469 Bacteria 2149
520 Ga0495673_0113182 3300047469 Bacteria 1082
521 Ga0495681_0001131 3300047470 Bacteria 20285
522 Ga0495681_0024464 3300047470 Bacteria 3181
523 Ga0495681_0035207 3300047470 Bacteria 2488
524 Ga0495684_0030723 3300047471 Bacteria 4124
525 Ga0495684_0435012 3300047471 Bacteria 915
526 Ga0495686_0126370 3300047472 Bacteria 1520
527 Ga0495686_0127953 3300047472 Bacteria 1508
528 Ga0495593_0025192 3300047673 Bacteria 3292
529 Ga0495593_0090783 3300047673 Bacteria 1573
530 Ga0495602_0164527 3300048088 Bacteria 1728
531 Ga0495602_0892779 3300048088 Bacteria 592
532 Ga0495626_0000490 3300048091 Bacteria 39851
533 Ga0495626_0000538 3300048091 Bacteria 37687
534 Ga0495626_0001424 3300048091 Bacteria 19061
535 Ga0495626_0003448 3300048091 Bacteria 10135
536 Ga0495626_0262682 3300048091 Bacteria 689
537 Ga0496101_0094024 3300048904 Bacteria 2234
538 Ga0496102_1218807 3300048905 Bacteria 672
539 Ga0496103_0086413 3300048906 Bacteria 1977
540 Ga0496104_0624649 3300048907 Bacteria 987
541 Ga0496104_1528359 3300048907 Bacteria 570
542 Ga0496106_1029961 3300048909 Unclassified 647
543 Ga0496108_0032403 3300048911 Bacteria 4341
544 Ga0496109_0260113 3300048912 Bacteria 1635
545 Ga0496109_0954387 3300048912 Bacteria 795
546 Ga0496110_0047289 3300048913 Bacteria 3767
547 Ga0496110_0824045 3300048913 Bacteria 833
548 Ga0496111_0688967 3300048914 Bacteria 744
549 Ga0496111_1105862 3300048914 Bacteria 565
550 Ga0496112_0025482 3300048915 Bacteria 5679
551 Ga0496112_0234120 3300048915 Unclassified 1791
552 Ga0496114_0001978 3300048917 Bacteria 15574
553 Ga0496115_0147652 3300048918 Bacteria 1941
554 Ga0496116_0039501 3300048919 Bacteria 3262
555 Ga0496117_0001581 3300048920 Bacteria 32312
556 Ga0496117_0296429 3300048920 Bacteria 858
557 Ga0496118_0178580 3300048921 Bacteria 1286
558 Ga0496121_0059938 3300048924 Bacteria 3135
559 Ga0496121_0704775 3300048924 Bacteria 607
560 Ga0496122_0005168 3300048925 Bacteria 15704
561 Ga0496123_0026923 3300048926 Bacteria 4295
562 Ga0496124_0190285 3300048927 Bacteria 1571
563 Ga0496125_0007781 3300048928 Bacteria 11337
564 Ga0496125_0053077 3300048928 Bacteria 3327
565 Ga0496125_0217674 3300048928 Bacteria 1233
566 Ga0496126_0091173 3300048929 Bacteria 2680
567 Ga0495678_000437 3300049459 Bacteria 41568
568 Ga0495678_001452 3300049459 Bacteria 18640
569 Ga0495678_005908 3300049459 Bacteria 6624
570 Ga0495678_017731 3300049459 Bacteria 3217
571 Ga0495678_055284 3300049459 Bacteria 1515
572 Ga0495678_087205 3300049459 Bacteria 1107
573 Ga0495678_173180 3300049459 Bacteria 681
574 Ga0495682_0000307 3300049460 Bacteria 36956
575 Ga0495682_0003264 3300049460 Bacteria 7256
576 Ga0495682_0060363 3300049460 Bacteria 1369
577 Ga0495682_0062615 3300049460 Bacteria 1342
578 Ga0495682_0088657 3300049460 Bacteria 1111
579 Ga0495682_0203071 3300049460 Bacteria 702
580 Ga0495682_0295538 3300049460 Bacteria 571
581 Ga0501031_0048591 3300049568 Bacteria 2764
582 Ga0501031_0346655 3300049568 Bacteria 961
583 Ga0501032_0144665 3300049569 Bacteria 1565
584 Ga0501033_0085887 3300049570 Bacteria 2304
585 Ga0501034_0487932 3300049571 Bacteria 1147
586 Ga0501036_0027179 3300049572 Bacteria 4834
587 Ga0501036_0326028 3300049572 Bacteria 1283
588 Ga0501036_1139927 3300049572 Bacteria 636
589 Ga0501038_0005503 3300049574 Bacteria 11759
590 Ga0501038_1243853 3300049574 Bacteria 539
591 Ga0501039_0011483 3300049575 Bacteria 6741
592 Ga0501039_0110947 3300049575 Bacteria 2144
593 Ga0501039_0317994 3300049575 Bacteria 1224
594 Ga0501040_0019453 3300049576 Bacteria 4516
595 Ga0501040_0022127 3300049576 Bacteria 4253
596 Ga0501040_0310076 3300049576 Bacteria 1128
597 Ga0501041_0006386 3300049577 Bacteria 6898
598 Ga0501041_0038855 3300049577 Bacteria 2887
599 Ga0501041_0405259 3300049577 Bacteria 864
600 Ga0501041_0675931 3300049577 Bacteria 660
601 Ga0501042_0014313 3300049578 Bacteria 5414
602 Ga0501042_0089203 3300049578 Bacteria 2212
603 Ga0501042_0143663 3300049578 Bacteria 1721
604 Ga0501042_0163274 3300049578 Bacteria 1607
605 Ga0501043_0077243 3300049579 Bacteria 2616
606 Ga0501046_0009891 3300049580 Bacteria 8216
607 Ga0501048_0034389 3300049582 Bacteria 3656
608 Ga0501048_0179871 3300049582 Bacteria 1499
609 Ga0501048_0997506 3300049582 Bacteria 602
610 Ga0501067_0148152 3300049583 Bacteria 1308
611 Ga0501068_0014758 3300049584 Bacteria 4470
612 Ga0501068_0445548 3300049584 Bacteria 837
613 Ga0501069_0003746 3300049585 Bacteria 7815
614 Ga0501069_0186041 3300049585 Bacteria 1201
615 Ga0501070_0017298 3300049586 Bacteria 6054
616 Ga0501071_0006205 3300049587 Bacteria 7751
617 Ga0501071_0103177 3300049587 Bacteria 2103
618 Ga0501071_0166963 3300049587 Bacteria 1647
619 Ga0501071_1261268 3300049587 Bacteria 571
620 Ga0501072_0023058 3300049588 Bacteria 4833
621 Ga0501072_0062578 3300049588 Bacteria 2935
622 Ga0501072_0189268 3300049588 Bacteria 1641
623 Ga0501073_0053832 3300049589 Bacteria 2817
624 Ga0501074_0025433 3300049590 Bacteria 4300
625 Ga0501074_0183324 3300049590 Bacteria 1493
626 Ga0501074_0197339 3300049590 Bacteria 1434
627 Ga0501075_0021672 3300049591 Bacteria 4686
628 Ga0501075_0067834 3300049591 Bacteria 2693
629 Ga0501075_0277467 3300049591 Bacteria 1277
630 Ga0501075_0319583 3300049591 Bacteria 1183
631 Ga0501075_0669252 3300049591 Bacteria 791
632 Ga0501076_0006382 3300049592 Bacteria 8553
633 Ga0501076_0011226 3300049592 Bacteria 6669
634 Ga0501076_0033778 3300049592 Bacteria 3994
635 Ga0501076_1581429 3300049592 Bacteria 538
636 Ga0501077_0010374 3300049593 Bacteria 5797
637 Ga0501077_0035094 3300049593 Bacteria 3193
638 Ga0501209_184714 3300049656 Bacteria 637
639 Ga0501243_017374 3300049675 Bacteria 1167
640 Ga0501079_0006833 3300049741 Bacteria 8589
641 Ga0501079_0013918 3300049741 Bacteria 6136
642 Ga0501079_0042123 3300049741 Bacteria 3527
643 Ga0501079_0078197 3300049741 Bacteria 2559
644 Ga0501080_0094801 3300049742 Bacteria 2772
645 Ga0501080_0285972 3300049742 Bacteria 1498
646 Ga0501080_0668574 3300049742 Bacteria 918
647 Ga0501080_1461672 3300049742 Bacteria 582
648 Ga0501081_0072094 3300049743 Bacteria 2408
649 Ga0501081_0540740 3300049743 Bacteria 870
650 Ga0501083_0018187 3300049744 Bacteria 4898
651 Ga0501083_0283768 3300049744 Bacteria 1077
652 Ga0501083_0469649 3300049744 Bacteria 819
653 Ga0501035_0028926 3300049822 Bacteria 5056
654 Ga0501044_0150579 3300049823 Bacteria 2309
655 Ga0501045_0020247 3300049824 Bacteria 4750
656 Ga0501045_0029882 3300049824 Bacteria 3940
