F475068
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 684 | 349 | 684 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_3038749|Ga0451853_3038749_28_450 |
| Length | 140 |
| Sequence | VAGSSTSSSATEGHAAGIPAAQEERTVTDDEVVPETRGVTAQELATVDLGPEIEGMEGRRLRMRMFTFEPGAVFGPVHDHVGRPGTVYVLQGTITDHRDGVATDYGPGVGWPEDRDTNHWLENRGRVPAVEISVDIVNPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 116 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 144 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 145 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 149 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 167 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 168 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 169 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 170 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 173 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 177 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 178 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 179 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 180 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 181 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 182 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 183 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 184 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 185 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 186 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 187 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 188 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 189 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 190 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 191 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 192 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 193 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 300 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 2.78 |
| Rhizosphere | 94.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_7184 | 2124908027 | Bacteria | 2394 |
| 2 | MRS2a_Contig_735 | 2124908027 | Bacteria | 3129 |
| 3 | SwRhRL2b_contig_974593 | 2162886007 | Bacteria | 14964 |
| 4 | Ga0006562J51391_1018001 | 3300003578 | Bacteria | 830 |
| 5 | Ga0058860_12119322 | 3300004801 | Bacteria | 503 |
| 6 | Ga0065714_10319798 | 3300005288 | Bacteria | 670 |
| 7 | Ga0065715_10144632 | 3300005293 | Bacteria | 1804 |
| 8 | Ga0070658_10131006 | 3300005327 | Bacteria | 2090 |
| 9 | Ga0070676_10134016 | 3300005328 | Bacteria | 1570 |
| 10 | Ga0070683_100018314 | 3300005329 | Bacteria | 6200 |
| 11 | Ga0070683_100070062 | 3300005329 | Bacteria | 3271 |
| 12 | Ga0070683_101148749 | 3300005329 | Bacteria | 746 |
| 13 | Ga0070680_101659160 | 3300005336 | Bacteria | 554 |
| 14 | Ga0070682_100047913 | 3300005337 | Unclassified | 2659 |
| 15 | Ga0070689_100302389 | 3300005340 | Bacteria | 1332 |
| 16 | Ga0070661_100054711 | 3300005344 | Bacteria | 2923 |
| 17 | Ga0070661_100565448 | 3300005344 | Bacteria | 916 |
| 18 | Ga0070668_100128389 | 3300005347 | Bacteria | 2032 |
| 19 | Ga0070671_100308466 | 3300005355 | Bacteria | 1348 |
| 20 | Ga0070674_100005238 | 3300005356 | Bacteria | 7462 |
| 21 | Ga0070674_100512866 | 3300005356 | Bacteria | 1000 |
| 22 | Ga0070667_100422406 | 3300005367 | Bacteria | 1215 |
| 23 | Ga0070714_100238001 | 3300005435 | Bacteria | 1679 |
| 24 | Ga0070714_100736248 | 3300005435 | Bacteria | 953 |
| 25 | Ga0070714_100810961 | 3300005435 | Bacteria | 907 |
| 26 | Ga0070701_10720222 | 3300005438 | Bacteria | 673 |
| 27 | Ga0070705_100150622 | 3300005440 | Bacteria | 1543 |
| 28 | Ga0070705_100812651 | 3300005440 | Bacteria | 745 |
| 29 | Ga0070694_100441168 | 3300005444 | Bacteria | 1026 |
| 30 | Ga0070678_100123621 | 3300005456 | Bacteria | 2044 |
| 31 | Ga0070681_10021936 | 3300005458 | Bacteria | 6406 |
| 32 | Ga0068867_100727925 | 3300005459 | Bacteria | 878 |
| 33 | Ga0070685_10818577 | 3300005466 | Bacteria | 688 |
| 34 | Ga0070684_100009533 | 3300005535 | Bacteria | 7651 |
| 35 | Ga0070684_101489452 | 3300005535 | Bacteria | 638 |
| 36 | Ga0070697_100251111 | 3300005536 | Bacteria | 1512 |
| 37 | Ga0070672_100129839 | 3300005543 | Bacteria | 2070 |
| 38 | Ga0070695_100348229 | 3300005545 | Bacteria | 1109 |
| 39 | Ga0070696_100040092 | 3300005546 | Bacteria | 3233 |
| 40 | Ga0070696_100588205 | 3300005546 | Bacteria | 896 |
| 41 | Ga0070696_101485845 | 3300005546 | Bacteria | 580 |
| 42 | Ga0070696_101528144 | 3300005546 | Bacteria | 572 |
| 43 | Ga0070665_100001218 | 3300005548 | Bacteria | 31350 |
| 44 | Ga0070665_100043339 | 3300005548 | Bacteria | 4522 |
| 45 | Ga0070704_100387488 | 3300005549 | Bacteria | 1189 |
| 46 | Ga0070704_100641789 | 3300005549 | Bacteria | 937 |
| 47 | Ga0070664_100000674 | 3300005564 | Bacteria | 26089 |
| 48 | Ga0070664_101391985 | 3300005564 | Bacteria | 663 |
| 49 | Ga0068854_100194277 | 3300005578 | Bacteria | 1592 |
| 50 | Ga0070702_101492291 | 3300005615 | Bacteria | 556 |
| 51 | Ga0068852_101349404 | 3300005616 | Bacteria | 735 |
| 52 | Ga0068859_101344144 | 3300005617 | Bacteria | 788 |
| 53 | Ga0068861_101186331 | 3300005719 | Bacteria | 737 |
| 54 | Ga0068863_100047720 | 3300005841 | Bacteria | 4062 |
| 55 | Ga0068863_101673403 | 3300005841 | Bacteria | 646 |
| 56 | Ga0068860_100494291 | 3300005843 | Bacteria | 1221 |
| 57 | Ga0068862_100776677 | 3300005844 | Bacteria | 934 |
| 58 | Ga0068862_101036645 | 3300005844 | Bacteria | 813 |
| 59 | Ga0075432_10000086 | 3300006058 | Bacteria | 19052 |
| 60 | Ga0075428_101926837 | 3300006844 | Bacteria | 614 |
| 61 | Ga0075433_11677197 | 3300006852 | Bacteria | 547 |
| 62 | Ga0075434_100019668 | 3300006871 | Bacteria | 6535 |
| 63 | Ga0075436_100102834 | 3300006914 | Bacteria | 1990 |
| 64 | Ga0097620_101344140 | 3300006931 | Bacteria | 788 |
| 65 | Ga0105244_10442256 | 3300009036 | Bacteria | 598 |
| 66 | Ga0105250_10302955 | 3300009092 | Bacteria | 691 |
| 67 | Ga0105240_10015390 | 3300009093 | Bacteria | 10398 |
| 68 | Ga0105240_10428764 | 3300009093 | Unclassified | 1484 |
| 69 | Ga0105245_10040933 | 3300009098 | Bacteria | 4129 |
| 70 | Ga0105245_10272063 | 3300009098 | Bacteria | 1652 |
| 71 | Ga0114129_10033074 | 3300009147 | Bacteria | 7308 |
| 72 | Ga0114129_12774695 | 3300009147 | Bacteria | 583 |
| 73 | Ga0105243_11779898 | 3300009148 | Bacteria | 647 |
| 74 | Ga0105242_10536006 | 3300009176 | Bacteria | 1120 |
| 75 | Ga0105242_10581894 | 3300009176 | Bacteria | 1078 |
| 76 | Ga0105237_10334012 | 3300009545 | Bacteria | 1520 |
| 77 | Ga0105237_11448005 | 3300009545 | Bacteria | 693 |
| 78 | Ga0105249_10062257 | 3300009553 | Bacteria | 3426 |
| 79 | Ga0105239_10391863 | 3300010375 | Bacteria | 1571 |
| 80 | Ga0105239_13124259 | 3300010375 | Bacteria | 539 |
| 81 | Ga0105246_10372626 | 3300011119 | Bacteria | 1177 |
| 82 | Ga0105246_10418803 | 3300011119 | Unclassified | 1117 |
| 83 | Ga0105246_10741793 | 3300011119 | Bacteria | 865 |
| 84 | Ga0105246_12208178 | 3300011119 | Bacteria | 536 |
| 85 | Ga0157328_1008953 | 3300012478 | Bacteria | 665 |
| 86 | Ga0157373_10337198 | 3300013100 | Bacteria | 1074 |
| 87 | Ga0157369_10317302 | 3300013105 | Bacteria | 1620 |
| 88 | Ga0157369_10394703 | 3300013105 | Bacteria | 1435 |
| 89 | Ga0157374_10126997 | 3300013296 | Bacteria | 2465 |
| 90 | Ga0157378_10380623 | 3300013297 | Bacteria | 1386 |
| 91 | Ga0157378_10544232 | 3300013297 | Bacteria | 1165 |
| 92 | Ga0163162_12095936 | 3300013306 | Bacteria | 649 |
| 93 | Ga0163162_12659815 | 3300013306 | Bacteria | 576 |
| 94 | Ga0157372_10014769 | 3300013307 | Bacteria | 8358 |
| 95 | Ga0157372_10854950 | 3300013307 | Bacteria | 1056 |
| 96 | Ga0157372_12349680 | 3300013307 | Bacteria | 612 |
| 97 | Ga0157372_12511967 | 3300013307 | Bacteria | 591 |
| 98 | Ga0157375_10058265 | 3300013308 | Bacteria | 3821 |
| 99 | Ga0157375_10175081 | 3300013308 | Bacteria | 2295 |
| 100 | Ga0157375_11906387 | 3300013308 | Bacteria | 705 |
| 101 | Ga0163163_11340648 | 3300014325 | Bacteria | 777 |
| 102 | Ga0182008_10006943 | 3300014497 | Bacteria | 6284 |
| 103 | Ga0182007_10009622 | 3300015262 | Bacteria | 3881 |
| 104 | Ga0182005_1001133 | 3300015265 | Bacteria | 11128 |
| 105 | Ga0163161_10536614 | 3300017792 | Bacteria | 957 |
| 106 | Ga0207697_10048149 | 3300025315 | Bacteria | 1758 |
| 107 | Ga0207655_1001872 | 3300025728 | Bacteria | 18118 |
| 108 | Ga0207655_1012569 | 3300025728 | Bacteria | 4937 |
| 109 | Ga0207713_1005277 | 3300025735 | Bacteria | 8127 |
| 110 | Ga0207713_1005486 | 3300025735 | Bacteria | 7919 |
| 111 | Ga0207653_10031202 | 3300025885 | Bacteria | 1721 |
| 112 | Ga0207688_10018309 | 3300025901 | Bacteria | 3811 |
| 113 | Ga0207705_10209112 | 3300025909 | Bacteria | 1480 |
| 114 | Ga0207707_10222566 | 3300025912 | Unclassified | 1643 |
| 115 | Ga0207707_11663451 | 3300025912 | Bacteria | 501 |
| 116 | Ga0207695_10017147 | 3300025913 | Bacteria | 8442 |
| 117 | Ga0207695_10149559 | 3300025913 | Bacteria | 2275 |
| 118 | Ga0207695_10505700 | 3300025913 | Bacteria | 1090 |
| 119 | Ga0207649_10045760 | 3300025920 | Bacteria | 2684 |
| 120 | Ga0207694_10497398 | 3300025924 | Bacteria | 1021 |
| 121 | Ga0207687_10013465 | 3300025927 | Bacteria | 5340 |
| 122 | Ga0207687_10030892 | 3300025927 | Bacteria | 3616 |
| 123 | Ga0207687_11687537 | 3300025927 | Bacteria | 543 |
| 124 | Ga0207664_10072849 | 3300025929 | Bacteria | 2771 |
| 125 | Ga0207690_10592233 | 3300025932 | Bacteria | 904 |
| 126 | Ga0207686_10570194 | 3300025934 | Bacteria | 887 |
| 127 | Ga0207686_11849667 | 3300025934 | Bacteria | 500 |
| 128 | Ga0207669_10174441 | 3300025937 | Bacteria | 1534 |
| 129 | Ga0207669_10221677 | 3300025937 | Bacteria | 1388 |
| 130 | Ga0207669_10727246 | 3300025937 | Bacteria | 818 |
| 131 | Ga0207704_10279428 | 3300025938 | Bacteria | 1268 |
| 132 | Ga0207704_11900249 | 3300025938 | Bacteria | 512 |
| 133 | Ga0207691_10133892 | 3300025940 | Bacteria | 2188 |
| 134 | Ga0207661_10027333 | 3300025944 | Bacteria | 4357 |
| 135 | Ga0207661_10828800 | 3300025944 | Bacteria | 852 |
| 136 | Ga0207679_10001427 | 3300025945 | Bacteria | 15032 |
| 137 | Ga0207679_10058784 | 3300025945 | Bacteria | 2851 |
| 138 | Ga0207712_10514311 | 3300025961 | Bacteria | 1025 |
| 139 | Ga0207668_10097263 | 3300025972 | Bacteria | 2178 |
| 140 | Ga0207640_10086703 | 3300025981 | Bacteria | 2156 |
| 141 | Ga0207703_10014401 | 3300026035 | Bacteria | 6166 |
| 142 | Ga0207639_10000118 | 3300026041 | Bacteria | 60793 |
| 143 | Ga0207708_10273312 | 3300026075 | Bacteria | 1367 |
| 144 | Ga0207708_11372693 | 3300026075 | Bacteria | 620 |
| 145 | Ga0207641_10124578 | 3300026088 | Bacteria | 2305 |
| 146 | Ga0207648_10530546 | 3300026089 | Bacteria | 1079 |
| 147 | Ga0207648_11422241 | 3300026089 | Bacteria | 652 |
| 148 | Ga0207676_10808687 | 3300026095 | Bacteria | 915 |
| 149 | Ga0207674_10027486 | 3300026116 | Bacteria | 6017 |
| 150 | Ga0207675_100019647 | 3300026118 | Bacteria | 6305 |
| 151 | Ga0207683_10000961 | 3300026121 | Bacteria | 26403 |
| 152 | Ga0207683_12114510 | 3300026121 | Bacteria | 511 |
| 153 | Ga0209969_1005739 | 3300027360 | Bacteria | 1747 |
| 154 | Ga0209982_1004337 | 3300027552 | Bacteria | 2032 |
| 155 | Ga0210002_1028865 | 3300027617 | Bacteria | 917 |
| 156 | Ga0209983_1003298 | 3300027665 | Bacteria | 3465 |
| 157 | Ga0209971_1011721 | 3300027682 | Bacteria | 2077 |
| 158 | Ga0209966_1011716 | 3300027695 | Bacteria | 1601 |
| 159 | Ga0209998_10014095 | 3300027717 | Bacteria | 1668 |
| 160 | Ga0209974_10016737 | 3300027876 | Bacteria | 2433 |
| 161 | Ga0207428_10161782 | 3300027907 | Bacteria | 1699 |
| 162 | Ga0207428_10397783 | 3300027907 | Bacteria | 1009 |
| 163 | Ga0268266_10000211 | 3300028379 | Bacteria | 101045 |
| 164 | Ga0268266_10083004 | 3300028379 | Bacteria | 2796 |
| 165 | Ga0268265_10204108 | 3300028380 | Bacteria | 1717 |