657 Ga0501045_0163670 3300049824 Bacteria 1656
658 Ga0501045_0299004 3300049824 Bacteria 1198
659 Ga0501045_0319609 3300049824 Bacteria 1155
660 nmdc:mga05p37_1828234_c1 3300050507 Bacteria 584
661 nmdc:mga05p37_28870_c1 3300050507 Bacteria 6766
662 nmdc:mga08y16_2087303_c1 3300050511 Bacteria 515
663 nmdc:mga0n895_12219_c1 3300050512 Bacteria 7694
664 nmdc:mga08x19_105717_c1 3300050514 Bacteria 1872
665 Ga0495601_0187956 3300053077 Bacteria 1350
666 Ga0495601_0614307 3300053077 Bacteria 697
667 Ga0495612_0117115 3300053078 Bacteria 1144
668 Ga0495595_0113479 3300053084 Bacteria 1316
669 Ga0495595_0176113 3300053084 Bacteria 1060
670 Ga0495619_0014093 3300053085 Bacteria 5046
671 Ga0495619_0391137 3300053085 Bacteria 960
672 Ga0495619_0635373 3300053085 Bacteria 729
673 Ga0495619_0723090 3300053085 Bacteria 676
674 Ga0500643_000341 3300053087 Bacteria 37015
675 Ga0501084_0011960 3300054114 Bacteria 7186
676 Ga0501084_0020787 3300054114 Bacteria 5475
677 Ga0501084_0025627 3300054114 Bacteria 4918
678 Ga0501082_0007671 3300060353 Bacteria 9314
679 Ga0501082_0337351 3300060353 Bacteria 1313
680 Ga0501082_0447091 3300060353 Bacteria 1129
681 Ga0530510_0014617 3300061734 Bacteria 5540
682 Ga0530510_0181195 3300061734 Bacteria 1562
683 Ga0530510_0531451 3300061734 Bacteria 892
684 Ga0530510_1288209 3300061734 Bacteria 560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053087 Ga0500643_000341 Ga0500643_000341_12308_12652 112
2 3300005435 Ga0070714_100810961 Ga0070714_1008109612 113
3 3300005546 Ga0070696_100588205 Ga0070696_1005882051 113
4 3300009545 Ga0105237_10334012 Ga0105237_103340121 113
5 3300010375 Ga0105239_10391863 Ga0105239_103918634 113
6 3300013306 Ga0163162_12659815 Ga0163162_126598152 113
7 3300025937 Ga0207669_10727246 Ga0207669_107272461 113
8 3300026089 Ga0207648_11422241 Ga0207648_114222411 113
9 3300028556 Ga0265337_1005753 Ga0265337_10057535 113
10 3300042876 Ga0451577_0007478 Ga0451577_0007478_2285_2626 113
11 3300044712 Ga0453684_0000176 Ga0453684_0000176_231324_231665 113
12 3300045051 Ga0451576_0125358 Ga0451576_0125358_1915_2256 113
13 3300046642 Ga0495634_0065328 Ga0495634_0065328_882_1223 113
14 3300047321 Ga0495676_0070380 Ga0495676_0070380_313_654 113
15 3300049742 Ga0501080_1461672 Ga0501080_1461672_116_457 113
16 3300053084 Ga0495595_0113479 Ga0495595_0113479_795_1136 113
17 2124908027 MRS2a_Contig_7184 MRS2a_00084540 114
18 2124908027 MRS2a_Contig_735 MRS2a_00592480 114
19 2162886007 SwRhRL2b_contig_974593 SwRhRL2b_0638.00004530 114
20 3300003578 Ga0006562J51391_1018001 Ga0006562J51391_10180011 114
21 3300004801 Ga0058860_12119322 Ga0058860_121193221 114
22 3300005288 Ga0065714_10319798 Ga0065714_103197981 114
23 3300005293 Ga0065715_10144632 Ga0065715_101446322 114
24 3300005327 Ga0070658_10131006 Ga0070658_101310064 114
25 3300005328 Ga0070676_10134016 Ga0070676_101340162 114
26 3300005329 Ga0070683_100018314 Ga0070683_1000183144 114
27 3300005329 Ga0070683_100070062 Ga0070683_1000700623 114
28 3300005329 Ga0070683_101148749 Ga0070683_1011487492 114
29 3300005336 Ga0070680_101659160 Ga0070680_1016591602 114
30 3300005337 Ga0070682_100047913 Ga0070682_1000479133 114
31 3300005340 Ga0070689_100302389 Ga0070689_1003023893 114
32 3300005344 Ga0070661_100054711 Ga0070661_1000547113 114
33 3300005344 Ga0070661_100565448 Ga0070661_1005654482 114
34 3300005347 Ga0070668_100128389 Ga0070668_1001283892 114
35 3300005355 Ga0070671_100308466 Ga0070671_1003084662 114
36 3300005356 Ga0070674_100005238 Ga0070674_1000052383 114
37 3300005356 Ga0070674_100512866 Ga0070674_1005128662 114
38 3300005367 Ga0070667_100422406 Ga0070667_1004224062 114
39 3300005435 Ga0070714_100238001 Ga0070714_1002380012 114
40 3300005435 Ga0070714_100736248 Ga0070714_1007362481 114
41 3300005438 Ga0070701_10720222 Ga0070701_107202221 114
42 3300005440 Ga0070705_100150622 Ga0070705_1001506222 114
43 3300005440 Ga0070705_100812651 Ga0070705_1008126512 114
44 3300005444 Ga0070694_100441168 Ga0070694_1004411681 114
45 3300005456 Ga0070678_100123621 Ga0070678_1001236212 114
46 3300005458 Ga0070681_10021936 Ga0070681_100219362 114
47 3300005459 Ga0068867_100727925 Ga0068867_1007279252 114
48 3300005466 Ga0070685_10818577 Ga0070685_108185772 114
49 3300005535 Ga0070684_100009533 Ga0070684_1000095333 114
50 3300005535 Ga0070684_101489452 Ga0070684_1014894521 114
51 3300005536 Ga0070697_100251111 Ga0070697_1002511112 114
52 3300005543 Ga0070672_100129839 Ga0070672_1001298393 114
53 3300005545 Ga0070695_100348229 Ga0070695_1003482291 114
54 3300005546 Ga0070696_100040092 Ga0070696_1000400922 114
55 3300005546 Ga0070696_101485845 Ga0070696_1014858451 114
56 3300005546 Ga0070696_101528144 Ga0070696_1015281441 114
57 3300005548 Ga0070665_100001218 Ga0070665_10000121815 114
58 3300005548 Ga0070665_100043339 Ga0070665_1000433392 114
59 3300005549 Ga0070704_100387488 Ga0070704_1003874882 114
60 3300005549 Ga0070704_100641789 Ga0070704_1006417891 114
61 3300005564 Ga0070664_100000674 Ga0070664_10000067412 114
62 3300005564 Ga0070664_101391985 Ga0070664_1013919852 114
63 3300005578 Ga0068854_100194277 Ga0068854_1001942773 114
64 3300005615 Ga0070702_101492291 Ga0070702_1014922911 114
65 3300005616 Ga0068852_101349404 Ga0068852_1013494042 114
66 3300005617 Ga0068859_101344144 Ga0068859_1013441442 114
67 3300005719 Ga0068861_101186331 Ga0068861_1011863312 114
68 3300005841 Ga0068863_100047720 Ga0068863_1000477205 114
69 3300005841 Ga0068863_101673403 Ga0068863_1016734032 114
70 3300005843 Ga0068860_100494291 Ga0068860_1004942912 114
71 3300005844 Ga0068862_100776677 Ga0068862_1007766772 114
72 3300005844 Ga0068862_101036645 Ga0068862_1010366452 114
73 3300006058 Ga0075432_10000086 Ga0075432_100000864 114
74 3300006844 Ga0075428_101926837 Ga0075428_1019268372 114
75 3300006852 Ga0075433_11677197 Ga0075433_116771971 114
76 3300006871 Ga0075434_100019668 Ga0075434_1000196683 114
77 3300006914 Ga0075436_100102834 Ga0075436_1001028342 114
78 3300006931 Ga0097620_101344140 Ga0097620_1013441402 114
79 3300009036 Ga0105244_10442256 Ga0105244_104422561 114
80 3300009092 Ga0105250_10302955 Ga0105250_103029552 114
81 3300009093 Ga0105240_10015390 Ga0105240_100153907 114
82 3300009093 Ga0105240_10428764 Ga0105240_104287644 114
83 3300009098 Ga0105245_10040933 Ga0105245_100409335 114
84 3300009098 Ga0105245_10272063 Ga0105245_102720634 114
85 3300009147 Ga0114129_10033074 Ga0114129_100330742 114
86 3300009147 Ga0114129_12774695 Ga0114129_127746952 114
87 3300009148 Ga0105243_11779898 Ga0105243_117798981 114
88 3300009176 Ga0105242_10536006 Ga0105242_105360062 114
89 3300009176 Ga0105242_10581894 Ga0105242_105818941 114
90 3300009545 Ga0105237_11448005 Ga0105237_114480052 114
91 3300009553 Ga0105249_10062257 Ga0105249_100622574 114
92 3300010375 Ga0105239_13124259 Ga0105239_131242591 114
93 3300011119 Ga0105246_10372626 Ga0105246_103726262 114
94 3300011119 Ga0105246_10418803 Ga0105246_104188033 114
95 3300011119 Ga0105246_10741793 Ga0105246_107417932 114
96 3300011119 Ga0105246_12208178 Ga0105246_122081782 114
97 3300012478 Ga0157328_1008953 Ga0157328_10089532 114
98 3300013100 Ga0157373_10337198 Ga0157373_103371982 114
99 3300013105 Ga0157369_10317302 Ga0157369_103173022 114
100 3300013105 Ga0157369_10394703 Ga0157369_103947032 114
101 3300013296 Ga0157374_10126997 Ga0157374_101269973 114
102 3300013297 Ga0157378_10380623 Ga0157378_103806233 114
103 3300013297 Ga0157378_10544232 Ga0157378_105442322 114
104 3300013306 Ga0163162_12095936 Ga0163162_120959362 114
105 3300013307 Ga0157372_10014769 Ga0157372_1001476910 114
106 3300013307 Ga0157372_10854950 Ga0157372_108549501 114
107 3300013307 Ga0157372_12349680 Ga0157372_123496802 114
108 3300013307 Ga0157372_12511967 Ga0157372_125119671 114
109 3300013308 Ga0157375_10058265 Ga0157375_100582653 114
110 3300013308 Ga0157375_10175081 Ga0157375_101750812 114
111 3300013308 Ga0157375_11906387 Ga0157375_119063871 114
112 3300014325 Ga0163163_11340648 Ga0163163_113406482 114
113 3300014497 Ga0182008_10006943 Ga0182008_100069435 114
114 3300015262 Ga0182007_10009622 Ga0182007_100096224 114
115 3300015265 Ga0182005_1001133 Ga0182005_10011334 114
116 3300017792 Ga0163161_10536614 Ga0163161_105366142 114
117 3300025315 Ga0207697_10048149 Ga0207697_100481493 114
118 3300025728 Ga0207655_1001872 Ga0207655_100187214 114
119 3300025728 Ga0207655_1012569 Ga0207655_10125697 114
120 3300025735 Ga0207713_1005277 Ga0207713_10052772 114
121 3300025735 Ga0207713_1005486 Ga0207713_10054862 114
122 3300025885 Ga0207653_10031202 Ga0207653_100312022 114
123 3300025901 Ga0207688_10018309 Ga0207688_100183093 114
124 3300025909 Ga0207705_10209112 Ga0207705_102091122 114
125 3300025912 Ga0207707_10222566 Ga0207707_102225661 114
126 3300025912 Ga0207707_11663451 Ga0207707_116634511 114
127 3300025913 Ga0207695_10017147 Ga0207695_100171473 114
128 3300025913 Ga0207695_10149559 Ga0207695_101495591 114
129 3300025913 Ga0207695_10505700 Ga0207695_105057003 114
130 3300025920 Ga0207649_10045760 Ga0207649_100457601 114
131 3300025924 Ga0207694_10497398 Ga0207694_104973982 114
132 3300025927 Ga0207687_10013465 Ga0207687_100134651 114
133 3300025927 Ga0207687_10030892 Ga0207687_100308921 114
134 3300025927 Ga0207687_11687537 Ga0207687_116875371 114
135 3300025929 Ga0207664_10072849 Ga0207664_100728493 114
136 3300025932 Ga0207690_10592233 Ga0207690_105922332 114
137 3300025934 Ga0207686_10570194 Ga0207686_105701942 114
138 3300025934 Ga0207686_11849667 Ga0207686_118496671 114
139 3300025937 Ga0207669_10174441 Ga0207669_101744412 114
140 3300025937 Ga0207669_10221677 Ga0207669_102216772 114
141 3300025938 Ga0207704_10279428 Ga0207704_102794281 114
142 3300025938 Ga0207704_11900249 Ga0207704_119002491 114
143 3300025940 Ga0207691_10133892 Ga0207691_101338923 114
144 3300025944 Ga0207661_10027333 Ga0207661_100273333 114
145 3300025944 Ga0207661_10828800 Ga0207661_108288002 114
146 3300025945 Ga0207679_10001427 Ga0207679_100014278 114
147 3300025945 Ga0207679_10058784 Ga0207679_100587843 114
148 3300025961 Ga0207712_10514311 Ga0207712_105143112 114
149 3300025972 Ga0207668_10097263 Ga0207668_100972632 114
150 3300025981 Ga0207640_10086703 Ga0207640_100867033 114
151 3300026035 Ga0207703_10014401 Ga0207703_100144012 114
152 3300026041 Ga0207639_10000118 Ga0207639_100001187 114
153 3300026075 Ga0207708_10273312 Ga0207708_102733121 114
154 3300026075 Ga0207708_11372693 Ga0207708_113726931 114
155 3300026088 Ga0207641_10124578 Ga0207641_101245783 114
156 3300026089 Ga0207648_10530546 Ga0207648_105305462 114
157 3300026095 Ga0207676_10808687 Ga0207676_108086871 114
158 3300026116 Ga0207674_10027486 Ga0207674_100274866 114
159 3300026118 Ga0207675_100019647 Ga0207675_1000196475 114
160 3300026121 Ga0207683_10000961 Ga0207683_1000096110 114
161 3300026121 Ga0207683_12114510 Ga0207683_121145101 114
162 3300027360 Ga0209969_1005739 Ga0209969_10057393 114
163 3300027552 Ga0209982_1004337 Ga0209982_10043371 114
164 3300027617 Ga0210002_1028865 Ga0210002_10288651 114
165 3300027665 Ga0209983_1003298 Ga0209983_10032986 114
166 3300027682 Ga0209971_1011721 Ga0209971_10117213 114
167 3300027695 Ga0209966_1011716 Ga0209966_10117162 114
168 3300027717 Ga0209998_10014095 Ga0209998_100140953 114
169 3300027876 Ga0209974_10016737 Ga0209974_100167372 114
170 3300027907 Ga0207428_10161782 Ga0207428_101617822 114
171 3300027907 Ga0207428_10397783 Ga0207428_103977831 114
172 3300028379 Ga0268266_10000211 Ga0268266_1000021161 114
173 3300028379 Ga0268266_10083004 Ga0268266_100830043 114
174 3300028380 Ga0268265_10204108 Ga0268265_102041082 114
175 3300028380 Ga0268265_11038605 Ga0268265_110386052 114
176 3300028380 Ga0268265_11173996 Ga0268265_111739962 114
177 3300028558 Ga0265326_10006088 Ga0265326_100060882 114
178 3300028563 Ga0265319_1069098 Ga0265319_10690982 114
179 3300028653 Ga0265323_10108718 Ga0265323_101087182 114
180 3300028654 Ga0265322_10115346 Ga0265322_101153462 114
181 3300028666 Ga0265336_10008131 Ga0265336_100081313 114
182 3300028800 Ga0265338_10009948 Ga0265338_100099485 114
183 3300028800 Ga0265338_10766096 Ga0265338_107660962 114
184 3300031238 Ga0265332_10197602 Ga0265332_101976022 114
185 3300031242 Ga0265329_10014704 Ga0265329_100147043 114
186 3300031250 Ga0265331_10086542 Ga0265331_100865422 114
187 3300031251 Ga0265327_10043787 Ga0265327_100437872 114
188 3300031344 Ga0265316_10020698 Ga0265316_100206985 114
189 3300031344 Ga0265316_10189656 Ga0265316_101896562 114
190 3300031344 Ga0265316_10203575 Ga0265316_102035752 114
191 3300031548 Ga0307408_100010466 Ga0307408_1000104663 114
192 3300031548 Ga0307408_100044564 Ga0307408_1000445644 114
193 3300031595 Ga0265313_10122177 Ga0265313_101221771 114
194 3300031665 Ga0316575_10030305 Ga0316575_100303052 114
195 3300031711 Ga0265314_10006988 Ga0265314_100069887 114
196 3300031711 Ga0265314_10318496 Ga0265314_103184961 114
197 3300031712 Ga0265342_10018637 Ga0265342_100186373 114
198 3300031712 Ga0265342_10536310 Ga0265342_105363101 114