| 166 | Ga0268265_11038605 | 3300028380 | Bacteria | 811 |
| 167 | Ga0268265_11173996 | 3300028380 | Bacteria | 764 |
| 168 | Ga0265337_1005753 | 3300028556 | Bacteria | 4871 |
| 169 | Ga0265326_10006088 | 3300028558 | Bacteria | 3770 |
| 170 | Ga0265319_1069098 | 3300028563 | Bacteria | 1134 |
| 171 | Ga0265323_10108718 | 3300028653 | Bacteria | 911 |
| 172 | Ga0265322_10115346 | 3300028654 | Bacteria | 765 |
| 173 | Ga0265336_10008131 | 3300028666 | Bacteria | 3695 |
| 174 | Ga0265338_10009948 | 3300028800 | Bacteria | 11244 |
| 175 | Ga0265338_10766096 | 3300028800 | Bacteria | 663 |
| 176 | Ga0265332_10197602 | 3300031238 | Bacteria | 836 |
| 177 | Ga0265329_10014704 | 3300031242 | Bacteria | 2756 |
| 178 | Ga0265331_10086542 | 3300031250 | Bacteria | 1452 |
| 179 | Ga0265327_10043787 | 3300031251 | Bacteria | 2392 |
| 180 | Ga0265316_10020698 | 3300031344 | Bacteria | 5593 |
| 181 | Ga0265316_10189656 | 3300031344 | Bacteria | 1528 |
| 182 | Ga0265316_10203575 | 3300031344 | Bacteria | 1466 |
| 183 | Ga0307408_100010466 | 3300031548 | Bacteria | 6115 |
| 184 | Ga0307408_100044564 | 3300031548 | Bacteria | 3162 |
| 185 | Ga0265313_10122177 | 3300031595 | Bacteria | 1135 |
| 186 | Ga0316575_10030305 | 3300031665 | Bacteria | 2114 |
| 187 | Ga0265314_10006988 | 3300031711 | Bacteria | 9872 |
| 188 | Ga0265314_10318496 | 3300031711 | Bacteria | 866 |
| 189 | Ga0265342_10018637 | 3300031712 | Bacteria | 4488 |
| 190 | Ga0265342_10536310 | 3300031712 | Bacteria | 594 |
| 191 | Ga0316576_10035561 | 3300031727 | Bacteria | 3556 |
| 192 | Ga0316576_10191294 | 3300031727 | Bacteria | 1542 |
| 193 | Ga0316578_10013590 | 3300031728 | Bacteria | 4322 |
| 194 | Ga0307405_10000703 | 3300031731 | Bacteria | 12993 |
| 195 | Ga0307413_10567245 | 3300031824 | Bacteria | 924 |
| 196 | Ga0307413_10983392 | 3300031824 | Bacteria | 722 |
| 197 | Ga0307410_10302614 | 3300031852 | Bacteria | 1262 |
| 198 | Ga0307410_10657087 | 3300031852 | Bacteria | 880 |
| 199 | Ga0307406_10002856 | 3300031901 | Bacteria | 9406 |
| 200 | Ga0307406_10066387 | 3300031901 | Bacteria | 2348 |
| 201 | Ga0307406_10456548 | 3300031901 | Bacteria | 1026 |
| 202 | Ga0307407_10174984 | 3300031903 | Bacteria | 1417 |
| 203 | Ga0307412_10081175 | 3300031911 | Bacteria | 2242 |
| 204 | Ga0307412_11390352 | 3300031911 | Bacteria | 635 |
| 205 | Ga0307409_100025273 | 3300031995 | Bacteria | 4161 |
| 206 | Ga0307416_100010142 | 3300032002 | Bacteria | 6209 |
| 207 | Ga0307416_100265316 | 3300032002 | Bacteria | 1681 |
| 208 | Ga0307416_100312084 | 3300032002 | Bacteria | 1570 |
| 209 | Ga0307411_11288890 | 3300032005 | Bacteria | 665 |
| 210 | Ga0307415_100055278 | 3300032126 | Bacteria | 2715 |
| 211 | Ga0307415_100089070 | 3300032126 | Bacteria | 2228 |
| 212 | Ga0307415_101788686 | 3300032126 | Bacteria | 594 |
| 213 | Ga0316585_10029518 | 3300032137 | Bacteria | 1717 |
| 214 | Ga0316580_10007098 | 3300032139 | Bacteria | 3325 |
| 215 | Ga0316588_1072889 | 3300033528 | Bacteria | 845 |
| 216 | Ga0373941_0146082 | 3300035115 | Bacteria | 864 |
| 217 | Ga0373945_0338093 | 3300035116 | Bacteria | 651 |
| 218 | Ga0373957_0340200 | 3300035120 | Bacteria | 640 |
| 219 | Ga0373960_0107129 | 3300035121 | Bacteria | 913 |
| 220 | Ga0373943_0434469 | 3300035170 | Bacteria | 761 |
| 221 | Ga0373943_0649289 | 3300035170 | Bacteria | 623 |
| 222 | Ga0373946_0155439 | 3300035171 | Bacteria | 1070 |
| 223 | Ga0373955_0334543 | 3300035172 | Bacteria | 916 |
| 224 | Ga0316574_0128792 | 3300035398 | Bacteria | 1628 |
| 225 | Ga0316574_0297689 | 3300035398 | Bacteria | 1026 |
| 226 | Ga0316574_0405226 | 3300035398 | Bacteria | 858 |
| 227 | Ga0316574_0540186 | 3300035398 | Bacteria | 724 |
| 228 | Ga0373931_0148259 | 3300035691 | Bacteria | 1365 |
| 229 | Ga0373933_0105349 | 3300035724 | Bacteria | 1754 |
| 230 | Ga0373933_0157090 | 3300035724 | Bacteria | 1443 |
| 231 | Ga0373947_0059869 | 3300035725 | Bacteria | 2310 |
| 232 | Ga0373947_0979420 | 3300035725 | Bacteria | 577 |
| 233 | Ga0373937_0667196 | 3300036401 | Bacteria | 986 |
| 234 | Ga0373937_1428642 | 3300036401 | Bacteria | 639 |
| 235 | Ga0316582_0132368 | 3300036647 | Bacteria | 1676 |
| 236 | Ga0316582_0201834 | 3300036647 | Bacteria | 1357 |
| 237 | Ga0316582_0251201 | 3300036647 | Bacteria | 1212 |
| 238 | Ga0316582_0265351 | 3300036647 | Bacteria | 1177 |
| 239 | Ga0316582_0279606 | 3300036647 | Bacteria | 1145 |
| 240 | Ga0316584_0007219 | 3300036712 | Bacteria | 7581 |
| 241 | Ga0316584_0064691 | 3300036712 | Bacteria | 2738 |
| 242 | Ga0316584_0068312 | 3300036712 | Bacteria | 2663 |
| 243 | Ga0316584_0138656 | 3300036712 | Bacteria | 1815 |
| 244 | Ga0316584_0391085 | 3300036712 | Bacteria | 992 |
| 245 | Ga0373925_0427070 | 3300037068 | Bacteria | 1083 |
| 246 | Ga0395899_0026680 | 3300037312 | Bacteria | 4358 |
| 247 | Ga0395899_0315319 | 3300037312 | Bacteria | 1055 |
| 248 | Ga0395898_0051869 | 3300037466 | Bacteria | 4009 |
| 249 | Ga0395898_0687101 | 3300037466 | Bacteria | 965 |
| 250 | Ga0395905_0236363 | 3300037471 | Bacteria | 1708 |
| 251 | Ga0316581_0149995 | 3300037588 | Bacteria | 719 |
| 252 | Ga0395901_0047032 | 3300038443 | Bacteria | 4482 |
| 253 | Ga0395901_0387095 | 3300038443 | Bacteria | 1438 |
| 254 | Ga0395901_2043160 | 3300038443 | Bacteria | 519 |
| 255 | Ga0439438_001013 | 3300041405 | Bacteria | 12531 |
| 256 | Ga0439447_000666 | 3300041407 | Bacteria | 12740 |
| 257 | Ga0439466_0002641 | 3300041411 | Bacteria | 7009 |
| 258 | Ga0439466_0106712 | 3300041411 | Bacteria | 870 |
| 259 | Ga0439465_0005161 | 3300041413 | Bacteria | 4191 |
| 260 | Ga0451800_1247482 | 3300041459 | Bacteria | 743 |
| 261 | Ga0451802_0496456 | 3300041460 | Bacteria | 606 |
| 262 | Ga0451849_0145583 | 3300041505 | Bacteria | 1099 |
| 263 | Ga0451851_0964593 | 3300041507 | Bacteria | 583 |
| 264 | Ga0451853_3038749 | 3300041512 | Bacteria | 522 |
| 265 | Ga0451853_3458816 | 3300041512 | Bacteria | 2308 |
| 266 | Ga0439448_0027212 | 3300042005 | Bacteria | 1801 |
| 267 | Ga0439432_010667 | 3300042006 | Bacteria | 3178 |
| 268 | Ga0439451_002482 | 3300042009 | Bacteria | 3740 |
| 269 | Ga0439451_002901 | 3300042009 | Bacteria | 3482 |
| 270 | Ga0439452_021999 | 3300042010 | Bacteria | 1654 |
| 271 | Ga0439454_089355 | 3300042011 | Bacteria | 568 |
| 272 | Ga0439456_000443 | 3300042013 | Bacteria | 9164 |
| 273 | Ga0439456_086210 | 3300042013 | Bacteria | 703 |
| 274 | Ga0439463_008507 | 3300042016 | Bacteria | 2529 |
| 275 | Ga0450911_000802 | 3300042115 | Bacteria | 8637 |
| 276 | Ga0450890_000175 | 3300042127 | Bacteria | 9686 |
| 277 | Ga0450903_000125 | 3300042138 | Bacteria | 16677 |
| 278 | Ga0450906_000150 | 3300042145 | Bacteria | 12876 |
| 279 | Ga0450907_000264 | 3300042146 | Bacteria | 17813 |
| 280 | Ga0450910_043876 | 3300042147 | Bacteria | 727 |
| 281 | Ga0439446_0000262 | 3300042156 | Bacteria | 9800 |
| 282 | Ga0450908_000323 | 3300042184 | Bacteria | 9397 |
| 283 | Ga0450909_000146 | 3300042185 | Bacteria | 7468 |
| 284 | Ga0439434_0004261 | 3300042435 | Bacteria | 4181 |
| 285 | Ga0439464_0001496 | 3300042439 | Bacteria | 5522 |
| 286 | Ga0439460_0015634 | 3300042461 | Bacteria | 2011 |
| 287 | Ga0439460_0068874 | 3300042461 | Bacteria | 1092 |
| 288 | Ga0451577_0000491 | 3300042876 | Bacteria | 67041 |
| 289 | Ga0451577_0007478 | 3300042876 | Bacteria | 10728 |
| 290 | Ga0451577_0011620 | 3300042876 | Bacteria | 8314 |
| 291 | Ga0451577_0037350 | 3300042876 | Bacteria | 4372 |
| 292 | Ga0451577_0064223 | 3300042876 | Bacteria | 3274 |
| 293 | Ga0451577_0140824 | 3300042876 | Bacteria | 2167 |
| 294 | Ga0451577_0188018 | 3300042876 | Bacteria | 1863 |
| 295 | Ga0451577_0306388 | 3300042876 | Bacteria | 1439 |
| 296 | Ga0451577_0491503 | 3300042876 | Bacteria | 1114 |
| 297 | Ga0451577_0656716 | 3300042876 | Bacteria | 951 |
| 298 | Ga0439440_0000067 | 3300042993 | Bacteria | 13146 |
| 299 | Ga0453683_0073361 | 3300044673 | Bacteria | 2142 |
| 300 | Ga0453683_0232474 | 3300044673 | Bacteria | 1173 |
| 301 | Ga0453684_0000176 | 3300044712 | Bacteria | 283097 |
| 302 | Ga0453684_0001325 | 3300044712 | Bacteria | 73132 |
| 303 | Ga0453684_0001444 | 3300044712 | Bacteria | 67679 |
| 304 | Ga0453684_0002706 | 3300044712 | Bacteria | 42066 |
| 305 | Ga0453684_0004431 | 3300044712 | Bacteria | 29651 |
| 306 | Ga0453684_0022734 | 3300044712 | Bacteria | 9286 |
| 307 | Ga0453684_0057653 | 3300044712 | Bacteria | 5024 |
| 308 | Ga0453684_0077750 | 3300044712 | Bacteria | 4156 |
| 309 | Ga0453684_0136906 | 3300044712 | Bacteria | 2930 |
| 310 | Ga0453684_0166280 | 3300044712 | Bacteria | 2603 |
| 311 | Ga0453684_0541964 | 3300044712 | Bacteria | 1283 |
| 312 | Ga0453684_0724825 | 3300044712 | Bacteria | 1078 |
| 313 | Ga0453684_1047084 | 3300044712 | Unclassified | 865 |
| 314 | Ga0451576_0009820 | 3300045051 | Bacteria | 11061 |
| 315 | Ga0451576_0084645 | 3300045051 | Bacteria | 3299 |
| 316 | Ga0451576_0109245 | 3300045051 | Bacteria | 2878 |
| 317 | Ga0451576_0125358 | 3300045051 | Bacteria | 2676 |
| 318 | Ga0451576_0296552 | 3300045051 | Bacteria | 1690 |
| 319 | Ga0451576_1113040 | 3300045051 | Bacteria | 826 |
| 320 | Ga0495617_000613 | 3300046452 | Bacteria | 17917 |
| 321 | Ga0495617_002742 | 3300046452 | Bacteria | 6811 |
| 322 | Ga0495617_003910 | 3300046452 | Bacteria | 5490 |
| 323 | Ga0495617_052845 | 3300046452 | Bacteria | 1349 |
| 324 | Ga0495627_042401 | 3300046453 | Bacteria | 1395 |
| 325 | Ga0495592_0060527 | 3300046454 | Bacteria | 2785 |
| 326 | Ga0495603_0000256 | 3300046455 | Bacteria | 27948 |
| 327 | Ga0495603_0193271 | 3300046455 | Bacteria | 1176 |
| 328 | Ga0495590_0000339 | 3300046457 | Bacteria | 24297 |
| 329 | Ga0495590_0007354 | 3300046457 | Bacteria | 4252 |
| 330 | Ga0495590_0013132 | 3300046457 | Bacteria | 3052 |
| 331 | Ga0495591_000266 | 3300046458 | Bacteria | 49608 |
| 332 | Ga0495591_097381 | 3300046458 | Bacteria | 732 |
| 333 | Ga0495629_0016696 | 3300046459 | Bacteria | 5268 |
| 334 | Ga0495638_0025626 | 3300046460 | Bacteria | 3830 |
| 335 | Ga0495638_0052167 | 3300046460 | Bacteria | 2548 |
| 336 | Ga0495651_0157474 | 3300046462 | Bacteria | 1631 |
| 337 | Ga0495653_0493811 | 3300046463 | Bacteria | 764 |
| 338 | Ga0495653_0511841 | 3300046463 | Bacteria | 747 |
| 339 | Ga0495650_0000531 | 3300046471 | Bacteria | 55413 |
| 340 | Ga0495650_0003945 | 3300046471 | Bacteria | 10454 |
| 341 | Ga0495650_0028492 | 3300046471 | Bacteria | 2562 |
| 342 | Ga0495582_0007727 | 3300046473 | Bacteria | 5944 |
| 343 | Ga0495605_0000526 | 3300046474 | Bacteria | 32322 |
| 344 | Ga0495605_0001754 | 3300046474 | Bacteria | 13901 |
| 345 | Ga0495605_0007320 | 3300046474 | Bacteria | 6269 |
| 346 | Ga0495605_0031768 | 3300046474 | Bacteria | 2694 |
| 347 | Ga0495605_0050064 | 3300046474 | Bacteria | 2039 |
| 348 | Ga0495605_0128959 | 3300046474 | Bacteria | 1141 |
| 349 | Ga0495639_0008154 | 3300046475 | Bacteria | 4498 |
| 350 | Ga0495662_0045390 | 3300046476 | Bacteria | 2121 |
| 351 | Ga0495584_0001430 | 3300046491 | Bacteria | 14368 |
| 352 | Ga0495584_0002117 | 3300046491 | Bacteria | 11362 |
| 353 | Ga0495584_0014843 | 3300046491 | Bacteria | 3970 |
| 354 | Ga0495584_0040286 | 3300046491 | Bacteria | 2358 |
| 355 | Ga0495584_0311391 | 3300046491 | Bacteria | 799 |
| 356 | Ga0495584_0343133 | 3300046491 | Bacteria | 758 |
| 357 | Ga0495585_0003604 | 3300046492 | Bacteria | 10382 |
| 358 | Ga0495585_0091794 | 3300046492 | Bacteria | 1634 |
| 359 | Ga0495585_0187634 | 3300046492 | Bacteria | 1059 |
| 360 | Ga0495594_0002357 | 3300046499 | Bacteria | 9835 |
| 361 | Ga0495594_0002788 | 3300046499 | Bacteria | 9066 |
| 362 | Ga0495607_0000637 | 3300046501 | Bacteria | 34042 |
| 363 | Ga0495607_0054893 | 3300046501 | Bacteria | 2294 |
| 364 | Ga0495607_0060485 | 3300046501 | Bacteria | 2155 |
| 365 | Ga0495607_0101490 | 3300046501 | Bacteria | 1540 |