199 3300031727 Ga0316576_10035561 Ga0316576_100355614 114
200 3300031727 Ga0316576_10191294 Ga0316576_101912942 114
201 3300031728 Ga0316578_10013590 Ga0316578_100135902 114
202 3300031731 Ga0307405_10000703 Ga0307405_1000070312 114
203 3300031824 Ga0307413_10567245 Ga0307413_105672452 114
204 3300031824 Ga0307413_10983392 Ga0307413_109833922 114
205 3300031852 Ga0307410_10302614 Ga0307410_103026142 114
206 3300031852 Ga0307410_10657087 Ga0307410_106570871 114
207 3300031901 Ga0307406_10002856 Ga0307406_1000285610 114
208 3300031901 Ga0307406_10066387 Ga0307406_100663874 114
209 3300031901 Ga0307406_10456548 Ga0307406_104565482 114
210 3300031903 Ga0307407_10174984 Ga0307407_101749842 114
211 3300031911 Ga0307412_10081175 Ga0307412_100811753 114
212 3300031911 Ga0307412_11390352 Ga0307412_113903521 114
213 3300031995 Ga0307409_100025273 Ga0307409_1000252732 114
214 3300032002 Ga0307416_100010142 Ga0307416_1000101424 114
215 3300032002 Ga0307416_100265316 Ga0307416_1002653163 114
216 3300032002 Ga0307416_100312084 Ga0307416_1003120843 114
217 3300032005 Ga0307411_11288890 Ga0307411_112888902 114
218 3300032126 Ga0307415_100055278 Ga0307415_1000552781 114
219 3300032126 Ga0307415_100089070 Ga0307415_1000890702 114
220 3300032126 Ga0307415_101788686 Ga0307415_1017886861 114
221 3300032137 Ga0316585_10029518 Ga0316585_100295182 114
222 3300032139 Ga0316580_10007098 Ga0316580_100070982 114
223 3300033528 Ga0316588_1072889 Ga0316588_10728892 114
224 3300035115 Ga0373941_0146082 Ga0373941_0146082_107_457 114
225 3300035116 Ga0373945_0338093 Ga0373945_0338093_78_422 114
226 3300035120 Ga0373957_0340200 Ga0373957_0340200_266_610 114
227 3300035121 Ga0373960_0107129 Ga0373960_0107129_57_401 114
228 3300035170 Ga0373943_0434469 Ga0373943_0434469_55_399 114
229 3300035170 Ga0373943_0649289 Ga0373943_0649289_20_364 114
230 3300035171 Ga0373946_0155439 Ga0373946_0155439_397_741 114
231 3300035172 Ga0373955_0334543 Ga0373955_0334543_17_361 114
232 3300035398 Ga0316574_0128792 Ga0316574_0128792_228_572 114
233 3300035398 Ga0316574_0297689 Ga0316574_0297689_468_812 114
234 3300035398 Ga0316574_0405226 Ga0316574_0405226_383_733 114
235 3300035398 Ga0316574_0540186 Ga0316574_0540186_34_378 114
236 3300035691 Ga0373931_0148259 Ga0373931_0148259_50_394 114
237 3300035724 Ga0373933_0105349 Ga0373933_0105349_159_539 114
238 3300035724 Ga0373933_0157090 Ga0373933_0157090_398_742 114
239 3300035725 Ga0373947_0059869 Ga0373947_0059869_536_880 114
240 3300035725 Ga0373947_0979420 Ga0373947_0979420_202_546 114
241 3300036401 Ga0373937_0667196 Ga0373937_0667196_557_937 114
242 3300036401 Ga0373937_1428642 Ga0373937_1428642_195_590 114
243 3300036647 Ga0316582_0132368 Ga0316582_0132368_378_722 114
244 3300036647 Ga0316582_0201834 Ga0316582_0201834_837_1181 114
245 3300036647 Ga0316582_0251201 Ga0316582_0251201_851_1195 114
246 3300036647 Ga0316582_0265351 Ga0316582_0265351_113_457 114
247 3300036647 Ga0316582_0279606 Ga0316582_0279606_70_417 114
248 3300036712 Ga0316584_0007219 Ga0316584_0007219_1026_1370 114
249 3300036712 Ga0316584_0064691 Ga0316584_0064691_1975_2319 114
250 3300036712 Ga0316584_0068312 Ga0316584_0068312_781_1128 114
251 3300036712 Ga0316584_0138656 Ga0316584_0138656_1230_1574 114
252 3300036712 Ga0316584_0391085 Ga0316584_0391085_433_777 114
253 3300037068 Ga0373925_0427070 Ga0373925_0427070_194_538 114
254 3300037312 Ga0395899_0026680 Ga0395899_0026680_873_1217 114
255 3300037312 Ga0395899_0315319 Ga0395899_0315319_362_712 114
256 3300037466 Ga0395898_0051869 Ga0395898_0051869_935_1324 114
257 3300037466 Ga0395898_0687101 Ga0395898_0687101_370_723 114
258 3300037471 Ga0395905_0236363 Ga0395905_0236363_1045_1434 114
259 3300037588 Ga0316581_0149995 Ga0316581_0149995_126_470 114
260 3300038443 Ga0395901_0047032 Ga0395901_0047032_950_1294 114
261 3300038443 Ga0395901_0387095 Ga0395901_0387095_961_1350 114
262 3300038443 Ga0395901_2043160 Ga0395901_2043160_127_480 114
263 3300041405 Ga0439438_001013 Ga0439438_001013_1713_2057 114
264 3300041407 Ga0439447_000666 Ga0439447_000666_2690_3034 114
265 3300041411 Ga0439466_0002641 Ga0439466_0002641_5346_5690 114
266 3300041411 Ga0439466_0106712 Ga0439466_0106712_230_574 114
267 3300041413 Ga0439465_0005161 Ga0439465_0005161_180_524 114
268 3300041459 Ga0451800_1247482 Ga0451800_1247482_114_461 114
269 3300041460 Ga0451802_0496456 Ga0451802_0496456_91_435 114
270 3300041505 Ga0451849_0145583 Ga0451849_0145583_608_952 114
271 3300041507 Ga0451851_0964593 Ga0451851_0964593_216_560 114
272 3300041512 Ga0451853_3038749 Ga0451853_3038749_28_450 114
273 3300041512 Ga0451853_3458816 Ga0451853_3458816_228_572 114
274 3300042005 Ga0439448_0027212 Ga0439448_0027212_568_912 114
275 3300042006 Ga0439432_010667 Ga0439432_010667_1184_1528 114
276 3300042009 Ga0439451_002482 Ga0439451_002482_742_1086 114
277 3300042009 Ga0439451_002901 Ga0439451_002901_1136_1480 114
278 3300042010 Ga0439452_021999 Ga0439452_021999_714_1058 114
279 3300042011 Ga0439454_089355 Ga0439454_089355_186_530 114
280 3300042013 Ga0439456_000443 Ga0439456_000443_7259_7603 114
281 3300042013 Ga0439456_086210 Ga0439456_086210_303_647 114
282 3300042016 Ga0439463_008507 Ga0439463_008507_1093_1437 114
283 3300042115 Ga0450911_000802 Ga0450911_000802_4417_4761 114
284 3300042127 Ga0450890_000175 Ga0450890_000175_6627_6971 114
285 3300042138 Ga0450903_000125 Ga0450903_000125_9480_9824 114
286 3300042145 Ga0450906_000150 Ga0450906_000150_4815_5159 114
287 3300042146 Ga0450907_000264 Ga0450907_000264_6962_7306 114
288 3300042147 Ga0450910_043876 Ga0450910_043876_223_567 114
289 3300042156 Ga0439446_0000262 Ga0439446_0000262_2221_2565 114
290 3300042184 Ga0450908_000323 Ga0450908_000323_2719_3063 114
291 3300042185 Ga0450909_000146 Ga0450909_000146_5805_6149 114
292 3300042435 Ga0439434_0004261 Ga0439434_0004261_774_1118 114
293 3300042439 Ga0439464_0001496 Ga0439464_0001496_4594_4938 114
294 3300042461 Ga0439460_0015634 Ga0439460_0015634_271_615 114
295 3300042461 Ga0439460_0068874 Ga0439460_0068874_725_1069 114
296 3300042876 Ga0451577_0000491 Ga0451577_0000491_65850_66209 114
297 3300042876 Ga0451577_0011620 Ga0451577_0011620_5786_6163 114
298 3300042876 Ga0451577_0037350 Ga0451577_0037350_3770_4114 114
299 3300042876 Ga0451577_0064223 Ga0451577_0064223_242_586 114
300 3300042876 Ga0451577_0140824 Ga0451577_0140824_1206_1550 114
301 3300042876 Ga0451577_0188018 Ga0451577_0188018_1028_1375 114
302 3300042876 Ga0451577_0306388 Ga0451577_0306388_233_622 114
303 3300042876 Ga0451577_0491503 Ga0451577_0491503_131_475 114
304 3300042876 Ga0451577_0656716 Ga0451577_0656716_458_802 114
305 3300042993 Ga0439440_0000067 Ga0439440_0000067_12733_13077 114
306 3300044673 Ga0453683_0073361 Ga0453683_0073361_1681_2025 114
307 3300044673 Ga0453683_0232474 Ga0453683_0232474_127_474 114
308 3300044712 Ga0453684_0001325 Ga0453684_0001325_2456_2800 114
309 3300044712 Ga0453684_0001444 Ga0453684_0001444_65850_66209 114
310 3300044712 Ga0453684_0002706 Ga0453684_0002706_39922_40311 114
311 3300044712 Ga0453684_0004431 Ga0453684_0004431_4713_5057 114
312 3300044712 Ga0453684_0022734 Ga0453684_0022734_8309_8653 114
313 3300044712 Ga0453684_0057653 Ga0453684_0057653_4203_4547 114
314 3300044712 Ga0453684_0077750 Ga0453684_0077750_3321_3665 114
315 3300044712 Ga0453684_0136906 Ga0453684_0136906_191_535 114
316 3300044712 Ga0453684_0166280 Ga0453684_0166280_1446_1823 114
317 3300044712 Ga0453684_0541964 Ga0453684_0541964_132_485 114
318 3300044712 Ga0453684_0724825 Ga0453684_0724825_478_825 114
319 3300044712 Ga0453684_1047084 Ga0453684_1047084_34_378 114
320 3300045051 Ga0451576_0009820 Ga0451576_0009820_7602_7946 114
321 3300045051 Ga0451576_0084645 Ga0451576_0084645_1732_2076 114
322 3300045051 Ga0451576_0109245 Ga0451576_0109245_1377_1724 114
323 3300045051 Ga0451576_0296552 Ga0451576_0296552_1266_1655 114
324 3300045051 Ga0451576_1113040 Ga0451576_1113040_22_366 114
325 3300046452 Ga0495617_000613 Ga0495617_000613_9286_9630 114
326 3300046452 Ga0495617_002742 Ga0495617_002742_6060_6404 114
327 3300046452 Ga0495617_003910 Ga0495617_003910_361_705 114
328 3300046452 Ga0495617_052845 Ga0495617_052845_644_988 114
329 3300046453 Ga0495627_042401 Ga0495627_042401_708_1052 114
330 3300046454 Ga0495592_0060527 Ga0495592_0060527_1700_2095 114
331 3300046455 Ga0495603_0000256 Ga0495603_0000256_14352_14696 114
332 3300046455 Ga0495603_0193271 Ga0495603_0193271_371_715 114
333 3300046457 Ga0495590_0000339 Ga0495590_0000339_21316_21660 114
334 3300046457 Ga0495590_0007354 Ga0495590_0007354_1395_1739 114
335 3300046457 Ga0495590_0013132 Ga0495590_0013132_2657_3001 114
336 3300046458 Ga0495591_000266 Ga0495591_000266_10263_10607 114
337 3300046458 Ga0495591_097381 Ga0495591_097381_365_709 114
338 3300046459 Ga0495629_0016696 Ga0495629_0016696_3969_4313 114
339 3300046460 Ga0495638_0025626 Ga0495638_0025626_2992_3336 114
340 3300046460 Ga0495638_0052167 Ga0495638_0052167_1936_2280 114
341 3300046462 Ga0495651_0157474 Ga0495651_0157474_1273_1617 114
342 3300046463 Ga0495653_0493811 Ga0495653_0493811_24_377 114
343 3300046463 Ga0495653_0511841 Ga0495653_0511841_116_460 114
344 3300046471 Ga0495650_0000531 Ga0495650_0000531_20888_21232 114
345 3300046471 Ga0495650_0003945 Ga0495650_0003945_758_1102 114
346 3300046471 Ga0495650_0028492 Ga0495650_0028492_1944_2288 114
347 3300046473 Ga0495582_0007727 Ga0495582_0007727_5056_5400 114
348 3300046474 Ga0495605_0000526 Ga0495605_0000526_7635_7979 114
349 3300046474 Ga0495605_0001754 Ga0495605_0001754_9926_10270 114
350 3300046474 Ga0495605_0007320 Ga0495605_0007320_1988_2332 114
351 3300046474 Ga0495605_0031768 Ga0495605_0031768_2004_2348 114
352 3300046474 Ga0495605_0050064 Ga0495605_0050064_1532_1897 114
353 3300046474 Ga0495605_0128959 Ga0495605_0128959_624_968 114
354 3300046475 Ga0495639_0008154 Ga0495639_0008154_263_607 114
355 3300046476 Ga0495662_0045390 Ga0495662_0045390_873_1217 114
356 3300046491 Ga0495584_0001430 Ga0495584_0001430_10420_10764 114
357 3300046491 Ga0495584_0002117 Ga0495584_0002117_10657_11001 114
358 3300046491 Ga0495584_0014843 Ga0495584_0014843_2355_2699 114
359 3300046491 Ga0495584_0040286 Ga0495584_0040286_933_1277 114
360 3300046491 Ga0495584_0311391 Ga0495584_0311391_229_573 114
361 3300046491 Ga0495584_0343133 Ga0495584_0343133_53_397 114
362 3300046492 Ga0495585_0003604 Ga0495585_0003604_8928_9272 114
363 3300046492 Ga0495585_0091794 Ga0495585_0091794_732_1076 114
364 3300046492 Ga0495585_0187634 Ga0495585_0187634_272_616 114
365 3300046499 Ga0495594_0002357 Ga0495594_0002357_900_1244 114
366 3300046499 Ga0495594_0002788 Ga0495594_0002788_4954_5298 114
367 3300046501 Ga0495607_0000637 Ga0495607_0000637_11674_12018 114
368 3300046501 Ga0495607_0054893 Ga0495607_0054893_167_511 114
369 3300046501 Ga0495607_0060485 Ga0495607_0060485_1116_1460 114
370 3300046501 Ga0495607_0101490 Ga0495607_0101490_314_658 114
371 3300046506 Ga0495583_0000921 Ga0495583_0000921_1918_2262 114
372 3300046506 Ga0495583_0017824 Ga0495583_0017824_141_485 114
373 3300046506 Ga0495583_0031567 Ga0495583_0031567_580_924 114
374 3300046506 Ga0495583_0031659 Ga0495583_0031659_362_706 114
375 3300046506 Ga0495583_0102598 Ga0495583_0102598_863_1207 114
376 3300046507 Ga0495606_0021952 Ga0495606_0021952_3254_3598 114
377 3300046507 Ga0495606_0031391 Ga0495606_0031391_2514_2858 114
378 3300046507 Ga0495606_0042204 Ga0495606_0042204_2308_2652 114
379 3300046511 Ga0495608_0073084 Ga0495608_0073084_1872_2216 114
380 3300046511 Ga0495608_0360385 Ga0495608_0360385_180_527 114
381 3300046512 Ga0495610_0067998 Ga0495610_0067998_800_1144 114
382 3300046513 Ga0495616_0000245 Ga0495616_0000245_32144_32488 114
383 3300046513 Ga0495616_0001526 Ga0495616_0001526_15024_15368 114
384 3300046513 Ga0495616_0026197 Ga0495616_0026197_2327_2671 114
385 3300046513 Ga0495616_0131878 Ga0495616_0131878_298_642 114
386 3300046513 Ga0495616_0422167 Ga0495616_0422167_138_482 114
387 3300046514 Ga0495618_0775290 Ga0495618_0775290_130_474 114
388 3300046515 Ga0495620_0002926 Ga0495620_0002926_1321_1665 114
389 3300046515 Ga0495620_0026987 Ga0495620_0026987_161_505 114
390 3300046517 Ga0495630_0003131 Ga0495630_0003131_5476_5820 114
391 3300046517 Ga0495630_0144308 Ga0495630_0144308_928_1272 114
392 3300046518 Ga0495631_0000005 Ga0495631_0000005_41094_41438 114
393 3300046518 Ga0495631_0006594 Ga0495631_0006594_4400_4744 114
394 3300046518 Ga0495631_0020944 Ga0495631_0020944_136_480 114
395 3300046518 Ga0495631_0168696 Ga0495631_0168696_91_435 114
396 3300046519 Ga0495632_0000166 Ga0495632_0000166_29170_29514 114
397 3300046519 Ga0495632_0002218 Ga0495632_0002218_10038_10382 114
398 3300046519 Ga0495632_0002362 Ga0495632_0002362_10434_10778 114
399 3300046520 Ga0495637_0000440 Ga0495637_0000440_362_706 114
400 3300046520 Ga0495637_0000804 Ga0495637_0000804_8017_8361 114
401 3300046520 Ga0495637_0001706 Ga0495637_0001706_10720_11085 114
402 3300046520 Ga0495637_0004378 Ga0495637_0004378_6536_6880 114