| 366 | Ga0495583_0000921 | 3300046506 | Bacteria | 34568 |
| 367 | Ga0495583_0017824 | 3300046506 | Bacteria | 3757 |
| 368 | Ga0495583_0031567 | 3300046506 | Bacteria | 2567 |
| 369 | Ga0495583_0031659 | 3300046506 | Bacteria | 2561 |
| 370 | Ga0495583_0102598 | 3300046506 | Bacteria | 1219 |
| 371 | Ga0495606_0021952 | 3300046507 | Bacteria | 4667 |
| 372 | Ga0495606_0031391 | 3300046507 | Bacteria | 3694 |
| 373 | Ga0495606_0042204 | 3300046507 | Bacteria | 3052 |
| 374 | Ga0495608_0073084 | 3300046511 | Bacteria | 2236 |
| 375 | Ga0495608_0360385 | 3300046511 | Bacteria | 894 |
| 376 | Ga0495610_0067998 | 3300046512 | Bacteria | 1671 |
| 377 | Ga0495616_0000245 | 3300046513 | Bacteria | 44179 |
| 378 | Ga0495616_0001526 | 3300046513 | Bacteria | 15942 |
| 379 | Ga0495616_0026197 | 3300046513 | Bacteria | 3106 |
| 380 | Ga0495616_0131878 | 3300046513 | Bacteria | 1144 |
| 381 | Ga0495616_0422167 | 3300046513 | Bacteria | 544 |
| 382 | Ga0495618_0775290 | 3300046514 | Bacteria | 560 |
| 383 | Ga0495620_0002926 | 3300046515 | Bacteria | 9814 |
| 384 | Ga0495620_0026987 | 3300046515 | Bacteria | 2693 |
| 385 | Ga0495630_0003131 | 3300046517 | Bacteria | 11476 |
| 386 | Ga0495630_0144308 | 3300046517 | Bacteria | 1810 |
| 387 | Ga0495631_0000005 | 3300046518 | Bacteria | 159179 |
| 388 | Ga0495631_0006594 | 3300046518 | Bacteria | 5974 |
| 389 | Ga0495631_0020944 | 3300046518 | Bacteria | 3048 |
| 390 | Ga0495631_0168696 | 3300046518 | Bacteria | 939 |
| 391 | Ga0495632_0000166 | 3300046519 | Bacteria | 68543 |
| 392 | Ga0495632_0002218 | 3300046519 | Bacteria | 14977 |
| 393 | Ga0495632_0002362 | 3300046519 | Bacteria | 14436 |
| 394 | Ga0495637_0000440 | 3300046520 | Bacteria | 30318 |
| 395 | Ga0495637_0000804 | 3300046520 | Bacteria | 20840 |
| 396 | Ga0495637_0001706 | 3300046520 | Bacteria | 12687 |
| 397 | Ga0495637_0004378 | 3300046520 | Bacteria | 7325 |
| 398 | Ga0495637_0011362 | 3300046520 | Bacteria | 4281 |
| 399 | Ga0495643_0353435 | 3300046522 | Bacteria | 657 |
| 400 | Ga0495643_0465043 | 3300046522 | Bacteria | 548 |
| 401 | Ga0495644_0029822 | 3300046523 | Bacteria | 2060 |
| 402 | Ga0495648_0031213 | 3300046524 | Bacteria | 3511 |
| 403 | Ga0495648_0045833 | 3300046524 | Bacteria | 2716 |
| 404 | Ga0495648_0046838 | 3300046524 | Bacteria | 2677 |
| 405 | Ga0495648_0148046 | 3300046524 | Bacteria | 1227 |
| 406 | Ga0495648_0331568 | 3300046524 | Bacteria | 701 |
| 407 | Ga0495666_0013364 | 3300046526 | Bacteria | 4093 |
| 408 | Ga0495666_0063468 | 3300046526 | Bacteria | 1763 |
| 409 | Ga0495642_0000016 | 3300046528 | Bacteria | 114282 |
| 410 | Ga0495642_0001529 | 3300046528 | Bacteria | 10268 |
| 411 | Ga0495652_0188854 | 3300046529 | Bacteria | 1574 |
| 412 | Ga0495654_0012576 | 3300046530 | Bacteria | 4542 |
| 413 | Ga0495654_0016537 | 3300046530 | Bacteria | 3897 |
| 414 | Ga0495654_0017220 | 3300046530 | Bacteria | 3803 |
| 415 | Ga0495654_0017344 | 3300046530 | Bacteria | 3787 |
| 416 | Ga0495654_0072543 | 3300046530 | Bacteria | 1629 |
| 417 | Ga0495654_0174176 | 3300046530 | Bacteria | 936 |
| 418 | Ga0495640_0080680 | 3300046533 | Bacteria | 2163 |
| 419 | Ga0495640_0352524 | 3300046533 | Bacteria | 908 |
| 420 | Ga0495586_0004702 | 3300046535 | Bacteria | 7299 |
| 421 | Ga0495586_0040651 | 3300046535 | Bacteria | 2503 |
| 422 | Ga0495587_0000877 | 3300046536 | Bacteria | 19880 |
| 423 | Ga0495609_0000186 | 3300046538 | Bacteria | 62251 |
| 424 | Ga0495609_0001638 | 3300046538 | Bacteria | 14592 |
| 425 | Ga0495597_0011750 | 3300046542 | Bacteria | 4239 |
| 426 | Ga0495597_0016091 | 3300046542 | Bacteria | 3536 |
| 427 | Ga0495597_0066164 | 3300046542 | Bacteria | 1566 |
| 428 | Ga0495597_0134012 | 3300046542 | Bacteria | 1025 |
| 429 | Ga0495622_0060030 | 3300046557 | Bacteria | 1760 |
| 430 | Ga0495622_0060449 | 3300046557 | Bacteria | 1754 |
| 431 | Ga0495622_0067344 | 3300046557 | Bacteria | 1654 |
| 432 | Ga0495633_0001867 | 3300046558 | Bacteria | 15451 |
| 433 | Ga0495633_0011205 | 3300046558 | Bacteria | 4850 |
| 434 | Ga0495633_0218800 | 3300046558 | Bacteria | 872 |
| 435 | Ga0495667_0045894 | 3300046559 | Bacteria | 2890 |
| 436 | Ga0495667_0068510 | 3300046559 | Bacteria | 2317 |
| 437 | Ga0495667_0862348 | 3300046559 | Bacteria | 556 |
| 438 | Ga0495656_0000395 | 3300046615 | Bacteria | 14474 |
| 439 | Ga0495656_0024969 | 3300046615 | Bacteria | 2365 |
| 440 | Ga0495668_0112920 | 3300046616 | Bacteria | 1486 |
| 441 | Ga0495668_0702680 | 3300046616 | Bacteria | 559 |
| 442 | Ga0495634_0065328 | 3300046642 | Bacteria | 2412 |
| 443 | Ga0495634_0289089 | 3300046642 | Bacteria | 994 |
| 444 | Ga0495611_0412822 | 3300046648 | Bacteria | 616 |
| 445 | Ga0495625_0005814 | 3300046660 | Bacteria | 11130 |
| 446 | Ga0495625_0007010 | 3300046660 | Bacteria | 9923 |
| 447 | Ga0495625_0011080 | 3300046660 | Bacteria | 7385 |
| 448 | Ga0495625_0103755 | 3300046660 | Bacteria | 1949 |
| 449 | Ga0495625_0201910 | 3300046660 | Bacteria | 1311 |
| 450 | Ga0495625_0338195 | 3300046660 | Bacteria | 954 |
| 451 | Ga0495635_0000594 | 3300046663 | Bacteria | 23281 |
| 452 | Ga0495659_0000335 | 3300046664 | Bacteria | 18557 |
| 453 | Ga0495659_0002744 | 3300046664 | Bacteria | 5662 |
| 454 | Ga0495659_0121412 | 3300046664 | Bacteria | 1029 |
| 455 | Ga0495661_0001171 | 3300046665 | Bacteria | 22887 |
| 456 | Ga0495661_0075198 | 3300046665 | Bacteria | 1963 |
| 457 | Ga0495661_0165283 | 3300046665 | Bacteria | 1184 |
| 458 | Ga0495588_0019674 | 3300046674 | Bacteria | 3309 |
| 459 | Ga0495599_0064397 | 3300046678 | Bacteria | 2290 |
| 460 | Ga0495623_0089739 | 3300046679 | Bacteria | 1889 |
| 461 | Ga0495646_0006790 | 3300046680 | Bacteria | 7260 |
| 462 | Ga0495669_0001951 | 3300046684 | Bacteria | 8476 |
| 463 | Ga0495669_0247177 | 3300046684 | Bacteria | 856 |
| 464 | Ga0495669_0400030 | 3300046684 | Bacteria | 665 |
| 465 | Ga0495613_0053677 | 3300046689 | Bacteria | 2964 |
| 466 | Ga0495670_0000215 | 3300046691 | Bacteria | 26202 |
| 467 | Ga0495670_0055484 | 3300046691 | Bacteria | 1986 |
| 468 | Ga0495670_0108359 | 3300046691 | Bacteria | 1436 |
| 469 | Ga0495670_0621826 | 3300046691 | Bacteria | 588 |
| 470 | Ga0495670_0833621 | 3300046691 | Bacteria | 503 |
| 471 | Ga0495671_0091763 | 3300046692 | Bacteria | 1486 |
| 472 | Ga0495671_0203276 | 3300046692 | Bacteria | 960 |
| 473 | Ga0495671_0477053 | 3300046692 | Bacteria | 595 |
| 474 | Ga0495649_0000086 | 3300046694 | Bacteria | 80528 |
| 475 | Ga0495649_0001882 | 3300046694 | Bacteria | 15353 |
| 476 | Ga0495649_0016341 | 3300046694 | Bacteria | 4206 |
| 477 | Ga0495649_0056999 | 3300046694 | Bacteria | 2107 |
| 478 | Ga0495649_0109500 | 3300046694 | Bacteria | 1465 |
| 479 | Ga0495649_0144826 | 3300046694 | Bacteria | 1249 |
| 480 | Ga0495589_0000636 | 3300046794 | Bacteria | 23067 |
| 481 | Ga0495589_0000799 | 3300046794 | Bacteria | 19935 |
| 482 | Ga0495589_0008326 | 3300046794 | Bacteria | 5417 |
| 483 | Ga0495589_0065008 | 3300046794 | Bacteria | 1788 |
| 484 | Ga0495600_0002600 | 3300046809 | Bacteria | 10405 |
| 485 | Ga0495600_0235469 | 3300046809 | Bacteria | 1168 |
| 486 | Ga0495660_0055284 | 3300046810 | Bacteria | 2149 |
| 487 | Ga0495660_0120606 | 3300046810 | Bacteria | 1327 |
| 488 | Ga0495581_0010345 | 3300047315 | Bacteria | 5398 |
| 489 | Ga0495581_0021045 | 3300047315 | Bacteria | 3783 |
| 490 | Ga0495604_0001248 | 3300047317 | Bacteria | 20850 |
| 491 | Ga0495604_0186990 | 3300047317 | Bacteria | 1446 |
| 492 | Ga0495636_0001197 | 3300047318 | Bacteria | 9805 |
| 493 | Ga0495636_0043209 | 3300047318 | Bacteria | 1874 |
| 494 | Ga0495674_0545469 | 3300047319 | Bacteria | 923 |
| 495 | Ga0495674_0620722 | 3300047319 | Bacteria | 855 |
| 496 | Ga0495672_0001126 | 3300047320 | Bacteria | 27097 |
| 497 | Ga0495672_0007895 | 3300047320 | Bacteria | 7937 |
| 498 | Ga0495672_0010752 | 3300047320 | Bacteria | 6495 |
| 499 | Ga0495672_0040511 | 3300047320 | Bacteria | 2824 |
| 500 | Ga0495672_0357778 | 3300047320 | Bacteria | 676 |
| 501 | Ga0495672_0392912 | 3300047320 | Bacteria | 636 |
| 502 | Ga0495676_0065572 | 3300047321 | Bacteria | 2818 |
| 503 | Ga0495676_0070380 | 3300047321 | Bacteria | 2695 |
| 504 | Ga0495680_0000029 | 3300047322 | Bacteria | 112033 |
| 505 | Ga0495680_0065586 | 3300047322 | Bacteria | 2780 |
| 506 | Ga0495680_0358077 | 3300047322 | Bacteria | 1015 |
| 507 | Ga0495683_0000010 | 3300047323 | Bacteria | 223494 |
| 508 | Ga0495683_0003697 | 3300047323 | Bacteria | 8858 |
| 509 | Ga0495683_0047247 | 3300047323 | Bacteria | 2160 |
| 510 | Ga0495683_0059918 | 3300047323 | Bacteria | 1887 |
| 511 | Ga0495687_001073 | 3300047443 | Bacteria | 26922 |
| 512 | Ga0495687_008040 | 3300047443 | Bacteria | 6095 |
| 513 | Ga0495677_0000135 | 3300047445 | Bacteria | 35127 |
| 514 | Ga0495685_066449 | 3300047447 | Bacteria | 1211 |
| 515 | Ga0495685_091689 | 3300047447 | Bacteria | 1007 |
| 516 | Ga0495673_0000636 | 3300047469 | Bacteria | 34509 |
| 517 | Ga0495673_0001177 | 3300047469 | Bacteria | 22089 |
| 518 | Ga0495673_0011065 | 3300047469 | Bacteria | 4876 |
| 519 | Ga0495673_0039221 | 3300047469 | Bacteria | 2149 |
| 520 | Ga0495673_0113182 | 3300047469 | Bacteria | 1082 |
| 521 | Ga0495681_0001131 | 3300047470 | Bacteria | 20285 |
| 522 | Ga0495681_0024464 | 3300047470 | Bacteria | 3181 |
| 523 | Ga0495681_0035207 | 3300047470 | Bacteria | 2488 |
| 524 | Ga0495684_0030723 | 3300047471 | Bacteria | 4124 |
| 525 | Ga0495684_0435012 | 3300047471 | Bacteria | 915 |
| 526 | Ga0495686_0126370 | 3300047472 | Bacteria | 1520 |
| 527 | Ga0495686_0127953 | 3300047472 | Bacteria | 1508 |
| 528 | Ga0495593_0025192 | 3300047673 | Bacteria | 3292 |
| 529 | Ga0495593_0090783 | 3300047673 | Bacteria | 1573 |
| 530 | Ga0495602_0164527 | 3300048088 | Bacteria | 1728 |
| 531 | Ga0495602_0892779 | 3300048088 | Bacteria | 592 |
| 532 | Ga0495626_0000490 | 3300048091 | Bacteria | 39851 |
| 533 | Ga0495626_0000538 | 3300048091 | Bacteria | 37687 |
| 534 | Ga0495626_0001424 | 3300048091 | Bacteria | 19061 |
| 535 | Ga0495626_0003448 | 3300048091 | Bacteria | 10135 |
| 536 | Ga0495626_0262682 | 3300048091 | Bacteria | 689 |
| 537 | Ga0496101_0094024 | 3300048904 | Bacteria | 2234 |
| 538 | Ga0496102_1218807 | 3300048905 | Bacteria | 672 |
| 539 | Ga0496103_0086413 | 3300048906 | Bacteria | 1977 |
| 540 | Ga0496104_0624649 | 3300048907 | Bacteria | 987 |
| 541 | Ga0496104_1528359 | 3300048907 | Bacteria | 570 |
| 542 | Ga0496106_1029961 | 3300048909 | Unclassified | 647 |
| 543 | Ga0496108_0032403 | 3300048911 | Bacteria | 4341 |
| 544 | Ga0496109_0260113 | 3300048912 | Bacteria | 1635 |
| 545 | Ga0496109_0954387 | 3300048912 | Bacteria | 795 |
| 546 | Ga0496110_0047289 | 3300048913 | Bacteria | 3767 |
| 547 | Ga0496110_0824045 | 3300048913 | Bacteria | 833 |
| 548 | Ga0496111_0688967 | 3300048914 | Bacteria | 744 |
| 549 | Ga0496111_1105862 | 3300048914 | Bacteria | 565 |
| 550 | Ga0496112_0025482 | 3300048915 | Bacteria | 5679 |
| 551 | Ga0496112_0234120 | 3300048915 | Unclassified | 1791 |
| 552 | Ga0496114_0001978 | 3300048917 | Bacteria | 15574 |
| 553 | Ga0496115_0147652 | 3300048918 | Bacteria | 1941 |
| 554 | Ga0496116_0039501 | 3300048919 | Bacteria | 3262 |
| 555 | Ga0496117_0001581 | 3300048920 | Bacteria | 32312 |
| 556 | Ga0496117_0296429 | 3300048920 | Bacteria | 858 |
| 557 | Ga0496118_0178580 | 3300048921 | Bacteria | 1286 |
| 558 | Ga0496121_0059938 | 3300048924 | Bacteria | 3135 |
| 559 | Ga0496121_0704775 | 3300048924 | Bacteria | 607 |
| 560 | Ga0496122_0005168 | 3300048925 | Bacteria | 15704 |
| 561 | Ga0496123_0026923 | 3300048926 | Bacteria | 4295 |
| 562 | Ga0496124_0190285 | 3300048927 | Bacteria | 1571 |
| 563 | Ga0496125_0007781 | 3300048928 | Bacteria | 11337 |
| 564 | Ga0496125_0053077 | 3300048928 | Bacteria | 3327 |
| 565 | Ga0496125_0217674 | 3300048928 | Bacteria | 1233 |
| 566 | Ga0496126_0091173 | 3300048929 | Bacteria | 2680 |
| 567 | Ga0495678_000437 | 3300049459 | Bacteria | 41568 |
| 568 | Ga0495678_001452 | 3300049459 | Bacteria | 18640 |
| 569 | Ga0495678_005908 | 3300049459 | Bacteria | 6624 |
| 570 | Ga0495678_017731 | 3300049459 | Bacteria | 3217 |
| 571 | Ga0495678_055284 | 3300049459 | Bacteria | 1515 |
| 572 | Ga0495678_087205 | 3300049459 | Bacteria | 1107 |
| 573 | Ga0495678_173180 | 3300049459 | Bacteria | 681 |
| 574 | Ga0495682_0000307 | 3300049460 | Bacteria | 36956 |
| 575 | Ga0495682_0003264 | 3300049460 | Bacteria | 7256 |
| 576 | Ga0495682_0060363 | 3300049460 | Bacteria | 1369 |
| 577 | Ga0495682_0062615 | 3300049460 | Bacteria | 1342 |
| 578 | Ga0495682_0088657 | 3300049460 | Bacteria | 1111 |
| 579 | Ga0495682_0203071 | 3300049460 | Bacteria | 702 |
| 580 | Ga0495682_0295538 | 3300049460 | Bacteria | 571 |
| 581 | Ga0501031_0048591 | 3300049568 | Bacteria | 2764 |
| 582 | Ga0501031_0346655 | 3300049568 | Bacteria | 961 |
| 583 | Ga0501032_0144665 | 3300049569 | Bacteria | 1565 |
| 584 | Ga0501033_0085887 | 3300049570 | Bacteria | 2304 |
| 585 | Ga0501034_0487932 | 3300049571 | Bacteria | 1147 |
| 586 | Ga0501036_0027179 | 3300049572 | Bacteria | 4834 |
| 587 | Ga0501036_0326028 | 3300049572 | Bacteria | 1283 |
| 588 | Ga0501036_1139927 | 3300049572 | Bacteria | 636 |
| 589 | Ga0501038_0005503 | 3300049574 | Bacteria | 11759 |
| 590 | Ga0501038_1243853 | 3300049574 | Bacteria | 539 |
| 591 | Ga0501039_0011483 | 3300049575 | Bacteria | 6741 |
| 592 | Ga0501039_0110947 | 3300049575 | Bacteria | 2144 |
| 593 | Ga0501039_0317994 | 3300049575 | Bacteria | 1224 |
| 594 | Ga0501040_0019453 | 3300049576 | Bacteria | 4516 |
| 595 | Ga0501040_0022127 | 3300049576 | Bacteria | 4253 |
| 596 | Ga0501040_0310076 | 3300049576 | Bacteria | 1128 |
| 597 | Ga0501041_0006386 | 3300049577 | Bacteria | 6898 |
| 598 | Ga0501041_0038855 | 3300049577 | Bacteria | 2887 |
| 599 | Ga0501041_0405259 | 3300049577 | Bacteria | 864 |
| 600 | Ga0501041_0675931 | 3300049577 | Bacteria | 660 |
| 601 | Ga0501042_0014313 | 3300049578 | Bacteria | 5414 |
| 602 | Ga0501042_0089203 | 3300049578 | Bacteria | 2212 |
| 603 | Ga0501042_0143663 | 3300049578 | Bacteria | 1721 |
| 604 | Ga0501042_0163274 | 3300049578 | Bacteria | 1607 |
| 605 | Ga0501043_0077243 | 3300049579 | Bacteria | 2616 |
| 606 | Ga0501046_0009891 | 3300049580 | Bacteria | 8216 |
| 607 | Ga0501048_0034389 | 3300049582 | Bacteria | 3656 |
| 608 | Ga0501048_0179871 | 3300049582 | Bacteria | 1499 |
| 609 | Ga0501048_0997506 | 3300049582 | Bacteria | 602 |
| 610 | Ga0501067_0148152 | 3300049583 | Bacteria | 1308 |
| 611 | Ga0501068_0014758 | 3300049584 | Bacteria | 4470 |
| 612 | Ga0501068_0445548 | 3300049584 | Bacteria | 837 |
| 613 | Ga0501069_0003746 | 3300049585 | Bacteria | 7815 |
| 614 | Ga0501069_0186041 | 3300049585 | Bacteria | 1201 |
| 615 | Ga0501070_0017298 | 3300049586 | Bacteria | 6054 |
| 616 | Ga0501071_0006205 | 3300049587 | Bacteria | 7751 |
| 617 | Ga0501071_0103177 | 3300049587 | Bacteria | 2103 |
| 618 | Ga0501071_0166963 | 3300049587 | Bacteria | 1647 |
| 619 | Ga0501071_1261268 | 3300049587 | Bacteria | 571 |
| 620 | Ga0501072_0023058 | 3300049588 | Bacteria | 4833 |
| 621 | Ga0501072_0062578 | 3300049588 | Bacteria | 2935 |
| 622 | Ga0501072_0189268 | 3300049588 | Bacteria | 1641 |
| 623 | Ga0501073_0053832 | 3300049589 | Bacteria | 2817 |
| 624 | Ga0501074_0025433 | 3300049590 | Bacteria | 4300 |
| 625 | Ga0501074_0183324 | 3300049590 | Bacteria | 1493 |
| 626 | Ga0501074_0197339 | 3300049590 | Bacteria | 1434 |
| 627 | Ga0501075_0021672 | 3300049591 | Bacteria | 4686 |
| 628 | Ga0501075_0067834 | 3300049591 | Bacteria | 2693 |
| 629 | Ga0501075_0277467 | 3300049591 | Bacteria | 1277 |
| 630 | Ga0501075_0319583 | 3300049591 | Bacteria | 1183 |
| 631 | Ga0501075_0669252 | 3300049591 | Bacteria | 791 |
| 632 | Ga0501076_0006382 | 3300049592 | Bacteria | 8553 |
| 633 | Ga0501076_0011226 | 3300049592 | Bacteria | 6669 |
| 634 | Ga0501076_0033778 | 3300049592 | Bacteria | 3994 |
| 635 | Ga0501076_1581429 | 3300049592 | Bacteria | 538 |
| 636 | Ga0501077_0010374 | 3300049593 | Bacteria | 5797 |
| 637 | Ga0501077_0035094 | 3300049593 | Bacteria | 3193 |
| 638 | Ga0501209_184714 | 3300049656 | Bacteria | 637 |
| 639 | Ga0501243_017374 | 3300049675 | Bacteria | 1167 |
| 640 | Ga0501079_0006833 | 3300049741 | Bacteria | 8589 |
| 641 | Ga0501079_0013918 | 3300049741 | Bacteria | 6136 |
| 642 | Ga0501079_0042123 | 3300049741 | Bacteria | 3527 |
| 643 | Ga0501079_0078197 | 3300049741 | Bacteria | 2559 |
| 644 | Ga0501080_0094801 | 3300049742 | Bacteria | 2772 |
| 645 | Ga0501080_0285972 | 3300049742 | Bacteria | 1498 |
| 646 | Ga0501080_0668574 | 3300049742 | Bacteria | 918 |
| 647 | Ga0501080_1461672 | 3300049742 | Bacteria | 582 |
| 648 | Ga0501081_0072094 | 3300049743 | Bacteria | 2408 |
| 649 | Ga0501081_0540740 | 3300049743 | Bacteria | 870 |
| 650 | Ga0501083_0018187 | 3300049744 | Bacteria | 4898 |
| 651 | Ga0501083_0283768 | 3300049744 | Bacteria | 1077 |
| 652 | Ga0501083_0469649 | 3300049744 | Bacteria | 819 |
| 653 | Ga0501035_0028926 | 3300049822 | Bacteria | 5056 |
| 654 | Ga0501044_0150579 | 3300049823 | Bacteria | 2309 |
| 655 | Ga0501045_0020247 | 3300049824 | Bacteria | 4750 |
| 656 | Ga0501045_0029882 | 3300049824 | Bacteria | 3940 |
| 657 | Ga0501045_0163670 | 3300049824 | Bacteria | 1656 |
| 658 | Ga0501045_0299004 | 3300049824 | Bacteria | 1198 |
| 659 | Ga0501045_0319609 | 3300049824 | Bacteria | 1155 |
| 660 | nmdc:mga05p37_1828234_c1 | 3300050507 | Bacteria | 584 |
| 661 | nmdc:mga05p37_28870_c1 | 3300050507 | Bacteria | 6766 |
| 662 | nmdc:mga08y16_2087303_c1 | 3300050511 | Bacteria | 515 |
| 663 | nmdc:mga0n895_12219_c1 | 3300050512 | Bacteria | 7694 |
| 664 | nmdc:mga08x19_105717_c1 | 3300050514 | Bacteria | 1872 |
| 665 | Ga0495601_0187956 | 3300053077 | Bacteria | 1350 |
| 666 | Ga0495601_0614307 | 3300053077 | Bacteria | 697 |
| 667 | Ga0495612_0117115 | 3300053078 | Bacteria | 1144 |
| 668 | Ga0495595_0113479 | 3300053084 | Bacteria | 1316 |
| 669 | Ga0495595_0176113 | 3300053084 | Bacteria | 1060 |
| 670 | Ga0495619_0014093 | 3300053085 | Bacteria | 5046 |
| 671 | Ga0495619_0391137 | 3300053085 | Bacteria | 960 |
| 672 | Ga0495619_0635373 | 3300053085 | Bacteria | 729 |
| 673 | Ga0495619_0723090 | 3300053085 | Bacteria | 676 |
| 674 | Ga0500643_000341 | 3300053087 | Bacteria | 37015 |
| 675 | Ga0501084_0011960 | 3300054114 | Bacteria | 7186 |
| 676 | Ga0501084_0020787 | 3300054114 | Bacteria | 5475 |
| 677 | Ga0501084_0025627 | 3300054114 | Bacteria | 4918 |
| 678 | Ga0501082_0007671 | 3300060353 | Bacteria | 9314 |
| 679 | Ga0501082_0337351 | 3300060353 | Bacteria | 1313 |
| 680 | Ga0501082_0447091 | 3300060353 | Bacteria | 1129 |
| 681 | Ga0530510_0014617 | 3300061734 | Bacteria | 5540 |
| 682 | Ga0530510_0181195 | 3300061734 | Bacteria | 1562 |
| 683 | Ga0530510_0531451 | 3300061734 | Bacteria | 892 |
| 684 | Ga0530510_1288209 | 3300061734 | Bacteria | 560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053087 | Ga0500643_000341 | Ga0500643_000341_12308_12652 | 112 |
| 2 | 3300005435 | Ga0070714_100810961 | Ga0070714_1008109612 | 113 |
| 3 | 3300005546 | Ga0070696_100588205 | Ga0070696_1005882051 | 113 |
| 4 | 3300009545 | Ga0105237_10334012 | Ga0105237_103340121 | 113 |
| 5 | 3300010375 | Ga0105239_10391863 | Ga0105239_103918634 | 113 |
| 6 | 3300013306 | Ga0163162_12659815 | Ga0163162_126598152 | 113 |
| 7 | 3300025937 | Ga0207669_10727246 | Ga0207669_107272461 | 113 |
| 8 | 3300026089 | Ga0207648_11422241 | Ga0207648_114222411 | 113 |
| 9 | 3300028556 | Ga0265337_1005753 | Ga0265337_10057535 | 113 |
| 10 | 3300042876 | Ga0451577_0007478 | Ga0451577_0007478_2285_2626 | 113 |
| 11 | 3300044712 | Ga0453684_0000176 | Ga0453684_0000176_231324_231665 | 113 |
| 12 | 3300045051 | Ga0451576_0125358 | Ga0451576_0125358_1915_2256 | 113 |
| 13 | 3300046642 | Ga0495634_0065328 | Ga0495634_0065328_882_1223 | 113 |
| 14 | 3300047321 | Ga0495676_0070380 | Ga0495676_0070380_313_654 | 113 |
| 15 | 3300049742 | Ga0501080_1461672 | Ga0501080_1461672_116_457 | 113 |
| 16 | 3300053084 | Ga0495595_0113479 | Ga0495595_0113479_795_1136 | 113 |
| 17 | 2124908027 | MRS2a_Contig_7184 | MRS2a_00084540 | 114 |
| 18 | 2124908027 | MRS2a_Contig_735 | MRS2a_00592480 | 114 |
| 19 | 2162886007 | SwRhRL2b_contig_974593 | SwRhRL2b_0638.00004530 | 114 |
| 20 | 3300003578 | Ga0006562J51391_1018001 | Ga0006562J51391_10180011 | 114 |
| 21 | 3300004801 | Ga0058860_12119322 | Ga0058860_121193221 | 114 |
| 22 | 3300005288 | Ga0065714_10319798 | Ga0065714_103197981 | 114 |
| 23 | 3300005293 | Ga0065715_10144632 | Ga0065715_101446322 | 114 |
| 24 | 3300005327 | Ga0070658_10131006 | Ga0070658_101310064 | 114 |
| 25 | 3300005328 | Ga0070676_10134016 | Ga0070676_101340162 | 114 |
| 26 | 3300005329 | Ga0070683_100018314 | Ga0070683_1000183144 | 114 |
| 27 | 3300005329 | Ga0070683_100070062 | Ga0070683_1000700623 | 114 |
| 28 | 3300005329 | Ga0070683_101148749 | Ga0070683_1011487492 | 114 |
| 29 | 3300005336 | Ga0070680_101659160 | Ga0070680_1016591602 | 114 |
| 30 | 3300005337 | Ga0070682_100047913 | Ga0070682_1000479133 | 114 |
| 31 | 3300005340 | Ga0070689_100302389 | Ga0070689_1003023893 | 114 |
| 32 | 3300005344 | Ga0070661_100054711 | Ga0070661_1000547113 | 114 |
| 33 | 3300005344 | Ga0070661_100565448 | Ga0070661_1005654482 | 114 |
| 34 | 3300005347 | Ga0070668_100128389 | Ga0070668_1001283892 | 114 |
| 35 | 3300005355 | Ga0070671_100308466 | Ga0070671_1003084662 | 114 |
| 36 | 3300005356 | Ga0070674_100005238 | Ga0070674_1000052383 | 114 |
| 37 | 3300005356 | Ga0070674_100512866 | Ga0070674_1005128662 | 114 |
| 38 | 3300005367 | Ga0070667_100422406 | Ga0070667_1004224062 | 114 |
| 39 | 3300005435 | Ga0070714_100238001 | Ga0070714_1002380012 | 114 |
| 40 | 3300005435 | Ga0070714_100736248 | Ga0070714_1007362481 | 114 |
| 41 | 3300005438 | Ga0070701_10720222 | Ga0070701_107202221 | 114 |
| 42 | 3300005440 | Ga0070705_100150622 | Ga0070705_1001506222 | 114 |
| 43 | 3300005440 | Ga0070705_100812651 | Ga0070705_1008126512 | 114 |
| 44 | 3300005444 | Ga0070694_100441168 | Ga0070694_1004411681 | 114 |
| 45 | 3300005456 | Ga0070678_100123621 | Ga0070678_1001236212 | 114 |
| 46 | 3300005458 | Ga0070681_10021936 | Ga0070681_100219362 | 114 |
| 47 | 3300005459 | Ga0068867_100727925 | Ga0068867_1007279252 | 114 |
| 48 | 3300005466 | Ga0070685_10818577 | Ga0070685_108185772 | 114 |
| 49 | 3300005535 | Ga0070684_100009533 | Ga0070684_1000095333 | 114 |
| 50 | 3300005535 | Ga0070684_101489452 | Ga0070684_1014894521 | 114 |
| 51 | 3300005536 | Ga0070697_100251111 | Ga0070697_1002511112 | 114 |
| 52 | 3300005543 | Ga0070672_100129839 | Ga0070672_1001298393 | 114 |
| 53 | 3300005545 | Ga0070695_100348229 | Ga0070695_1003482291 | 114 |
| 54 | 3300005546 | Ga0070696_100040092 | Ga0070696_1000400922 | 114 |
| 55 | 3300005546 | Ga0070696_101485845 | Ga0070696_1014858451 | 114 |
| 56 | 3300005546 | Ga0070696_101528144 | Ga0070696_1015281441 | 114 |
| 57 | 3300005548 | Ga0070665_100001218 | Ga0070665_10000121815 | 114 |
| 58 | 3300005548 | Ga0070665_100043339 | Ga0070665_1000433392 | 114 |
| 59 | 3300005549 | Ga0070704_100387488 | Ga0070704_1003874882 | 114 |
| 60 | 3300005549 | Ga0070704_100641789 | Ga0070704_1006417891 | 114 |
| 61 | 3300005564 | Ga0070664_100000674 | Ga0070664_10000067412 | 114 |
| 62 | 3300005564 | Ga0070664_101391985 | Ga0070664_1013919852 | 114 |
| 63 | 3300005578 | Ga0068854_100194277 | Ga0068854_1001942773 | 114 |
| 64 | 3300005615 | Ga0070702_101492291 | Ga0070702_1014922911 | 114 |
| 65 | 3300005616 | Ga0068852_101349404 | Ga0068852_1013494042 | 114 |
| 66 | 3300005617 | Ga0068859_101344144 | Ga0068859_1013441442 | 114 |
| 67 | 3300005719 | Ga0068861_101186331 | Ga0068861_1011863312 | 114 |
| 68 | 3300005841 | Ga0068863_100047720 | Ga0068863_1000477205 | 114 |