403 3300046520 Ga0495637_0011362 Ga0495637_0011362_1393_1737 114
404 3300046522 Ga0495643_0353435 Ga0495643_0353435_247_591 114
405 3300046522 Ga0495643_0465043 Ga0495643_0465043_67_411 114
406 3300046523 Ga0495644_0029822 Ga0495644_0029822_794_1138 114
407 3300046524 Ga0495648_0031213 Ga0495648_0031213_2603_2947 114
408 3300046524 Ga0495648_0045833 Ga0495648_0045833_2316_2660 114
409 3300046524 Ga0495648_0046838 Ga0495648_0046838_2281_2625 114
410 3300046524 Ga0495648_0148046 Ga0495648_0148046_176_520 114
411 3300046524 Ga0495648_0331568 Ga0495648_0331568_176_520 114
412 3300046526 Ga0495666_0013364 Ga0495666_0013364_1158_1502 114
413 3300046526 Ga0495666_0063468 Ga0495666_0063468_530_874 114
414 3300046528 Ga0495642_0000016 Ga0495642_0000016_84774_85118 114
415 3300046528 Ga0495642_0001529 Ga0495642_0001529_558_902 114
416 3300046529 Ga0495652_0188854 Ga0495652_0188854_716_1111 114
417 3300046530 Ga0495654_0012576 Ga0495654_0012576_3716_4060 114
418 3300046530 Ga0495654_0016537 Ga0495654_0016537_1656_2000 114
419 3300046530 Ga0495654_0017220 Ga0495654_0017220_1436_1780 114
420 3300046530 Ga0495654_0017344 Ga0495654_0017344_836_1180 114
421 3300046530 Ga0495654_0072543 Ga0495654_0072543_751_1116 114
422 3300046530 Ga0495654_0174176 Ga0495654_0174176_199_543 114
423 3300046533 Ga0495640_0080680 Ga0495640_0080680_1228_1572 114
424 3300046533 Ga0495640_0352524 Ga0495640_0352524_22_369 114
425 3300046535 Ga0495586_0004702 Ga0495586_0004702_6117_6461 114
426 3300046535 Ga0495586_0040651 Ga0495586_0040651_944_1288 114
427 3300046536 Ga0495587_0000877 Ga0495587_0000877_9646_9990 114
428 3300046538 Ga0495609_0000186 Ga0495609_0000186_25952_26296 114
429 3300046538 Ga0495609_0001638 Ga0495609_0001638_13905_14249 114
430 3300046542 Ga0495597_0011750 Ga0495597_0011750_2501_2845 114
431 3300046542 Ga0495597_0016091 Ga0495597_0016091_638_982 114
432 3300046542 Ga0495597_0066164 Ga0495597_0066164_163_507 114
433 3300046542 Ga0495597_0134012 Ga0495597_0134012_163_507 114
434 3300046557 Ga0495622_0060030 Ga0495622_0060030_1260_1604 114
435 3300046557 Ga0495622_0060449 Ga0495622_0060449_157_501 114
436 3300046557 Ga0495622_0067344 Ga0495622_0067344_76_420 114
437 3300046558 Ga0495633_0001867 Ga0495633_0001867_14012_14356 114
438 3300046558 Ga0495633_0011205 Ga0495633_0011205_3282_3626 114
439 3300046558 Ga0495633_0218800 Ga0495633_0218800_233_577 114
440 3300046559 Ga0495667_0045894 Ga0495667_0045894_2525_2869 114
441 3300046559 Ga0495667_0068510 Ga0495667_0068510_1813_2160 114
442 3300046559 Ga0495667_0862348 Ga0495667_0862348_23_367 114
443 3300046615 Ga0495656_0000395 Ga0495656_0000395_2455_2799 114
444 3300046615 Ga0495656_0024969 Ga0495656_0024969_194_538 114
445 3300046616 Ga0495668_0112920 Ga0495668_0112920_313_657 114
446 3300046616 Ga0495668_0702680 Ga0495668_0702680_175_519 114
447 3300046642 Ga0495634_0289089 Ga0495634_0289089_194_538 114
448 3300046648 Ga0495611_0412822 Ga0495611_0412822_16_360 114
449 3300046660 Ga0495625_0005814 Ga0495625_0005814_1003_1347 114
450 3300046660 Ga0495625_0007010 Ga0495625_0007010_298_663 114
451 3300046660 Ga0495625_0011080 Ga0495625_0011080_6586_6930 114
452 3300046660 Ga0495625_0103755 Ga0495625_0103755_542_886 114
453 3300046660 Ga0495625_0201910 Ga0495625_0201910_378_722 114
454 3300046660 Ga0495625_0338195 Ga0495625_0338195_489_854 114
455 3300046663 Ga0495635_0000594 Ga0495635_0000594_17293_17637 114
456 3300046664 Ga0495659_0000335 Ga0495659_0000335_13351_13695 114
457 3300046664 Ga0495659_0002744 Ga0495659_0002744_2743_3087 114
458 3300046664 Ga0495659_0121412 Ga0495659_0121412_416_760 114
459 3300046665 Ga0495661_0001171 Ga0495661_0001171_22001_22345 114
460 3300046665 Ga0495661_0075198 Ga0495661_0075198_832_1176 114
461 3300046665 Ga0495661_0165283 Ga0495661_0165283_690_1034 114
462 3300046674 Ga0495588_0019674 Ga0495588_0019674_2135_2479 114
463 3300046678 Ga0495599_0064397 Ga0495599_0064397_51_398 114
464 3300046679 Ga0495623_0089739 Ga0495623_0089739_606_1001 114
465 3300046680 Ga0495646_0006790 Ga0495646_0006790_3254_3598 114
466 3300046684 Ga0495669_0001951 Ga0495669_0001951_114_458 114
467 3300046684 Ga0495669_0247177 Ga0495669_0247177_276_620 114
468 3300046684 Ga0495669_0400030 Ga0495669_0400030_141_485 114
469 3300046689 Ga0495613_0053677 Ga0495613_0053677_1748_2092 114
470 3300046691 Ga0495670_0000215 Ga0495670_0000215_10879_11223 114
471 3300046691 Ga0495670_0055484 Ga0495670_0055484_519_863 114
472 3300046691 Ga0495670_0108359 Ga0495670_0108359_696_1040 114
473 3300046691 Ga0495670_0621826 Ga0495670_0621826_181_525 114
474 3300046691 Ga0495670_0833621 Ga0495670_0833621_12_356 114
475 3300046692 Ga0495671_0091763 Ga0495671_0091763_402_746 114
476 3300046692 Ga0495671_0203276 Ga0495671_0203276_181_525 114
477 3300046692 Ga0495671_0477053 Ga0495671_0477053_138_482 114
478 3300046694 Ga0495649_0000086 Ga0495649_0000086_21747_22091 114
479 3300046694 Ga0495649_0001882 Ga0495649_0001882_1618_1962 114
480 3300046694 Ga0495649_0016341 Ga0495649_0016341_2503_2847 114
481 3300046694 Ga0495649_0056999 Ga0495649_0056999_10_354 114
482 3300046694 Ga0495649_0109500 Ga0495649_0109500_1080_1424 114
483 3300046694 Ga0495649_0144826 Ga0495649_0144826_793_1137 114
484 3300046794 Ga0495589_0000636 Ga0495589_0000636_1045_1389 114
485 3300046794 Ga0495589_0000799 Ga0495589_0000799_1056_1400 114
486 3300046794 Ga0495589_0008326 Ga0495589_0008326_636_980 114
487 3300046794 Ga0495589_0065008 Ga0495589_0065008_719_1063 114
488 3300046809 Ga0495600_0002600 Ga0495600_0002600_9939_10283 114
489 3300046809 Ga0495600_0235469 Ga0495600_0235469_45_392 114
490 3300046810 Ga0495660_0055284 Ga0495660_0055284_665_1009 114
491 3300046810 Ga0495660_0120606 Ga0495660_0120606_147_491 114
492 3300047315 Ga0495581_0010345 Ga0495581_0010345_1169_1513 114
493 3300047315 Ga0495581_0021045 Ga0495581_0021045_1771_2115 114
494 3300047317 Ga0495604_0001248 Ga0495604_0001248_17253_17597 114
495 3300047317 Ga0495604_0186990 Ga0495604_0186990_649_1029 114
496 3300047318 Ga0495636_0001197 Ga0495636_0001197_9395_9739 114
497 3300047318 Ga0495636_0043209 Ga0495636_0043209_1417_1761 114
498 3300047319 Ga0495674_0545469 Ga0495674_0545469_175_519 114
499 3300047319 Ga0495674_0620722 Ga0495674_0620722_285_629 114
500 3300047320 Ga0495672_0001126 Ga0495672_0001126_24006_24350 114
501 3300047320 Ga0495672_0007895 Ga0495672_0007895_1993_2337 114
502 3300047320 Ga0495672_0010752 Ga0495672_0010752_686_1030 114