| 69 | 3300005841 | Ga0068863_101673403 | Ga0068863_1016734032 | 114 |
| 70 | 3300005843 | Ga0068860_100494291 | Ga0068860_1004942912 | 114 |
| 71 | 3300005844 | Ga0068862_100776677 | Ga0068862_1007766772 | 114 |
| 72 | 3300005844 | Ga0068862_101036645 | Ga0068862_1010366452 | 114 |
| 73 | 3300006058 | Ga0075432_10000086 | Ga0075432_100000864 | 114 |
| 74 | 3300006844 | Ga0075428_101926837 | Ga0075428_1019268372 | 114 |
| 75 | 3300006852 | Ga0075433_11677197 | Ga0075433_116771971 | 114 |
| 76 | 3300006871 | Ga0075434_100019668 | Ga0075434_1000196683 | 114 |
| 77 | 3300006914 | Ga0075436_100102834 | Ga0075436_1001028342 | 114 |
| 78 | 3300006931 | Ga0097620_101344140 | Ga0097620_1013441402 | 114 |
| 79 | 3300009036 | Ga0105244_10442256 | Ga0105244_104422561 | 114 |
| 80 | 3300009092 | Ga0105250_10302955 | Ga0105250_103029552 | 114 |
| 81 | 3300009093 | Ga0105240_10015390 | Ga0105240_100153907 | 114 |
| 82 | 3300009093 | Ga0105240_10428764 | Ga0105240_104287644 | 114 |
| 83 | 3300009098 | Ga0105245_10040933 | Ga0105245_100409335 | 114 |
| 84 | 3300009098 | Ga0105245_10272063 | Ga0105245_102720634 | 114 |
| 85 | 3300009147 | Ga0114129_10033074 | Ga0114129_100330742 | 114 |
| 86 | 3300009147 | Ga0114129_12774695 | Ga0114129_127746952 | 114 |
| 87 | 3300009148 | Ga0105243_11779898 | Ga0105243_117798981 | 114 |
| 88 | 3300009176 | Ga0105242_10536006 | Ga0105242_105360062 | 114 |
| 89 | 3300009176 | Ga0105242_10581894 | Ga0105242_105818941 | 114 |
| 90 | 3300009545 | Ga0105237_11448005 | Ga0105237_114480052 | 114 |
| 91 | 3300009553 | Ga0105249_10062257 | Ga0105249_100622574 | 114 |
| 92 | 3300010375 | Ga0105239_13124259 | Ga0105239_131242591 | 114 |
| 93 | 3300011119 | Ga0105246_10372626 | Ga0105246_103726262 | 114 |
| 94 | 3300011119 | Ga0105246_10418803 | Ga0105246_104188033 | 114 |
| 95 | 3300011119 | Ga0105246_10741793 | Ga0105246_107417932 | 114 |
| 96 | 3300011119 | Ga0105246_12208178 | Ga0105246_122081782 | 114 |
| 97 | 3300012478 | Ga0157328_1008953 | Ga0157328_10089532 | 114 |
| 98 | 3300013100 | Ga0157373_10337198 | Ga0157373_103371982 | 114 |
| 99 | 3300013105 | Ga0157369_10317302 | Ga0157369_103173022 | 114 |
| 100 | 3300013105 | Ga0157369_10394703 | Ga0157369_103947032 | 114 |
| 101 | 3300013296 | Ga0157374_10126997 | Ga0157374_101269973 | 114 |
| 102 | 3300013297 | Ga0157378_10380623 | Ga0157378_103806233 | 114 |
| 103 | 3300013297 | Ga0157378_10544232 | Ga0157378_105442322 | 114 |
| 104 | 3300013306 | Ga0163162_12095936 | Ga0163162_120959362 | 114 |
| 105 | 3300013307 | Ga0157372_10014769 | Ga0157372_1001476910 | 114 |
| 106 | 3300013307 | Ga0157372_10854950 | Ga0157372_108549501 | 114 |
| 107 | 3300013307 | Ga0157372_12349680 | Ga0157372_123496802 | 114 |
| 108 | 3300013307 | Ga0157372_12511967 | Ga0157372_125119671 | 114 |
| 109 | 3300013308 | Ga0157375_10058265 | Ga0157375_100582653 | 114 |
| 110 | 3300013308 | Ga0157375_10175081 | Ga0157375_101750812 | 114 |
| 111 | 3300013308 | Ga0157375_11906387 | Ga0157375_119063871 | 114 |
| 112 | 3300014325 | Ga0163163_11340648 | Ga0163163_113406482 | 114 |
| 113 | 3300014497 | Ga0182008_10006943 | Ga0182008_100069435 | 114 |
| 114 | 3300015262 | Ga0182007_10009622 | Ga0182007_100096224 | 114 |
| 115 | 3300015265 | Ga0182005_1001133 | Ga0182005_10011334 | 114 |
| 116 | 3300017792 | Ga0163161_10536614 | Ga0163161_105366142 | 114 |
| 117 | 3300025315 | Ga0207697_10048149 | Ga0207697_100481493 | 114 |
| 118 | 3300025728 | Ga0207655_1001872 | Ga0207655_100187214 | 114 |
| 119 | 3300025728 | Ga0207655_1012569 | Ga0207655_10125697 | 114 |
| 120 | 3300025735 | Ga0207713_1005277 | Ga0207713_10052772 | 114 |
| 121 | 3300025735 | Ga0207713_1005486 | Ga0207713_10054862 | 114 |
| 122 | 3300025885 | Ga0207653_10031202 | Ga0207653_100312022 | 114 |
| 123 | 3300025901 | Ga0207688_10018309 | Ga0207688_100183093 | 114 |
| 124 | 3300025909 | Ga0207705_10209112 | Ga0207705_102091122 | 114 |
| 125 | 3300025912 | Ga0207707_10222566 | Ga0207707_102225661 | 114 |
| 126 | 3300025912 | Ga0207707_11663451 | Ga0207707_116634511 | 114 |
| 127 | 3300025913 | Ga0207695_10017147 | Ga0207695_100171473 | 114 |
| 128 | 3300025913 | Ga0207695_10149559 | Ga0207695_101495591 | 114 |
| 129 | 3300025913 | Ga0207695_10505700 | Ga0207695_105057003 | 114 |
| 130 | 3300025920 | Ga0207649_10045760 | Ga0207649_100457601 | 114 |
| 131 | 3300025924 | Ga0207694_10497398 | Ga0207694_104973982 | 114 |
| 132 | 3300025927 | Ga0207687_10013465 | Ga0207687_100134651 | 114 |
| 133 | 3300025927 | Ga0207687_10030892 | Ga0207687_100308921 | 114 |
| 134 | 3300025927 | Ga0207687_11687537 | Ga0207687_116875371 | 114 |
| 135 | 3300025929 | Ga0207664_10072849 | Ga0207664_100728493 | 114 |
| 136 | 3300025932 | Ga0207690_10592233 | Ga0207690_105922332 | 114 |
| 137 | 3300025934 | Ga0207686_10570194 | Ga0207686_105701942 | 114 |
| 138 | 3300025934 | Ga0207686_11849667 | Ga0207686_118496671 | 114 |
| 139 | 3300025937 | Ga0207669_10174441 | Ga0207669_101744412 | 114 |
| 140 | 3300025937 | Ga0207669_10221677 | Ga0207669_102216772 | 114 |
| 141 | 3300025938 | Ga0207704_10279428 | Ga0207704_102794281 | 114 |
| 142 | 3300025938 | Ga0207704_11900249 | Ga0207704_119002491 | 114 |
| 143 | 3300025940 | Ga0207691_10133892 | Ga0207691_101338923 | 114 |
| 144 | 3300025944 | Ga0207661_10027333 | Ga0207661_100273333 | 114 |
| 145 | 3300025944 | Ga0207661_10828800 | Ga0207661_108288002 | 114 |
| 146 | 3300025945 | Ga0207679_10001427 | Ga0207679_100014278 | 114 |
| 147 | 3300025945 | Ga0207679_10058784 | Ga0207679_100587843 | 114 |
| 148 | 3300025961 | Ga0207712_10514311 | Ga0207712_105143112 | 114 |
| 149 | 3300025972 | Ga0207668_10097263 | Ga0207668_100972632 | 114 |
| 150 | 3300025981 | Ga0207640_10086703 | Ga0207640_100867033 | 114 |
| 151 | 3300026035 | Ga0207703_10014401 | Ga0207703_100144012 | 114 |
| 152 | 3300026041 | Ga0207639_10000118 | Ga0207639_100001187 | 114 |
| 153 | 3300026075 | Ga0207708_10273312 | Ga0207708_102733121 | 114 |
| 154 | 3300026075 | Ga0207708_11372693 | Ga0207708_113726931 | 114 |
| 155 | 3300026088 | Ga0207641_10124578 | Ga0207641_101245783 | 114 |
| 156 | 3300026089 | Ga0207648_10530546 | Ga0207648_105305462 | 114 |
| 157 | 3300026095 | Ga0207676_10808687 | Ga0207676_108086871 | 114 |
| 158 | 3300026116 | Ga0207674_10027486 | Ga0207674_100274866 | 114 |
| 159 | 3300026118 | Ga0207675_100019647 | Ga0207675_1000196475 | 114 |
| 160 | 3300026121 | Ga0207683_10000961 | Ga0207683_1000096110 | 114 |
| 161 | 3300026121 | Ga0207683_12114510 | Ga0207683_121145101 | 114 |
| 162 | 3300027360 | Ga0209969_1005739 | Ga0209969_10057393 | 114 |
| 163 | 3300027552 | Ga0209982_1004337 | Ga0209982_10043371 | 114 |
| 164 | 3300027617 | Ga0210002_1028865 | Ga0210002_10288651 | 114 |
| 165 | 3300027665 | Ga0209983_1003298 | Ga0209983_10032986 | 114 |
| 166 | 3300027682 | Ga0209971_1011721 | Ga0209971_10117213 | 114 |
| 167 | 3300027695 | Ga0209966_1011716 | Ga0209966_10117162 | 114 |
| 168 | 3300027717 | Ga0209998_10014095 | Ga0209998_100140953 | 114 |
| 169 | 3300027876 | Ga0209974_10016737 | Ga0209974_100167372 | 114 |
| 170 | 3300027907 | Ga0207428_10161782 | Ga0207428_101617822 | 114 |
| 171 | 3300027907 | Ga0207428_10397783 | Ga0207428_103977831 | 114 |
| 172 | 3300028379 | Ga0268266_10000211 | Ga0268266_1000021161 | 114 |
| 173 | 3300028379 | Ga0268266_10083004 | Ga0268266_100830043 | 114 |
| 174 | 3300028380 | Ga0268265_10204108 | Ga0268265_102041082 | 114 |
| 175 | 3300028380 | Ga0268265_11038605 | Ga0268265_110386052 | 114 |
| 176 | 3300028380 | Ga0268265_11173996 | Ga0268265_111739962 | 114 |
| 177 | 3300028558 | Ga0265326_10006088 | Ga0265326_100060882 | 114 |
| 178 | 3300028563 | Ga0265319_1069098 | Ga0265319_10690982 | 114 |
| 179 | 3300028653 | Ga0265323_10108718 | Ga0265323_101087182 | 114 |
| 180 | 3300028654 | Ga0265322_10115346 | Ga0265322_101153462 | 114 |
| 181 | 3300028666 | Ga0265336_10008131 | Ga0265336_100081313 | 114 |
| 182 | 3300028800 | Ga0265338_10009948 | Ga0265338_100099485 | 114 |
| 183 | 3300028800 | Ga0265338_10766096 | Ga0265338_107660962 | 114 |
| 184 | 3300031238 | Ga0265332_10197602 | Ga0265332_101976022 | 114 |
| 185 | 3300031242 | Ga0265329_10014704 | Ga0265329_100147043 | 114 |
| 186 | 3300031250 | Ga0265331_10086542 | Ga0265331_100865422 | 114 |
| 187 | 3300031251 | Ga0265327_10043787 | Ga0265327_100437872 | 114 |
| 188 | 3300031344 | Ga0265316_10020698 | Ga0265316_100206985 | 114 |
| 189 | 3300031344 | Ga0265316_10189656 | Ga0265316_101896562 | 114 |
| 190 | 3300031344 | Ga0265316_10203575 | Ga0265316_102035752 | 114 |
| 191 | 3300031548 | Ga0307408_100010466 | Ga0307408_1000104663 | 114 |
| 192 | 3300031548 | Ga0307408_100044564 | Ga0307408_1000445644 | 114 |
| 193 | 3300031595 | Ga0265313_10122177 | Ga0265313_101221771 | 114 |
| 194 | 3300031665 | Ga0316575_10030305 | Ga0316575_100303052 | 114 |
| 195 | 3300031711 | Ga0265314_10006988 | Ga0265314_100069887 | 114 |
| 196 | 3300031711 | Ga0265314_10318496 | Ga0265314_103184961 | 114 |
| 197 | 3300031712 | Ga0265342_10018637 | Ga0265342_100186373 | 114 |
| 198 | 3300031712 | Ga0265342_10536310 | Ga0265342_105363101 | 114 |
| 199 | 3300031727 | Ga0316576_10035561 | Ga0316576_100355614 | 114 |
| 200 | 3300031727 | Ga0316576_10191294 | Ga0316576_101912942 | 114 |
| 201 | 3300031728 | Ga0316578_10013590 | Ga0316578_100135902 | 114 |
| 202 | 3300031731 | Ga0307405_10000703 | Ga0307405_1000070312 | 114 |
| 203 | 3300031824 | Ga0307413_10567245 | Ga0307413_105672452 | 114 |
| 204 | 3300031824 | Ga0307413_10983392 | Ga0307413_109833922 | 114 |
| 205 | 3300031852 | Ga0307410_10302614 | Ga0307410_103026142 | 114 |
| 206 | 3300031852 | Ga0307410_10657087 | Ga0307410_106570871 | 114 |
| 207 | 3300031901 | Ga0307406_10002856 | Ga0307406_1000285610 | 114 |
| 208 | 3300031901 | Ga0307406_10066387 | Ga0307406_100663874 | 114 |
| 209 | 3300031901 | Ga0307406_10456548 | Ga0307406_104565482 | 114 |
| 210 | 3300031903 | Ga0307407_10174984 | Ga0307407_101749842 | 114 |
| 211 | 3300031911 | Ga0307412_10081175 | Ga0307412_100811753 | 114 |
| 212 | 3300031911 | Ga0307412_11390352 | Ga0307412_113903521 | 114 |
| 213 | 3300031995 | Ga0307409_100025273 | Ga0307409_1000252732 | 114 |
| 214 | 3300032002 | Ga0307416_100010142 | Ga0307416_1000101424 | 114 |
| 215 | 3300032002 | Ga0307416_100265316 | Ga0307416_1002653163 | 114 |
| 216 | 3300032002 | Ga0307416_100312084 | Ga0307416_1003120843 | 114 |
| 217 | 3300032005 | Ga0307411_11288890 | Ga0307411_112888902 | 114 |
| 218 | 3300032126 | Ga0307415_100055278 | Ga0307415_1000552781 | 114 |
| 219 | 3300032126 | Ga0307415_100089070 | Ga0307415_1000890702 | 114 |
| 220 | 3300032126 | Ga0307415_101788686 | Ga0307415_1017886861 | 114 |
| 221 | 3300032137 | Ga0316585_10029518 | Ga0316585_100295182 | 114 |
| 222 | 3300032139 | Ga0316580_10007098 | Ga0316580_100070982 | 114 |
| 223 | 3300033528 | Ga0316588_1072889 | Ga0316588_10728892 | 114 |
| 224 | 3300035115 | Ga0373941_0146082 | Ga0373941_0146082_107_457 | 114 |
| 225 | 3300035116 | Ga0373945_0338093 | Ga0373945_0338093_78_422 | 114 |
| 226 | 3300035120 | Ga0373957_0340200 | Ga0373957_0340200_266_610 | 114 |
| 227 | 3300035121 | Ga0373960_0107129 | Ga0373960_0107129_57_401 | 114 |
| 228 | 3300035170 | Ga0373943_0434469 | Ga0373943_0434469_55_399 | 114 |
| 229 | 3300035170 | Ga0373943_0649289 | Ga0373943_0649289_20_364 | 114 |
| 230 | 3300035171 | Ga0373946_0155439 | Ga0373946_0155439_397_741 | 114 |
| 231 | 3300035172 | Ga0373955_0334543 | Ga0373955_0334543_17_361 | 114 |
| 232 | 3300035398 | Ga0316574_0128792 | Ga0316574_0128792_228_572 | 114 |
| 233 | 3300035398 | Ga0316574_0297689 | Ga0316574_0297689_468_812 | 114 |
| 234 | 3300035398 | Ga0316574_0405226 | Ga0316574_0405226_383_733 | 114 |
| 235 | 3300035398 | Ga0316574_0540186 | Ga0316574_0540186_34_378 | 114 |
| 236 | 3300035691 | Ga0373931_0148259 | Ga0373931_0148259_50_394 | 114 |
| 237 | 3300035724 | Ga0373933_0105349 | Ga0373933_0105349_159_539 | 114 |
| 238 | 3300035724 | Ga0373933_0157090 | Ga0373933_0157090_398_742 | 114 |
| 239 | 3300035725 | Ga0373947_0059869 | Ga0373947_0059869_536_880 | 114 |
| 240 | 3300035725 | Ga0373947_0979420 | Ga0373947_0979420_202_546 | 114 |
| 241 | 3300036401 | Ga0373937_0667196 | Ga0373937_0667196_557_937 | 114 |
| 242 | 3300036401 | Ga0373937_1428642 | Ga0373937_1428642_195_590 | 114 |
| 243 | 3300036647 | Ga0316582_0132368 | Ga0316582_0132368_378_722 | 114 |
| 244 | 3300036647 | Ga0316582_0201834 | Ga0316582_0201834_837_1181 | 114 |
| 245 | 3300036647 | Ga0316582_0251201 | Ga0316582_0251201_851_1195 | 114 |
| 246 | 3300036647 | Ga0316582_0265351 | Ga0316582_0265351_113_457 | 114 |
| 247 | 3300036647 | Ga0316582_0279606 | Ga0316582_0279606_70_417 | 114 |
| 248 | 3300036712 | Ga0316584_0007219 | Ga0316584_0007219_1026_1370 | 114 |
| 249 | 3300036712 | Ga0316584_0064691 | Ga0316584_0064691_1975_2319 | 114 |
| 250 | 3300036712 | Ga0316584_0068312 | Ga0316584_0068312_781_1128 | 114 |
| 251 | 3300036712 | Ga0316584_0138656 | Ga0316584_0138656_1230_1574 | 114 |
| 252 | 3300036712 | Ga0316584_0391085 | Ga0316584_0391085_433_777 | 114 |
| 253 | 3300037068 | Ga0373925_0427070 | Ga0373925_0427070_194_538 | 114 |
| 254 | 3300037312 | Ga0395899_0026680 | Ga0395899_0026680_873_1217 | 114 |
| 255 | 3300037312 | Ga0395899_0315319 | Ga0395899_0315319_362_712 | 114 |
| 256 | 3300037466 | Ga0395898_0051869 | Ga0395898_0051869_935_1324 | 114 |
| 257 | 3300037466 | Ga0395898_0687101 | Ga0395898_0687101_370_723 | 114 |
| 258 | 3300037471 | Ga0395905_0236363 | Ga0395905_0236363_1045_1434 | 114 |
| 259 | 3300037588 | Ga0316581_0149995 | Ga0316581_0149995_126_470 | 114 |
| 260 | 3300038443 | Ga0395901_0047032 | Ga0395901_0047032_950_1294 | 114 |
| 261 | 3300038443 | Ga0395901_0387095 | Ga0395901_0387095_961_1350 | 114 |
| 262 | 3300038443 | Ga0395901_2043160 | Ga0395901_2043160_127_480 | 114 |
| 263 | 3300041405 | Ga0439438_001013 | Ga0439438_001013_1713_2057 | 114 |
| 264 | 3300041407 | Ga0439447_000666 | Ga0439447_000666_2690_3034 | 114 |
| 265 | 3300041411 | Ga0439466_0002641 | Ga0439466_0002641_5346_5690 | 114 |
| 266 | 3300041411 | Ga0439466_0106712 | Ga0439466_0106712_230_574 | 114 |
| 267 | 3300041413 | Ga0439465_0005161 | Ga0439465_0005161_180_524 | 114 |
| 268 | 3300041459 | Ga0451800_1247482 | Ga0451800_1247482_114_461 | 114 |
| 269 | 3300041460 | Ga0451802_0496456 | Ga0451802_0496456_91_435 | 114 |
| 270 | 3300041505 | Ga0451849_0145583 | Ga0451849_0145583_608_952 | 114 |
| 271 | 3300041507 | Ga0451851_0964593 | Ga0451851_0964593_216_560 | 114 |
| 272 | 3300041512 | Ga0451853_3038749 | Ga0451853_3038749_28_450 | 114 |
| 273 | 3300041512 | Ga0451853_3458816 | Ga0451853_3458816_228_572 | 114 |
| 274 | 3300042005 | Ga0439448_0027212 | Ga0439448_0027212_568_912 | 114 |
| 275 | 3300042006 | Ga0439432_010667 | Ga0439432_010667_1184_1528 | 114 |
| 276 | 3300042009 | Ga0439451_002482 | Ga0439451_002482_742_1086 | 114 |
| 277 | 3300042009 | Ga0439451_002901 | Ga0439451_002901_1136_1480 | 114 |
| 278 | 3300042010 | Ga0439452_021999 | Ga0439452_021999_714_1058 | 114 |
| 279 | 3300042011 | Ga0439454_089355 | Ga0439454_089355_186_530 | 114 |
| 280 | 3300042013 | Ga0439456_000443 | Ga0439456_000443_7259_7603 | 114 |
| 281 | 3300042013 | Ga0439456_086210 | Ga0439456_086210_303_647 | 114 |
| 282 | 3300042016 | Ga0439463_008507 | Ga0439463_008507_1093_1437 | 114 |
| 283 | 3300042115 | Ga0450911_000802 | Ga0450911_000802_4417_4761 | 114 |
| 284 | 3300042127 | Ga0450890_000175 | Ga0450890_000175_6627_6971 | 114 |
| 285 | 3300042138 | Ga0450903_000125 | Ga0450903_000125_9480_9824 | 114 |
| 286 | 3300042145 | Ga0450906_000150 | Ga0450906_000150_4815_5159 | 114 |
| 287 | 3300042146 | Ga0450907_000264 | Ga0450907_000264_6962_7306 | 114 |
| 288 | 3300042147 | Ga0450910_043876 | Ga0450910_043876_223_567 | 114 |
| 289 | 3300042156 | Ga0439446_0000262 | Ga0439446_0000262_2221_2565 | 114 |
| 290 | 3300042184 | Ga0450908_000323 | Ga0450908_000323_2719_3063 | 114 |
| 291 | 3300042185 | Ga0450909_000146 | Ga0450909_000146_5805_6149 | 114 |
| 292 | 3300042435 | Ga0439434_0004261 | Ga0439434_0004261_774_1118 | 114 |
| 293 | 3300042439 | Ga0439464_0001496 | Ga0439464_0001496_4594_4938 | 114 |
| 294 | 3300042461 | Ga0439460_0015634 | Ga0439460_0015634_271_615 | 114 |
| 295 | 3300042461 | Ga0439460_0068874 | Ga0439460_0068874_725_1069 | 114 |
| 296 | 3300042876 | Ga0451577_0000491 | Ga0451577_0000491_65850_66209 | 114 |
| 297 | 3300042876 | Ga0451577_0011620 | Ga0451577_0011620_5786_6163 | 114 |
| 298 | 3300042876 | Ga0451577_0037350 | Ga0451577_0037350_3770_4114 | 114 |
| 299 | 3300042876 | Ga0451577_0064223 | Ga0451577_0064223_242_586 | 114 |
| 300 | 3300042876 | Ga0451577_0140824 | Ga0451577_0140824_1206_1550 | 114 |
| 301 | 3300042876 | Ga0451577_0188018 | Ga0451577_0188018_1028_1375 | 114 |
| 302 | 3300042876 | Ga0451577_0306388 | Ga0451577_0306388_233_622 | 114 |
| 303 | 3300042876 | Ga0451577_0491503 | Ga0451577_0491503_131_475 | 114 |
| 304 | 3300042876 | Ga0451577_0656716 | Ga0451577_0656716_458_802 | 114 |
| 305 | 3300042993 | Ga0439440_0000067 | Ga0439440_0000067_12733_13077 | 114 |
| 306 | 3300044673 | Ga0453683_0073361 | Ga0453683_0073361_1681_2025 | 114 |
| 307 | 3300044673 | Ga0453683_0232474 | Ga0453683_0232474_127_474 | 114 |
| 308 | 3300044712 | Ga0453684_0001325 | Ga0453684_0001325_2456_2800 | 114 |
| 309 | 3300044712 | Ga0453684_0001444 | Ga0453684_0001444_65850_66209 | 114 |
| 310 | 3300044712 | Ga0453684_0002706 | Ga0453684_0002706_39922_40311 | 114 |
| 311 | 3300044712 | Ga0453684_0004431 | Ga0453684_0004431_4713_5057 | 114 |
| 312 | 3300044712 | Ga0453684_0022734 | Ga0453684_0022734_8309_8653 | 114 |
| 313 | 3300044712 | Ga0453684_0057653 | Ga0453684_0057653_4203_4547 | 114 |
| 314 | 3300044712 | Ga0453684_0077750 | Ga0453684_0077750_3321_3665 | 114 |
| 315 | 3300044712 | Ga0453684_0136906 | Ga0453684_0136906_191_535 | 114 |
| 316 | 3300044712 | Ga0453684_0166280 | Ga0453684_0166280_1446_1823 | 114 |
| 317 | 3300044712 | Ga0453684_0541964 | Ga0453684_0541964_132_485 | 114 |
| 318 | 3300044712 | Ga0453684_0724825 | Ga0453684_0724825_478_825 | 114 |
| 319 | 3300044712 | Ga0453684_1047084 | Ga0453684_1047084_34_378 | 114 |
| 320 | 3300045051 | Ga0451576_0009820 | Ga0451576_0009820_7602_7946 | 114 |
| 321 | 3300045051 | Ga0451576_0084645 | Ga0451576_0084645_1732_2076 | 114 |
| 322 | 3300045051 | Ga0451576_0109245 | Ga0451576_0109245_1377_1724 | 114 |
| 323 | 3300045051 | Ga0451576_0296552 | Ga0451576_0296552_1266_1655 | 114 |
| 324 | 3300045051 | Ga0451576_1113040 | Ga0451576_1113040_22_366 | 114 |
| 325 | 3300046452 | Ga0495617_000613 | Ga0495617_000613_9286_9630 | 114 |
| 326 | 3300046452 | Ga0495617_002742 | Ga0495617_002742_6060_6404 | 114 |
| 327 | 3300046452 | Ga0495617_003910 | Ga0495617_003910_361_705 | 114 |
| 328 | 3300046452 | Ga0495617_052845 | Ga0495617_052845_644_988 | 114 |
| 329 | 3300046453 | Ga0495627_042401 | Ga0495627_042401_708_1052 | 114 |
| 330 | 3300046454 | Ga0495592_0060527 | Ga0495592_0060527_1700_2095 | 114 |
| 331 | 3300046455 | Ga0495603_0000256 | Ga0495603_0000256_14352_14696 | 114 |
| 332 | 3300046455 | Ga0495603_0193271 | Ga0495603_0193271_371_715 | 114 |
| 333 | 3300046457 | Ga0495590_0000339 | Ga0495590_0000339_21316_21660 | 114 |
| 334 | 3300046457 | Ga0495590_0007354 | Ga0495590_0007354_1395_1739 | 114 |
| 335 | 3300046457 | Ga0495590_0013132 | Ga0495590_0013132_2657_3001 | 114 |
| 336 | 3300046458 | Ga0495591_000266 | Ga0495591_000266_10263_10607 | 114 |
| 337 | 3300046458 | Ga0495591_097381 | Ga0495591_097381_365_709 | 114 |
| 338 | 3300046459 | Ga0495629_0016696 | Ga0495629_0016696_3969_4313 | 114 |
| 339 | 3300046460 | Ga0495638_0025626 | Ga0495638_0025626_2992_3336 | 114 |
| 340 | 3300046460 | Ga0495638_0052167 | Ga0495638_0052167_1936_2280 | 114 |
| 341 | 3300046462 | Ga0495651_0157474 | Ga0495651_0157474_1273_1617 | 114 |
| 342 | 3300046463 | Ga0495653_0493811 | Ga0495653_0493811_24_377 | 114 |
| 343 | 3300046463 | Ga0495653_0511841 | Ga0495653_0511841_116_460 | 114 |
| 344 | 3300046471 | Ga0495650_0000531 | Ga0495650_0000531_20888_21232 | 114 |
| 345 | 3300046471 | Ga0495650_0003945 | Ga0495650_0003945_758_1102 | 114 |
| 346 | 3300046471 | Ga0495650_0028492 | Ga0495650_0028492_1944_2288 | 114 |
| 347 | 3300046473 | Ga0495582_0007727 | Ga0495582_0007727_5056_5400 | 114 |
| 348 | 3300046474 | Ga0495605_0000526 | Ga0495605_0000526_7635_7979 | 114 |
| 349 | 3300046474 | Ga0495605_0001754 | Ga0495605_0001754_9926_10270 | 114 |
| 350 | 3300046474 | Ga0495605_0007320 | Ga0495605_0007320_1988_2332 | 114 |
| 351 | 3300046474 | Ga0495605_0031768 | Ga0495605_0031768_2004_2348 | 114 |
| 352 | 3300046474 | Ga0495605_0050064 | Ga0495605_0050064_1532_1897 | 114 |
| 353 | 3300046474 | Ga0495605_0128959 | Ga0495605_0128959_624_968 | 114 |
| 354 | 3300046475 | Ga0495639_0008154 | Ga0495639_0008154_263_607 | 114 |
| 355 | 3300046476 | Ga0495662_0045390 | Ga0495662_0045390_873_1217 | 114 |
| 356 | 3300046491 | Ga0495584_0001430 | Ga0495584_0001430_10420_10764 | 114 |
| 357 | 3300046491 | Ga0495584_0002117 | Ga0495584_0002117_10657_11001 | 114 |
| 358 | 3300046491 | Ga0495584_0014843 | Ga0495584_0014843_2355_2699 | 114 |
| 359 | 3300046491 | Ga0495584_0040286 | Ga0495584_0040286_933_1277 | 114 |
| 360 | 3300046491 | Ga0495584_0311391 | Ga0495584_0311391_229_573 | 114 |
| 361 | 3300046491 | Ga0495584_0343133 | Ga0495584_0343133_53_397 | 114 |
| 362 | 3300046492 | Ga0495585_0003604 | Ga0495585_0003604_8928_9272 | 114 |
| 363 | 3300046492 | Ga0495585_0091794 | Ga0495585_0091794_732_1076 | 114 |
| 364 | 3300046492 | Ga0495585_0187634 | Ga0495585_0187634_272_616 | 114 |
| 365 | 3300046499 | Ga0495594_0002357 | Ga0495594_0002357_900_1244 | 114 |
| 366 | 3300046499 | Ga0495594_0002788 | Ga0495594_0002788_4954_5298 | 114 |
| 367 | 3300046501 | Ga0495607_0000637 | Ga0495607_0000637_11674_12018 | 114 |
| 368 | 3300046501 | Ga0495607_0054893 | Ga0495607_0054893_167_511 | 114 |
| 369 | 3300046501 | Ga0495607_0060485 | Ga0495607_0060485_1116_1460 | 114 |
| 370 | 3300046501 | Ga0495607_0101490 | Ga0495607_0101490_314_658 | 114 |
| 371 | 3300046506 | Ga0495583_0000921 | Ga0495583_0000921_1918_2262 | 114 |
| 372 | 3300046506 | Ga0495583_0017824 | Ga0495583_0017824_141_485 | 114 |
| 373 | 3300046506 | Ga0495583_0031567 | Ga0495583_0031567_580_924 | 114 |
| 374 | 3300046506 | Ga0495583_0031659 | Ga0495583_0031659_362_706 | 114 |
| 375 | 3300046506 | Ga0495583_0102598 | Ga0495583_0102598_863_1207 | 114 |
| 376 | 3300046507 | Ga0495606_0021952 | Ga0495606_0021952_3254_3598 | 114 |
| 377 | 3300046507 | Ga0495606_0031391 | Ga0495606_0031391_2514_2858 | 114 |
| 378 | 3300046507 | Ga0495606_0042204 | Ga0495606_0042204_2308_2652 | 114 |
| 379 | 3300046511 | Ga0495608_0073084 | Ga0495608_0073084_1872_2216 | 114 |
| 380 | 3300046511 | Ga0495608_0360385 | Ga0495608_0360385_180_527 | 114 |
| 381 | 3300046512 | Ga0495610_0067998 | Ga0495610_0067998_800_1144 | 114 |
| 382 | 3300046513 | Ga0495616_0000245 | Ga0495616_0000245_32144_32488 | 114 |
| 383 | 3300046513 | Ga0495616_0001526 | Ga0495616_0001526_15024_15368 | 114 |
| 384 | 3300046513 | Ga0495616_0026197 | Ga0495616_0026197_2327_2671 | 114 |
| 385 | 3300046513 | Ga0495616_0131878 | Ga0495616_0131878_298_642 | 114 |
| 386 | 3300046513 | Ga0495616_0422167 | Ga0495616_0422167_138_482 | 114 |
| 387 | 3300046514 | Ga0495618_0775290 | Ga0495618_0775290_130_474 | 114 |
| 388 | 3300046515 | Ga0495620_0002926 | Ga0495620_0002926_1321_1665 | 114 |
| 389 | 3300046515 | Ga0495620_0026987 | Ga0495620_0026987_161_505 | 114 |
| 390 | 3300046517 | Ga0495630_0003131 | Ga0495630_0003131_5476_5820 | 114 |
| 391 | 3300046517 | Ga0495630_0144308 | Ga0495630_0144308_928_1272 | 114 |
| 392 | 3300046518 | Ga0495631_0000005 | Ga0495631_0000005_41094_41438 | 114 |