503 3300047320 Ga0495672_0040511 Ga0495672_0040511_330_674 114
504 3300047320 Ga0495672_0357778 Ga0495672_0357778_200_544 114
505 3300047320 Ga0495672_0392912 Ga0495672_0392912_257_601 114
506 3300047321 Ga0495676_0065572 Ga0495676_0065572_833_1177 114
507 3300047322 Ga0495680_0000029 Ga0495680_0000029_97684_98028 114
508 3300047322 Ga0495680_0065586 Ga0495680_0065586_1234_1578 114
509 3300047322 Ga0495680_0358077 Ga0495680_0358077_575_919 114
510 3300047323 Ga0495683_0000010 Ga0495683_0000010_72307_72651 114
511 3300047323 Ga0495683_0003697 Ga0495683_0003697_8034_8378 114
512 3300047323 Ga0495683_0047247 Ga0495683_0047247_994_1359 114
513 3300047323 Ga0495683_0059918 Ga0495683_0059918_1225_1569 114
514 3300047443 Ga0495687_001073 Ga0495687_001073_5683_6027 114
515 3300047443 Ga0495687_008040 Ga0495687_008040_4793_5137 114
516 3300047445 Ga0495677_0000135 Ga0495677_0000135_609_953 114
517 3300047447 Ga0495685_066449 Ga0495685_066449_825_1169 114
518 3300047447 Ga0495685_091689 Ga0495685_091689_595_939 114
519 3300047469 Ga0495673_0000636 Ga0495673_0000636_3088_3432 114
520 3300047469 Ga0495673_0001177 Ga0495673_0001177_8815_9159 114
521 3300047469 Ga0495673_0011065 Ga0495673_0011065_4037_4381 114
522 3300047469 Ga0495673_0039221 Ga0495673_0039221_233_577 114
523 3300047469 Ga0495673_0113182 Ga0495673_0113182_699_1064 114
524 3300047470 Ga0495681_0001131 Ga0495681_0001131_1880_2224 114
525 3300047470 Ga0495681_0024464 Ga0495681_0024464_384_728 114
526 3300047470 Ga0495681_0035207 Ga0495681_0035207_1990_2334 114
527 3300047471 Ga0495684_0030723 Ga0495684_0030723_313_657 114
528 3300047471 Ga0495684_0435012 Ga0495684_0435012_259_627 114
529 3300047472 Ga0495686_0126370 Ga0495686_0126370_19_363 114
530 3300047472 Ga0495686_0127953 Ga0495686_0127953_343_687 114
531 3300047673 Ga0495593_0025192 Ga0495593_0025192_1299_1643 114
532 3300047673 Ga0495593_0090783 Ga0495593_0090783_836_1180 114
533 3300048088 Ga0495602_0164527 Ga0495602_0164527_290_685 114
534 3300048088 Ga0495602_0892779 Ga0495602_0892779_36_380 114
535 3300048091 Ga0495626_0000490 Ga0495626_0000490_20324_20668 114
536 3300048091 Ga0495626_0000538 Ga0495626_0000538_4962_5306 114
537 3300048091 Ga0495626_0001424 Ga0495626_0001424_10308_10652 114
538 3300048091 Ga0495626_0003448 Ga0495626_0003448_9779_10123 114
539 3300048091 Ga0495626_0262682 Ga0495626_0262682_13_357 114
540 3300048904 Ga0496101_0094024 Ga0496101_0094024_282_632 114
541 3300048905 Ga0496102_1218807 Ga0496102_1218807_78_422 114
542 3300048906 Ga0496103_0086413 Ga0496103_0086413_589_933 114
543 3300048907 Ga0496104_0624649 Ga0496104_0624649_12_356 114
544 3300048907 Ga0496104_1528359 Ga0496104_1528359_173_517 114
545 3300048909 Ga0496106_1029961 Ga0496106_1029961_122_466 114
546 3300048911 Ga0496108_0032403 Ga0496108_0032403_1601_1945 114
547 3300048912 Ga0496109_0260113 Ga0496109_0260113_746_1114 114
548 3300048912 Ga0496109_0954387 Ga0496109_0954387_435_785 114
549 3300048913 Ga0496110_0047289 Ga0496110_0047289_3392_3736 114
550 3300048913 Ga0496110_0824045 Ga0496110_0824045_323_667 114
551 3300048914 Ga0496111_0688967 Ga0496111_0688967_71_415 114
552 3300048914 Ga0496111_1105862 Ga0496111_1105862_195_539 114
553 3300048915 Ga0496112_0025482 Ga0496112_0025482_2222_2566 114
554 3300048915 Ga0496112_0234120 Ga0496112_0234120_388_732 114
555 3300048917 Ga0496114_0001978 Ga0496114_0001978_13470_13820 114
556 3300048918 Ga0496115_0147652 Ga0496115_0147652_856_1200 114
557 3300048919 Ga0496116_0039501 Ga0496116_0039501_883_1227 114
558 3300048920 Ga0496117_0001581 Ga0496117_0001581_2788_3132 114
559 3300048920 Ga0496117_0296429 Ga0496117_0296429_344_688 114
560 3300048921 Ga0496118_0178580 Ga0496118_0178580_254_598 114
561 3300048924 Ga0496121_0059938 Ga0496121_0059938_1986_2330 114
562 3300048924 Ga0496121_0704775 Ga0496121_0704775_79_423 114
563 3300048925 Ga0496122_0005168 Ga0496122_0005168_13167_13511 114
564 3300048926 Ga0496123_0026923 Ga0496123_0026923_1654_1998 114
565 3300048927 Ga0496124_0190285 Ga0496124_0190285_265_609 114
566 3300048928 Ga0496125_0007781 Ga0496125_0007781_7775_8119 114
567 3300048928 Ga0496125_0053077 Ga0496125_0053077_1056_1400 114
568 3300048928 Ga0496125_0217674 Ga0496125_0217674_238_582 114
569 3300048929 Ga0496126_0091173 Ga0496126_0091173_1791_2135 114
570 3300049459 Ga0495678_000437 Ga0495678_000437_20925_21269 114
571 3300049459 Ga0495678_001452 Ga0495678_001452_7171_7536 114
572 3300049459 Ga0495678_005908 Ga0495678_005908_436_780 114
573 3300049459 Ga0495678_017731 Ga0495678_017731_1831_2175 114
574 3300049459 Ga0495678_055284 Ga0495678_055284_231_575 114
575 3300049459 Ga0495678_087205 Ga0495678_087205_626_970 114
576 3300049459 Ga0495678_173180 Ga0495678_173180_301_666 114
577 3300049460 Ga0495682_0000307 Ga0495682_0000307_29058_29402 114
578 3300049460 Ga0495682_0003264 Ga0495682_0003264_6226_6570 114
579 3300049460 Ga0495682_0060363 Ga0495682_0060363_545_889 114
580 3300049460 Ga0495682_0062615 Ga0495682_0062615_981_1325 114
581 3300049460 Ga0495682_0088657 Ga0495682_0088657_551_895 114
582 3300049460 Ga0495682_0203071 Ga0495682_0203071_13_357 114
583 3300049460 Ga0495682_0295538 Ga0495682_0295538_117_461 114
584 3300049568 Ga0501031_0048591 Ga0501031_0048591_1160_1504 114
585 3300049568 Ga0501031_0346655 Ga0501031_0346655_164_508 114
586 3300049569 Ga0501032_0144665 Ga0501032_0144665_479_823 114
587 3300049570 Ga0501033_0085887 Ga0501033_0085887_1527_1871 114
588 3300049571 Ga0501034_0487932 Ga0501034_0487932_59_403 114
589 3300049572 Ga0501036_0027179 Ga0501036_0027179_1160_1504 114
590 3300049572 Ga0501036_0326028 Ga0501036_0326028_360_746 114
591 3300049572 Ga0501036_1139927 Ga0501036_1139927_89_442 114
592 3300049574 Ga0501038_0005503 Ga0501038_0005503_311_655 114
593 3300049574 Ga0501038_1243853 Ga0501038_1243853_22_375 114
594 3300049575 Ga0501039_0011483 Ga0501039_0011483_2846_3190 114
595 3300049575 Ga0501039_0110947 Ga0501039_0110947_1665_2009 114
596 3300049575 Ga0501039_0317994 Ga0501039_0317994_336_689 114
597 3300049576 Ga0501040_0019453 Ga0501040_0019453_1712_2056 114
598 3300049576 Ga0501040_0022127 Ga0501040_0022127_2297_2641 114
599 3300049576 Ga0501040_0310076 Ga0501040_0310076_660_1046 114
600 3300049577 Ga0501041_0006386 Ga0501041_0006386_4996_5340 114
601 3300049577 Ga0501041_0038855 Ga0501041_0038855_778_1122 114
602 3300049577 Ga0501041_0405259 Ga0501041_0405259_264_608 114
603 3300049577 Ga0501041_0675931 Ga0501041_0675931_20_373 114
604 3300049578 Ga0501042_0014313 Ga0501042_0014313_3228_3572 114
605 3300049578 Ga0501042_0089203 Ga0501042_0089203_198_542 114
606 3300049578 Ga0501042_0143663 Ga0501042_0143663_1319_1702 114
607 3300049578 Ga0501042_0163274 Ga0501042_0163274_278_664 114
608 3300049579 Ga0501043_0077243 Ga0501043_0077243_1052_1396 114
609 3300049580 Ga0501046_0009891 Ga0501046_0009891_6416_6760 114
610 3300049582 Ga0501048_0034389 Ga0501048_0034389_219_563 114
611 3300049582 Ga0501048_0179871 Ga0501048_0179871_708_1094 114
612 3300049582 Ga0501048_0997506 Ga0501048_0997506_200_544 114
613 3300049583 Ga0501067_0148152 Ga0501067_0148152_517_861 114
614 3300049584 Ga0501068_0014758 Ga0501068_0014758_3060_3404 114
615 3300049584 Ga0501068_0445548 Ga0501068_0445548_33_377 114
616 3300049585 Ga0501069_0003746 Ga0501069_0003746_3746_4090 114
617 3300049585 Ga0501069_0186041 Ga0501069_0186041_702_1046 114
618 3300049586 Ga0501070_0017298 Ga0501070_0017298_3702_4046 114
619 3300049587 Ga0501071_0006205 Ga0501071_0006205_3640_3984 114
620 3300049587 Ga0501071_0103177 Ga0501071_0103177_977_1321 114
621 3300049587 Ga0501071_0166963 Ga0501071_0166963_569_955 114
622 3300049587 Ga0501071_1261268 Ga0501071_1261268_208_552 114
623 3300049588 Ga0501072_0023058 Ga0501072_0023058_3599_3943 114
624 3300049588 Ga0501072_0062578 Ga0501072_0062578_716_1102 114
625 3300049588 Ga0501072_0189268 Ga0501072_0189268_1116_1460 114
626 3300049589 Ga0501073_0053832 Ga0501073_0053832_769_1113 114
627 3300049590 Ga0501074_0025433 Ga0501074_0025433_2118_2462 114
628 3300049590 Ga0501074_0183324 Ga0501074_0183324_540_926 114
629 3300049590 Ga0501074_0197339 Ga0501074_0197339_261_605 114
630 3300049591 Ga0501075_0021672 Ga0501075_0021672_2936_3280 114
631 3300049591 Ga0501075_0067834 Ga0501075_0067834_875_1219 114
632 3300049591 Ga0501075_0277467 Ga0501075_0277467_527_913 114
633 3300049591 Ga0501075_0319583 Ga0501075_0319583_470_814 114
634 3300049591 Ga0501075_0669252 Ga0501075_0669252_25_378 114
635 3300049592 Ga0501076_0006382 Ga0501076_0006382_3555_3899 114
636 3300049592 Ga0501076_0011226 Ga0501076_0011226_1720_2106 114
637 3300049592 Ga0501076_0033778 Ga0501076_0033778_41_385 114
638 3300049592 Ga0501076_1581429 Ga0501076_1581429_39_392 114
639 3300049593 Ga0501077_0010374 Ga0501077_0010374_875_1219 114
640 3300049593 Ga0501077_0035094 Ga0501077_0035094_2007_2351 114
641 3300049656 Ga0501209_184714 Ga0501209_184714_218_562 114
642 3300049675 Ga0501243_017374 Ga0501243_017374_617_961 114
643 3300049741 Ga0501079_0006833 Ga0501079_0006833_5148_5492 114
644 3300049741 Ga0501079_0013918 Ga0501079_0013918_560_904 114
645 3300049741 Ga0501079_0042123 Ga0501079_0042123_2320_2673 114
646 3300049741 Ga0501079_0078197 Ga0501079_0078197_2106_2450 114
647 3300049742 Ga0501080_0094801 Ga0501080_0094801_274_618 114
648 3300049742 Ga0501080_0285972 Ga0501080_0285972_872_1258 114
649 3300049742 Ga0501080_0668574 Ga0501080_0668574_302_646 114
650 3300049743 Ga0501081_0072094 Ga0501081_0072094_44_388 114
651 3300049743 Ga0501081_0540740 Ga0501081_0540740_221_565 114
652 3300049744 Ga0501083_0018187 Ga0501083_0018187_832_1176 114
653 3300049744 Ga0501083_0283768 Ga0501083_0283768_371_715 114
654 3300049744 Ga0501083_0469649 Ga0501083_0469649_92_436 114
655 3300049822 Ga0501035_0028926 Ga0501035_0028926_1618_1962 114
656 3300049823 Ga0501044_0150579 Ga0501044_0150579_1396_1782 114
657 3300049824 Ga0501045_0020247 Ga0501045_0020247_716_1060 114
658 3300049824 Ga0501045_0029882 Ga0501045_0029882_2197_2541 114
659 3300049824 Ga0501045_0163670 Ga0501045_0163670_1260_1646 114
660 3300049824 Ga0501045_0299004 Ga0501045_0299004_294_647 114
661 3300049824 Ga0501045_0319609 Ga0501045_0319609_148_492 114
662 3300050507 nmdc:mga05p37_1828234_c1 nmdc:mga05p37_1828234_c1_73_417 114
663 3300050507 nmdc:mga05p37_28870_c1 nmdc:mga05p37_28870_c1_3583_3927 114
664 3300050511 nmdc:mga08y16_2087303_c1 nmdc:mga08y16_2087303_c1_29_373 114
665 3300050512 nmdc:mga0n895_12219_c1 nmdc:mga0n895_12219_c1_3276_3620 114
666 3300050514 nmdc:mga08x19_105717_c1 nmdc:mga08x19_105717_c1_574_966 114
667 3300053077 Ga0495601_0187956 Ga0495601_0187956_952_1296 114
668 3300053077 Ga0495601_0614307 Ga0495601_0614307_202_582 114
669 3300053078 Ga0495612_0117115 Ga0495612_0117115_653_997 114
670 3300053084 Ga0495595_0176113 Ga0495595_0176113_283_630 114
671 3300053085 Ga0495619_0014093 Ga0495619_0014093_4168_4548 114
672 3300053085 Ga0495619_0391137 Ga0495619_0391137_598_942 114
673 3300053085 Ga0495619_0635373 Ga0495619_0635373_374_718 114
674 3300053085 Ga0495619_0723090 Ga0495619_0723090_101_469 114
675 3300054114 Ga0501084_0011960 Ga0501084_0011960_3644_3988 114
676 3300054114 Ga0501084_0020787 Ga0501084_0020787_3676_4020 114
677 3300054114 Ga0501084_0025627 Ga0501084_0025627_2421_2774 114
678 3300060353 Ga0501082_0007671 Ga0501082_0007671_6390_6734 114
679 3300060353 Ga0501082_0337351 Ga0501082_0337351_22_408 114
680 3300060353 Ga0501082_0447091 Ga0501082_0447091_371_715 114
681 3300061734 Ga0530510_0014617 Ga0530510_0014617_2616_2960 114
682 3300061734 Ga0530510_0181195 Ga0530510_0181195_1035_1379 114
683 3300061734 Ga0530510_0531451 Ga0530510_0531451_437_781 114
684 3300061734 Ga0530510_1288209 Ga0530510_1288209_160_546 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

64

135

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8975 35 109
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8904 10 110
6m9s-assembly2.cif.gz_D crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8849 35 108
6m9s-assembly1.cif.gz_B crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8842 35 108
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8837 35 109
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9066 35 109 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8918 35 111 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8753 11 110 2.60.120.10
af_A0A143ZXM2_1983_2072_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.867 35 108 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8608 35 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1H5LHQ7-F1-model_v4 deleted 0.9968 7 114
AF-A0A4R8WTJ1-F1-model_v4 Cupin domain-containing protein 0.9868 1 114
AF-A0A0Q9EMV4-F1-model_v4 Cupin 0.9865 21 114
AF-A0JTC5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.984 1 114
AF-A0A0Q9LSN7-F1-model_v4 Cupin 0.9815 1 114

Feature Viewer

pLDDT pTM Quality
93.6 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map