| 393 | 3300046518 | Ga0495631_0006594 | Ga0495631_0006594_4400_4744 | 114 |
| 394 | 3300046518 | Ga0495631_0020944 | Ga0495631_0020944_136_480 | 114 |
| 395 | 3300046518 | Ga0495631_0168696 | Ga0495631_0168696_91_435 | 114 |
| 396 | 3300046519 | Ga0495632_0000166 | Ga0495632_0000166_29170_29514 | 114 |
| 397 | 3300046519 | Ga0495632_0002218 | Ga0495632_0002218_10038_10382 | 114 |
| 398 | 3300046519 | Ga0495632_0002362 | Ga0495632_0002362_10434_10778 | 114 |
| 399 | 3300046520 | Ga0495637_0000440 | Ga0495637_0000440_362_706 | 114 |
| 400 | 3300046520 | Ga0495637_0000804 | Ga0495637_0000804_8017_8361 | 114 |
| 401 | 3300046520 | Ga0495637_0001706 | Ga0495637_0001706_10720_11085 | 114 |
| 402 | 3300046520 | Ga0495637_0004378 | Ga0495637_0004378_6536_6880 | 114 |
| 403 | 3300046520 | Ga0495637_0011362 | Ga0495637_0011362_1393_1737 | 114 |
| 404 | 3300046522 | Ga0495643_0353435 | Ga0495643_0353435_247_591 | 114 |
| 405 | 3300046522 | Ga0495643_0465043 | Ga0495643_0465043_67_411 | 114 |
| 406 | 3300046523 | Ga0495644_0029822 | Ga0495644_0029822_794_1138 | 114 |
| 407 | 3300046524 | Ga0495648_0031213 | Ga0495648_0031213_2603_2947 | 114 |
| 408 | 3300046524 | Ga0495648_0045833 | Ga0495648_0045833_2316_2660 | 114 |
| 409 | 3300046524 | Ga0495648_0046838 | Ga0495648_0046838_2281_2625 | 114 |
| 410 | 3300046524 | Ga0495648_0148046 | Ga0495648_0148046_176_520 | 114 |
| 411 | 3300046524 | Ga0495648_0331568 | Ga0495648_0331568_176_520 | 114 |
| 412 | 3300046526 | Ga0495666_0013364 | Ga0495666_0013364_1158_1502 | 114 |
| 413 | 3300046526 | Ga0495666_0063468 | Ga0495666_0063468_530_874 | 114 |
| 414 | 3300046528 | Ga0495642_0000016 | Ga0495642_0000016_84774_85118 | 114 |
| 415 | 3300046528 | Ga0495642_0001529 | Ga0495642_0001529_558_902 | 114 |
| 416 | 3300046529 | Ga0495652_0188854 | Ga0495652_0188854_716_1111 | 114 |
| 417 | 3300046530 | Ga0495654_0012576 | Ga0495654_0012576_3716_4060 | 114 |
| 418 | 3300046530 | Ga0495654_0016537 | Ga0495654_0016537_1656_2000 | 114 |
| 419 | 3300046530 | Ga0495654_0017220 | Ga0495654_0017220_1436_1780 | 114 |
| 420 | 3300046530 | Ga0495654_0017344 | Ga0495654_0017344_836_1180 | 114 |
| 421 | 3300046530 | Ga0495654_0072543 | Ga0495654_0072543_751_1116 | 114 |
| 422 | 3300046530 | Ga0495654_0174176 | Ga0495654_0174176_199_543 | 114 |
| 423 | 3300046533 | Ga0495640_0080680 | Ga0495640_0080680_1228_1572 | 114 |
| 424 | 3300046533 | Ga0495640_0352524 | Ga0495640_0352524_22_369 | 114 |
| 425 | 3300046535 | Ga0495586_0004702 | Ga0495586_0004702_6117_6461 | 114 |
| 426 | 3300046535 | Ga0495586_0040651 | Ga0495586_0040651_944_1288 | 114 |
| 427 | 3300046536 | Ga0495587_0000877 | Ga0495587_0000877_9646_9990 | 114 |
| 428 | 3300046538 | Ga0495609_0000186 | Ga0495609_0000186_25952_26296 | 114 |
| 429 | 3300046538 | Ga0495609_0001638 | Ga0495609_0001638_13905_14249 | 114 |
| 430 | 3300046542 | Ga0495597_0011750 | Ga0495597_0011750_2501_2845 | 114 |
| 431 | 3300046542 | Ga0495597_0016091 | Ga0495597_0016091_638_982 | 114 |
| 432 | 3300046542 | Ga0495597_0066164 | Ga0495597_0066164_163_507 | 114 |
| 433 | 3300046542 | Ga0495597_0134012 | Ga0495597_0134012_163_507 | 114 |
| 434 | 3300046557 | Ga0495622_0060030 | Ga0495622_0060030_1260_1604 | 114 |
| 435 | 3300046557 | Ga0495622_0060449 | Ga0495622_0060449_157_501 | 114 |
| 436 | 3300046557 | Ga0495622_0067344 | Ga0495622_0067344_76_420 | 114 |
| 437 | 3300046558 | Ga0495633_0001867 | Ga0495633_0001867_14012_14356 | 114 |
| 438 | 3300046558 | Ga0495633_0011205 | Ga0495633_0011205_3282_3626 | 114 |
| 439 | 3300046558 | Ga0495633_0218800 | Ga0495633_0218800_233_577 | 114 |
| 440 | 3300046559 | Ga0495667_0045894 | Ga0495667_0045894_2525_2869 | 114 |
| 441 | 3300046559 | Ga0495667_0068510 | Ga0495667_0068510_1813_2160 | 114 |
| 442 | 3300046559 | Ga0495667_0862348 | Ga0495667_0862348_23_367 | 114 |
| 443 | 3300046615 | Ga0495656_0000395 | Ga0495656_0000395_2455_2799 | 114 |
| 444 | 3300046615 | Ga0495656_0024969 | Ga0495656_0024969_194_538 | 114 |
| 445 | 3300046616 | Ga0495668_0112920 | Ga0495668_0112920_313_657 | 114 |
| 446 | 3300046616 | Ga0495668_0702680 | Ga0495668_0702680_175_519 | 114 |
| 447 | 3300046642 | Ga0495634_0289089 | Ga0495634_0289089_194_538 | 114 |
| 448 | 3300046648 | Ga0495611_0412822 | Ga0495611_0412822_16_360 | 114 |
| 449 | 3300046660 | Ga0495625_0005814 | Ga0495625_0005814_1003_1347 | 114 |
| 450 | 3300046660 | Ga0495625_0007010 | Ga0495625_0007010_298_663 | 114 |
| 451 | 3300046660 | Ga0495625_0011080 | Ga0495625_0011080_6586_6930 | 114 |
| 452 | 3300046660 | Ga0495625_0103755 | Ga0495625_0103755_542_886 | 114 |
| 453 | 3300046660 | Ga0495625_0201910 | Ga0495625_0201910_378_722 | 114 |
| 454 | 3300046660 | Ga0495625_0338195 | Ga0495625_0338195_489_854 | 114 |
| 455 | 3300046663 | Ga0495635_0000594 | Ga0495635_0000594_17293_17637 | 114 |
| 456 | 3300046664 | Ga0495659_0000335 | Ga0495659_0000335_13351_13695 | 114 |
| 457 | 3300046664 | Ga0495659_0002744 | Ga0495659_0002744_2743_3087 | 114 |
| 458 | 3300046664 | Ga0495659_0121412 | Ga0495659_0121412_416_760 | 114 |
| 459 | 3300046665 | Ga0495661_0001171 | Ga0495661_0001171_22001_22345 | 114 |
| 460 | 3300046665 | Ga0495661_0075198 | Ga0495661_0075198_832_1176 | 114 |
| 461 | 3300046665 | Ga0495661_0165283 | Ga0495661_0165283_690_1034 | 114 |
| 462 | 3300046674 | Ga0495588_0019674 | Ga0495588_0019674_2135_2479 | 114 |
| 463 | 3300046678 | Ga0495599_0064397 | Ga0495599_0064397_51_398 | 114 |
| 464 | 3300046679 | Ga0495623_0089739 | Ga0495623_0089739_606_1001 | 114 |
| 465 | 3300046680 | Ga0495646_0006790 | Ga0495646_0006790_3254_3598 | 114 |
| 466 | 3300046684 | Ga0495669_0001951 | Ga0495669_0001951_114_458 | 114 |
| 467 | 3300046684 | Ga0495669_0247177 | Ga0495669_0247177_276_620 | 114 |
| 468 | 3300046684 | Ga0495669_0400030 | Ga0495669_0400030_141_485 | 114 |
| 469 | 3300046689 | Ga0495613_0053677 | Ga0495613_0053677_1748_2092 | 114 |
| 470 | 3300046691 | Ga0495670_0000215 | Ga0495670_0000215_10879_11223 | 114 |
| 471 | 3300046691 | Ga0495670_0055484 | Ga0495670_0055484_519_863 | 114 |
| 472 | 3300046691 | Ga0495670_0108359 | Ga0495670_0108359_696_1040 | 114 |
| 473 | 3300046691 | Ga0495670_0621826 | Ga0495670_0621826_181_525 | 114 |
| 474 | 3300046691 | Ga0495670_0833621 | Ga0495670_0833621_12_356 | 114 |
| 475 | 3300046692 | Ga0495671_0091763 | Ga0495671_0091763_402_746 | 114 |
| 476 | 3300046692 | Ga0495671_0203276 | Ga0495671_0203276_181_525 | 114 |
| 477 | 3300046692 | Ga0495671_0477053 | Ga0495671_0477053_138_482 | 114 |
| 478 | 3300046694 | Ga0495649_0000086 | Ga0495649_0000086_21747_22091 | 114 |
| 479 | 3300046694 | Ga0495649_0001882 | Ga0495649_0001882_1618_1962 | 114 |
| 480 | 3300046694 | Ga0495649_0016341 | Ga0495649_0016341_2503_2847 | 114 |
| 481 | 3300046694 | Ga0495649_0056999 | Ga0495649_0056999_10_354 | 114 |
| 482 | 3300046694 | Ga0495649_0109500 | Ga0495649_0109500_1080_1424 | 114 |
| 483 | 3300046694 | Ga0495649_0144826 | Ga0495649_0144826_793_1137 | 114 |
| 484 | 3300046794 | Ga0495589_0000636 | Ga0495589_0000636_1045_1389 | 114 |
| 485 | 3300046794 | Ga0495589_0000799 | Ga0495589_0000799_1056_1400 | 114 |
| 486 | 3300046794 | Ga0495589_0008326 | Ga0495589_0008326_636_980 | 114 |
| 487 | 3300046794 | Ga0495589_0065008 | Ga0495589_0065008_719_1063 | 114 |
| 488 | 3300046809 | Ga0495600_0002600 | Ga0495600_0002600_9939_10283 | 114 |
| 489 | 3300046809 | Ga0495600_0235469 | Ga0495600_0235469_45_392 | 114 |
| 490 | 3300046810 | Ga0495660_0055284 | Ga0495660_0055284_665_1009 | 114 |
| 491 | 3300046810 | Ga0495660_0120606 | Ga0495660_0120606_147_491 | 114 |
| 492 | 3300047315 | Ga0495581_0010345 | Ga0495581_0010345_1169_1513 | 114 |
| 493 | 3300047315 | Ga0495581_0021045 | Ga0495581_0021045_1771_2115 | 114 |
| 494 | 3300047317 | Ga0495604_0001248 | Ga0495604_0001248_17253_17597 | 114 |
| 495 | 3300047317 | Ga0495604_0186990 | Ga0495604_0186990_649_1029 | 114 |
| 496 | 3300047318 | Ga0495636_0001197 | Ga0495636_0001197_9395_9739 | 114 |
| 497 | 3300047318 | Ga0495636_0043209 | Ga0495636_0043209_1417_1761 | 114 |
| 498 | 3300047319 | Ga0495674_0545469 | Ga0495674_0545469_175_519 | 114 |
| 499 | 3300047319 | Ga0495674_0620722 | Ga0495674_0620722_285_629 | 114 |
| 500 | 3300047320 | Ga0495672_0001126 | Ga0495672_0001126_24006_24350 | 114 |
| 501 | 3300047320 | Ga0495672_0007895 | Ga0495672_0007895_1993_2337 | 114 |
| 502 | 3300047320 | Ga0495672_0010752 | Ga0495672_0010752_686_1030 | 114 |
| 503 | 3300047320 | Ga0495672_0040511 | Ga0495672_0040511_330_674 | 114 |
| 504 | 3300047320 | Ga0495672_0357778 | Ga0495672_0357778_200_544 | 114 |
| 505 | 3300047320 | Ga0495672_0392912 | Ga0495672_0392912_257_601 | 114 |
| 506 | 3300047321 | Ga0495676_0065572 | Ga0495676_0065572_833_1177 | 114 |
| 507 | 3300047322 | Ga0495680_0000029 | Ga0495680_0000029_97684_98028 | 114 |
| 508 | 3300047322 | Ga0495680_0065586 | Ga0495680_0065586_1234_1578 | 114 |
| 509 | 3300047322 | Ga0495680_0358077 | Ga0495680_0358077_575_919 | 114 |
| 510 | 3300047323 | Ga0495683_0000010 | Ga0495683_0000010_72307_72651 | 114 |
| 511 | 3300047323 | Ga0495683_0003697 | Ga0495683_0003697_8034_8378 | 114 |
| 512 | 3300047323 | Ga0495683_0047247 | Ga0495683_0047247_994_1359 | 114 |
| 513 | 3300047323 | Ga0495683_0059918 | Ga0495683_0059918_1225_1569 | 114 |
| 514 | 3300047443 | Ga0495687_001073 | Ga0495687_001073_5683_6027 | 114 |
| 515 | 3300047443 | Ga0495687_008040 | Ga0495687_008040_4793_5137 | 114 |
| 516 | 3300047445 | Ga0495677_0000135 | Ga0495677_0000135_609_953 | 114 |
| 517 | 3300047447 | Ga0495685_066449 | Ga0495685_066449_825_1169 | 114 |
| 518 | 3300047447 | Ga0495685_091689 | Ga0495685_091689_595_939 | 114 |
| 519 | 3300047469 | Ga0495673_0000636 | Ga0495673_0000636_3088_3432 | 114 |
| 520 | 3300047469 | Ga0495673_0001177 | Ga0495673_0001177_8815_9159 | 114 |
| 521 | 3300047469 | Ga0495673_0011065 | Ga0495673_0011065_4037_4381 | 114 |
| 522 | 3300047469 | Ga0495673_0039221 | Ga0495673_0039221_233_577 | 114 |
| 523 | 3300047469 | Ga0495673_0113182 | Ga0495673_0113182_699_1064 | 114 |
| 524 | 3300047470 | Ga0495681_0001131 | Ga0495681_0001131_1880_2224 | 114 |
| 525 | 3300047470 | Ga0495681_0024464 | Ga0495681_0024464_384_728 | 114 |
| 526 | 3300047470 | Ga0495681_0035207 | Ga0495681_0035207_1990_2334 | 114 |
| 527 | 3300047471 | Ga0495684_0030723 | Ga0495684_0030723_313_657 | 114 |
| 528 | 3300047471 | Ga0495684_0435012 | Ga0495684_0435012_259_627 | 114 |
| 529 | 3300047472 | Ga0495686_0126370 | Ga0495686_0126370_19_363 | 114 |
| 530 | 3300047472 | Ga0495686_0127953 | Ga0495686_0127953_343_687 | 114 |
| 531 | 3300047673 | Ga0495593_0025192 | Ga0495593_0025192_1299_1643 | 114 |
| 532 | 3300047673 | Ga0495593_0090783 | Ga0495593_0090783_836_1180 | 114 |
| 533 | 3300048088 | Ga0495602_0164527 | Ga0495602_0164527_290_685 | 114 |
| 534 | 3300048088 | Ga0495602_0892779 | Ga0495602_0892779_36_380 | 114 |
| 535 | 3300048091 | Ga0495626_0000490 | Ga0495626_0000490_20324_20668 | 114 |
| 536 | 3300048091 | Ga0495626_0000538 | Ga0495626_0000538_4962_5306 | 114 |
| 537 | 3300048091 | Ga0495626_0001424 | Ga0495626_0001424_10308_10652 | 114 |
| 538 | 3300048091 | Ga0495626_0003448 | Ga0495626_0003448_9779_10123 | 114 |
| 539 | 3300048091 | Ga0495626_0262682 | Ga0495626_0262682_13_357 | 114 |
| 540 | 3300048904 | Ga0496101_0094024 | Ga0496101_0094024_282_632 | 114 |
| 541 | 3300048905 | Ga0496102_1218807 | Ga0496102_1218807_78_422 | 114 |
| 542 | 3300048906 | Ga0496103_0086413 | Ga0496103_0086413_589_933 | 114 |
| 543 | 3300048907 | Ga0496104_0624649 | Ga0496104_0624649_12_356 | 114 |
| 544 | 3300048907 | Ga0496104_1528359 | Ga0496104_1528359_173_517 | 114 |
| 545 | 3300048909 | Ga0496106_1029961 | Ga0496106_1029961_122_466 | 114 |
| 546 | 3300048911 | Ga0496108_0032403 | Ga0496108_0032403_1601_1945 | 114 |
| 547 | 3300048912 | Ga0496109_0260113 | Ga0496109_0260113_746_1114 | 114 |
| 548 | 3300048912 | Ga0496109_0954387 | Ga0496109_0954387_435_785 | 114 |
| 549 | 3300048913 | Ga0496110_0047289 | Ga0496110_0047289_3392_3736 | 114 |
| 550 | 3300048913 | Ga0496110_0824045 | Ga0496110_0824045_323_667 | 114 |
| 551 | 3300048914 | Ga0496111_0688967 | Ga0496111_0688967_71_415 | 114 |
| 552 | 3300048914 | Ga0496111_1105862 | Ga0496111_1105862_195_539 | 114 |
| 553 | 3300048915 | Ga0496112_0025482 | Ga0496112_0025482_2222_2566 | 114 |
| 554 | 3300048915 | Ga0496112_0234120 | Ga0496112_0234120_388_732 | 114 |
| 555 | 3300048917 | Ga0496114_0001978 | Ga0496114_0001978_13470_13820 | 114 |
| 556 | 3300048918 | Ga0496115_0147652 | Ga0496115_0147652_856_1200 | 114 |
| 557 | 3300048919 | Ga0496116_0039501 | Ga0496116_0039501_883_1227 | 114 |
| 558 | 3300048920 | Ga0496117_0001581 | Ga0496117_0001581_2788_3132 | 114 |
| 559 | 3300048920 | Ga0496117_0296429 | Ga0496117_0296429_344_688 | 114 |
| 560 | 3300048921 | Ga0496118_0178580 | Ga0496118_0178580_254_598 | 114 |
| 561 | 3300048924 | Ga0496121_0059938 | Ga0496121_0059938_1986_2330 | 114 |
| 562 | 3300048924 | Ga0496121_0704775 | Ga0496121_0704775_79_423 | 114 |
| 563 | 3300048925 | Ga0496122_0005168 | Ga0496122_0005168_13167_13511 | 114 |
| 564 | 3300048926 | Ga0496123_0026923 | Ga0496123_0026923_1654_1998 | 114 |
| 565 | 3300048927 | Ga0496124_0190285 | Ga0496124_0190285_265_609 | 114 |
| 566 | 3300048928 | Ga0496125_0007781 | Ga0496125_0007781_7775_8119 | 114 |
| 567 | 3300048928 | Ga0496125_0053077 | Ga0496125_0053077_1056_1400 | 114 |
| 568 | 3300048928 | Ga0496125_0217674 | Ga0496125_0217674_238_582 | 114 |
| 569 | 3300048929 | Ga0496126_0091173 | Ga0496126_0091173_1791_2135 | 114 |
| 570 | 3300049459 | Ga0495678_000437 | Ga0495678_000437_20925_21269 | 114 |
| 571 | 3300049459 | Ga0495678_001452 | Ga0495678_001452_7171_7536 | 114 |
| 572 | 3300049459 | Ga0495678_005908 | Ga0495678_005908_436_780 | 114 |
| 573 | 3300049459 | Ga0495678_017731 | Ga0495678_017731_1831_2175 | 114 |
| 574 | 3300049459 | Ga0495678_055284 | Ga0495678_055284_231_575 | 114 |
| 575 | 3300049459 | Ga0495678_087205 | Ga0495678_087205_626_970 | 114 |
| 576 | 3300049459 | Ga0495678_173180 | Ga0495678_173180_301_666 | 114 |
| 577 | 3300049460 | Ga0495682_0000307 | Ga0495682_0000307_29058_29402 | 114 |
| 578 | 3300049460 | Ga0495682_0003264 | Ga0495682_0003264_6226_6570 | 114 |
| 579 | 3300049460 | Ga0495682_0060363 | Ga0495682_0060363_545_889 | 114 |
| 580 | 3300049460 | Ga0495682_0062615 | Ga0495682_0062615_981_1325 | 114 |
| 581 | 3300049460 | Ga0495682_0088657 | Ga0495682_0088657_551_895 | 114 |
| 582 | 3300049460 | Ga0495682_0203071 | Ga0495682_0203071_13_357 | 114 |
| 583 | 3300049460 | Ga0495682_0295538 | Ga0495682_0295538_117_461 | 114 |
| 584 | 3300049568 | Ga0501031_0048591 | Ga0501031_0048591_1160_1504 | 114 |
| 585 | 3300049568 | Ga0501031_0346655 | Ga0501031_0346655_164_508 | 114 |
| 586 | 3300049569 | Ga0501032_0144665 | Ga0501032_0144665_479_823 | 114 |
| 587 | 3300049570 | Ga0501033_0085887 | Ga0501033_0085887_1527_1871 | 114 |
| 588 | 3300049571 | Ga0501034_0487932 | Ga0501034_0487932_59_403 | 114 |
| 589 | 3300049572 | Ga0501036_0027179 | Ga0501036_0027179_1160_1504 | 114 |
| 590 | 3300049572 | Ga0501036_0326028 | Ga0501036_0326028_360_746 | 114 |
| 591 | 3300049572 | Ga0501036_1139927 | Ga0501036_1139927_89_442 | 114 |
| 592 | 3300049574 | Ga0501038_0005503 | Ga0501038_0005503_311_655 | 114 |
| 593 | 3300049574 | Ga0501038_1243853 | Ga0501038_1243853_22_375 | 114 |
| 594 | 3300049575 | Ga0501039_0011483 | Ga0501039_0011483_2846_3190 | 114 |
| 595 | 3300049575 | Ga0501039_0110947 | Ga0501039_0110947_1665_2009 | 114 |
| 596 | 3300049575 | Ga0501039_0317994 | Ga0501039_0317994_336_689 | 114 |
| 597 | 3300049576 | Ga0501040_0019453 | Ga0501040_0019453_1712_2056 | 114 |
| 598 | 3300049576 | Ga0501040_0022127 | Ga0501040_0022127_2297_2641 | 114 |
| 599 | 3300049576 | Ga0501040_0310076 | Ga0501040_0310076_660_1046 | 114 |
| 600 | 3300049577 | Ga0501041_0006386 | Ga0501041_0006386_4996_5340 | 114 |
| 601 | 3300049577 | Ga0501041_0038855 | Ga0501041_0038855_778_1122 | 114 |
| 602 | 3300049577 | Ga0501041_0405259 | Ga0501041_0405259_264_608 | 114 |
| 603 | 3300049577 | Ga0501041_0675931 | Ga0501041_0675931_20_373 | 114 |
| 604 | 3300049578 | Ga0501042_0014313 | Ga0501042_0014313_3228_3572 | 114 |
| 605 | 3300049578 | Ga0501042_0089203 | Ga0501042_0089203_198_542 | 114 |
| 606 | 3300049578 | Ga0501042_0143663 | Ga0501042_0143663_1319_1702 | 114 |
| 607 | 3300049578 | Ga0501042_0163274 | Ga0501042_0163274_278_664 | 114 |
| 608 | 3300049579 | Ga0501043_0077243 | Ga0501043_0077243_1052_1396 | 114 |
| 609 | 3300049580 | Ga0501046_0009891 | Ga0501046_0009891_6416_6760 | 114 |
| 610 | 3300049582 | Ga0501048_0034389 | Ga0501048_0034389_219_563 | 114 |
| 611 | 3300049582 | Ga0501048_0179871 | Ga0501048_0179871_708_1094 | 114 |
| 612 | 3300049582 | Ga0501048_0997506 | Ga0501048_0997506_200_544 | 114 |
| 613 | 3300049583 | Ga0501067_0148152 | Ga0501067_0148152_517_861 | 114 |
| 614 | 3300049584 | Ga0501068_0014758 | Ga0501068_0014758_3060_3404 | 114 |
| 615 | 3300049584 | Ga0501068_0445548 | Ga0501068_0445548_33_377 | 114 |
| 616 | 3300049585 | Ga0501069_0003746 | Ga0501069_0003746_3746_4090 | 114 |
| 617 | 3300049585 | Ga0501069_0186041 | Ga0501069_0186041_702_1046 | 114 |
| 618 | 3300049586 | Ga0501070_0017298 | Ga0501070_0017298_3702_4046 | 114 |
| 619 | 3300049587 | Ga0501071_0006205 | Ga0501071_0006205_3640_3984 | 114 |
| 620 | 3300049587 | Ga0501071_0103177 | Ga0501071_0103177_977_1321 | 114 |
| 621 | 3300049587 | Ga0501071_0166963 | Ga0501071_0166963_569_955 | 114 |
| 622 | 3300049587 | Ga0501071_1261268 | Ga0501071_1261268_208_552 | 114 |
| 623 | 3300049588 | Ga0501072_0023058 | Ga0501072_0023058_3599_3943 | 114 |
| 624 | 3300049588 | Ga0501072_0062578 | Ga0501072_0062578_716_1102 | 114 |
| 625 | 3300049588 | Ga0501072_0189268 | Ga0501072_0189268_1116_1460 | 114 |
| 626 | 3300049589 | Ga0501073_0053832 | Ga0501073_0053832_769_1113 | 114 |
| 627 | 3300049590 | Ga0501074_0025433 | Ga0501074_0025433_2118_2462 | 114 |
| 628 | 3300049590 | Ga0501074_0183324 | Ga0501074_0183324_540_926 | 114 |
| 629 | 3300049590 | Ga0501074_0197339 | Ga0501074_0197339_261_605 | 114 |
| 630 | 3300049591 | Ga0501075_0021672 | Ga0501075_0021672_2936_3280 | 114 |
| 631 | 3300049591 | Ga0501075_0067834 | Ga0501075_0067834_875_1219 | 114 |
| 632 | 3300049591 | Ga0501075_0277467 | Ga0501075_0277467_527_913 | 114 |
| 633 | 3300049591 | Ga0501075_0319583 | Ga0501075_0319583_470_814 | 114 |
| 634 | 3300049591 | Ga0501075_0669252 | Ga0501075_0669252_25_378 | 114 |
| 635 | 3300049592 | Ga0501076_0006382 | Ga0501076_0006382_3555_3899 | 114 |
| 636 | 3300049592 | Ga0501076_0011226 | Ga0501076_0011226_1720_2106 | 114 |
| 637 | 3300049592 | Ga0501076_0033778 | Ga0501076_0033778_41_385 | 114 |
| 638 | 3300049592 | Ga0501076_1581429 | Ga0501076_1581429_39_392 | 114 |
| 639 | 3300049593 | Ga0501077_0010374 | Ga0501077_0010374_875_1219 | 114 |
| 640 | 3300049593 | Ga0501077_0035094 | Ga0501077_0035094_2007_2351 | 114 |
| 641 | 3300049656 | Ga0501209_184714 | Ga0501209_184714_218_562 | 114 |
| 642 | 3300049675 | Ga0501243_017374 | Ga0501243_017374_617_961 | 114 |
| 643 | 3300049741 | Ga0501079_0006833 | Ga0501079_0006833_5148_5492 | 114 |
| 644 | 3300049741 | Ga0501079_0013918 | Ga0501079_0013918_560_904 | 114 |
| 645 | 3300049741 | Ga0501079_0042123 | Ga0501079_0042123_2320_2673 | 114 |
| 646 | 3300049741 | Ga0501079_0078197 | Ga0501079_0078197_2106_2450 | 114 |
| 647 | 3300049742 | Ga0501080_0094801 | Ga0501080_0094801_274_618 | 114 |
| 648 | 3300049742 | Ga0501080_0285972 | Ga0501080_0285972_872_1258 | 114 |
| 649 | 3300049742 | Ga0501080_0668574 | Ga0501080_0668574_302_646 | 114 |
| 650 | 3300049743 | Ga0501081_0072094 | Ga0501081_0072094_44_388 | 114 |
| 651 | 3300049743 | Ga0501081_0540740 | Ga0501081_0540740_221_565 | 114 |
| 652 | 3300049744 | Ga0501083_0018187 | Ga0501083_0018187_832_1176 | 114 |
| 653 | 3300049744 | Ga0501083_0283768 | Ga0501083_0283768_371_715 | 114 |
| 654 | 3300049744 | Ga0501083_0469649 | Ga0501083_0469649_92_436 | 114 |
| 655 | 3300049822 | Ga0501035_0028926 | Ga0501035_0028926_1618_1962 | 114 |
| 656 | 3300049823 | Ga0501044_0150579 | Ga0501044_0150579_1396_1782 | 114 |
| 657 | 3300049824 | Ga0501045_0020247 | Ga0501045_0020247_716_1060 | 114 |
| 658 | 3300049824 | Ga0501045_0029882 | Ga0501045_0029882_2197_2541 | 114 |
| 659 | 3300049824 | Ga0501045_0163670 | Ga0501045_0163670_1260_1646 | 114 |
| 660 | 3300049824 | Ga0501045_0299004 | Ga0501045_0299004_294_647 | 114 |
| 661 | 3300049824 | Ga0501045_0319609 | Ga0501045_0319609_148_492 | 114 |
| 662 | 3300050507 | nmdc:mga05p37_1828234_c1 | nmdc:mga05p37_1828234_c1_73_417 | 114 |
| 663 | 3300050507 | nmdc:mga05p37_28870_c1 | nmdc:mga05p37_28870_c1_3583_3927 | 114 |
| 664 | 3300050511 | nmdc:mga08y16_2087303_c1 | nmdc:mga08y16_2087303_c1_29_373 | 114 |
| 665 | 3300050512 | nmdc:mga0n895_12219_c1 | nmdc:mga0n895_12219_c1_3276_3620 | 114 |
| 666 | 3300050514 | nmdc:mga08x19_105717_c1 | nmdc:mga08x19_105717_c1_574_966 | 114 |
| 667 | 3300053077 | Ga0495601_0187956 | Ga0495601_0187956_952_1296 | 114 |
| 668 | 3300053077 | Ga0495601_0614307 | Ga0495601_0614307_202_582 | 114 |
| 669 | 3300053078 | Ga0495612_0117115 | Ga0495612_0117115_653_997 | 114 |
| 670 | 3300053084 | Ga0495595_0176113 | Ga0495595_0176113_283_630 | 114 |
| 671 | 3300053085 | Ga0495619_0014093 | Ga0495619_0014093_4168_4548 | 114 |
| 672 | 3300053085 | Ga0495619_0391137 | Ga0495619_0391137_598_942 | 114 |
| 673 | 3300053085 | Ga0495619_0635373 | Ga0495619_0635373_374_718 | 114 |
| 674 | 3300053085 | Ga0495619_0723090 | Ga0495619_0723090_101_469 | 114 |
| 675 | 3300054114 | Ga0501084_0011960 | Ga0501084_0011960_3644_3988 | 114 |
| 676 | 3300054114 | Ga0501084_0020787 | Ga0501084_0020787_3676_4020 | 114 |
| 677 | 3300054114 | Ga0501084_0025627 | Ga0501084_0025627_2421_2774 | 114 |
| 678 | 3300060353 | Ga0501082_0007671 | Ga0501082_0007671_6390_6734 | 114 |
| 679 | 3300060353 | Ga0501082_0337351 | Ga0501082_0337351_22_408 | 114 |
| 680 | 3300060353 | Ga0501082_0447091 | Ga0501082_0447091_371_715 | 114 |
| 681 | 3300061734 | Ga0530510_0014617 | Ga0530510_0014617_2616_2960 | 114 |
| 682 | 3300061734 | Ga0530510_0181195 | Ga0530510_0181195_1035_1379 | 114 |
| 683 | 3300061734 | Ga0530510_0531451 | Ga0530510_0531451_437_781 | 114 |
| 684 | 3300061734 | Ga0530510_1288209 | Ga0530510_1288209_160_546 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4la3-assembly2.cif.gz_B | crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp | 0.8975 | 35 | 109 |
| 5wse-assembly2.cif.gz_C | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8904 | 10 | 110 |
| 6m9s-assembly2.cif.gz_D | crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 | 0.8849 | 35 | 108 |
| 6m9s-assembly1.cif.gz_B | crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 | 0.8842 | 35 | 108 |
| 8ch4-assembly1.cif.gz_C | crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. | 0.8837 | 35 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9066 | 35 | 109 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8918 | 35 | 111 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8753 | 11 | 110 | 2.60.120.10 |
| af_A0A143ZXM2_1983_2072_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.867 | 35 | 108 | 2.60.120.10 |
| 5jspB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8608 | 35 | 114 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5LHQ7-F1-model_v4 | deleted | 0.9968 | 7 | 114 |
|
| AF-A0A4R8WTJ1-F1-model_v4 | Cupin domain-containing protein | 0.9868 | 1 | 114 |
|
| AF-A0A0Q9EMV4-F1-model_v4 | Cupin | 0.9865 | 21 | 114 |
|
| AF-A0JTC5-F1-model_v4 | Cupin 2, conserved barrel domain protein | 0.984 | 1 | 114 |
|
| AF-A0A0Q9LSN7-F1-model_v4 | Cupin | 0.9815 | 1 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar