F474992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 313 | 675 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_1011217|Ga0436361_1011217_590_970 |
| Length | 126 |
| Sequence | MASRPDQAVIYHNPKCSTSRKTLELLRDNGVEPTLVQYLKTPPGGTSRLRGTRGELVTMIRDAGIDVRSAIRKRESLCGELNLADASDDQLLDAMAEHPVLIERPFVVTPKGTRLARPVDRVREIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 6 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 7 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 8 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 188 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 189 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 195 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 196 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 197 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 201 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 202 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 203 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 204 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 205 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 206 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 266 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 300 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 304 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 305 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 306 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 307 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 308 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 312 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 0 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.37 |
| Nodule | 0.15 |
| Rhizoplane | 11.13 |
| Rhizosphere | 66.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10100835 | 3300001989 | Bacteria | 872 |
| 2 | JGI24737J22298_10083722 | 3300001990 | Bacteria | 948 |
| 3 | JGI24735J21928_10062902 | 3300002067 | Bacteria | 1065 |
| 4 | JGI24735J21928_10080511 | 3300002067 | Bacteria | 933 |
| 5 | JGI24744J21845_10002910 | 3300002077 | Bacteria | 3500 |
| 6 | JGI24034J26672_10014121 | 3300002239 | Bacteria | 1216 |
| 7 | Ga0055540_1010510 | 3300003792 | Bacteria | 3075 |
| 8 | Ga0055540_1010819 | 3300003792 | Bacteria | 3007 |
| 9 | Ga0070676_10059747 | 3300005328 | Bacteria | 2262 |
| 10 | Ga0070690_100251515 | 3300005330 | Bacteria | 1250 |
| 11 | Ga0070677_10243331 | 3300005333 | Bacteria | 889 |
| 12 | Ga0068869_101084253 | 3300005334 | Bacteria | 700 |
| 13 | Ga0070666_10014436 | 3300005335 | Bacteria | 5029 |
| 14 | Ga0070666_10066179 | 3300005335 | Bacteria | 2452 |
| 15 | Ga0070682_100003080 | 3300005337 | Bacteria | 9232 |
| 16 | Ga0070682_100038791 | 3300005337 | Bacteria | 2924 |
| 17 | Ga0070682_100066156 | 3300005337 | Bacteria | 2299 |
| 18 | Ga0070682_100695119 | 3300005337 | Bacteria | 815 |
| 19 | Ga0068868_100001163 | 3300005338 | Bacteria | 18048 |
| 20 | Ga0070660_100354907 | 3300005339 | Bacteria | 1208 |
| 21 | Ga0070689_100076385 | 3300005340 | Bacteria | 2624 |
| 22 | Ga0070689_101282709 | 3300005340 | Bacteria | 659 |
| 23 | Ga0070691_10109073 | 3300005341 | Bacteria | 1383 |
| 24 | Ga0070692_10563468 | 3300005345 | Bacteria | 748 |
| 25 | Ga0070668_100001540 | 3300005347 | Bacteria | 16632 |
| 26 | Ga0070668_100013630 | 3300005347 | Bacteria | 6070 |
| 27 | Ga0070668_101183060 | 3300005347 | Bacteria | 692 |
| 28 | Ga0070668_101721540 | 3300005347 | Bacteria | 576 |
| 29 | Ga0070669_100018910 | 3300005353 | Bacteria | 4924 |
| 30 | Ga0070671_100012258 | 3300005355 | Bacteria | 6897 |
| 31 | Ga0070671_100173699 | 3300005355 | Bacteria | 1823 |
| 32 | Ga0070671_100827414 | 3300005355 | Bacteria | 807 |
| 33 | Ga0070674_100003394 | 3300005356 | Bacteria | 8927 |
| 34 | Ga0070674_100004262 | 3300005356 | Bacteria | 8136 |
| 35 | Ga0070674_100389244 | 3300005356 | Bacteria | 1136 |
| 36 | Ga0070674_100771590 | 3300005356 | Bacteria | 828 |
| 37 | Ga0070688_100054103 | 3300005365 | Bacteria | 2513 |
| 38 | Ga0070659_100254920 | 3300005366 | Bacteria | 1455 |
| 39 | Ga0070659_100553719 | 3300005366 | Bacteria | 985 |
| 40 | Ga0070667_100000791 | 3300005367 | Bacteria | 29649 |
| 41 | Ga0070667_100013169 | 3300005367 | Bacteria | 6836 |
| 42 | Ga0070667_100013973 | 3300005367 | Bacteria | 6635 |
| 43 | Ga0070667_100027611 | 3300005367 | Bacteria | 4723 |
| 44 | Ga0070667_100055913 | 3300005367 | Bacteria | 3332 |
| 45 | Ga0070667_100244906 | 3300005367 | Bacteria | 1602 |
| 46 | Ga0070667_101554950 | 3300005367 | Bacteria | 621 |
| 47 | Ga0070667_101987443 | 3300005367 | Bacteria | 548 |
| 48 | Ga0070709_10469052 | 3300005434 | Bacteria | 951 |
| 49 | Ga0070714_100003669 | 3300005435 | Bacteria | 11491 |
| 50 | Ga0070714_100261269 | 3300005435 | Bacteria | 1603 |
| 51 | Ga0070713_100111408 | 3300005436 | Bacteria | 2387 |
| 52 | Ga0070710_10000690 | 3300005437 | Bacteria | 16057 |
| 53 | Ga0070701_10011800 | 3300005438 | Bacteria | 3923 |
| 54 | Ga0070711_100000160 | 3300005439 | Bacteria | 36517 |
| 55 | Ga0070711_100992985 | 3300005439 | Bacteria | 720 |
| 56 | Ga0070705_100056197 | 3300005440 | Bacteria | 2317 |
| 57 | Ga0070700_100072711 | 3300005441 | Bacteria | 2199 |
| 58 | Ga0070700_100566538 | 3300005441 | Bacteria | 885 |
| 59 | Ga0070694_100023962 | 3300005444 | Bacteria | 3934 |
| 60 | Ga0070708_100429423 | 3300005445 | Bacteria | 1246 |
| 61 | Ga0070663_100032577 | 3300005455 | Bacteria | 3594 |
| 62 | Ga0070663_100358948 | 3300005455 | Bacteria | 1182 |
| 63 | Ga0070678_100000117 | 3300005456 | Bacteria | 31126 |
| 64 | Ga0070678_100747911 | 3300005456 | Bacteria | 884 |
| 65 | Ga0070678_101724462 | 3300005456 | Bacteria | 590 |
| 66 | Ga0070662_100016792 | 3300005457 | Bacteria | 4921 |
| 67 | Ga0070662_101505328 | 3300005457 | Bacteria | 580 |
| 68 | Ga0068867_100004067 | 3300005459 | Bacteria | 10296 |
| 69 | Ga0070685_10086894 | 3300005466 | Bacteria | 1886 |
| 70 | Ga0070684_100318328 | 3300005535 | Bacteria | 1429 |
| 71 | Ga0070684_101335652 | 3300005535 | Bacteria | 675 |
| 72 | Ga0068853_100023917 | 3300005539 | Bacteria | 5120 |
| 73 | Ga0068853_100419449 | 3300005539 | Bacteria | 1255 |
| 74 | Ga0068853_100470462 | 3300005539 | Bacteria | 1184 |
| 75 | Ga0070686_100801663 | 3300005544 | Bacteria | 759 |
| 76 | Ga0070696_100010017 | 3300005546 | Bacteria | 6339 |
| 77 | Ga0070696_100566175 | 3300005546 | Bacteria | 912 |
| 78 | Ga0070693_100149329 | 3300005547 | Bacteria | 1479 |
| 79 | Ga0070693_100946008 | 3300005547 | Bacteria | 648 |
| 80 | Ga0070665_100007248 | 3300005548 | Bacteria | 11267 |
| 81 | Ga0070665_100009840 | 3300005548 | Bacteria | 9663 |
| 82 | Ga0070665_101297107 | 3300005548 | Bacteria | 738 |
| 83 | Ga0070665_102181598 | 3300005548 | Bacteria | 558 |
| 84 | Ga0070704_100019594 | 3300005549 | Bacteria | 4349 |
| 85 | Ga0068855_100228057 | 3300005563 | Bacteria | 2087 |
| 86 | Ga0068855_100753020 | 3300005563 | Bacteria | 1038 |
| 87 | Ga0068854_100009069 | 3300005578 | Bacteria | 6411 |
| 88 | Ga0068856_101110798 | 3300005614 | Bacteria | 808 |
| 89 | Ga0068856_102256597 | 3300005614 | Bacteria | 553 |
| 90 | Ga0070702_100050964 | 3300005615 | Bacteria | 2367 |
| 91 | Ga0070702_101432387 | 3300005615 | Bacteria | 566 |
| 92 | Ga0068852_101148598 | 3300005616 | Bacteria | 797 |
| 93 | Ga0068859_100001042 | 3300005617 | Bacteria | 28409 |
| 94 | Ga0068859_100077098 | 3300005617 | Bacteria | 3374 |
| 95 | Ga0068859_102748165 | 3300005617 | Bacteria | 541 |
| 96 | Ga0068864_100317667 | 3300005618 | Bacteria | 1462 |
| 97 | Ga0068864_100852037 | 3300005618 | Bacteria | 898 |
| 98 | Ga0068864_101833201 | 3300005618 | Bacteria | 612 |
| 99 | Ga0068866_10000441 | 3300005718 | Bacteria | 19171 |
| 100 | Ga0068866_10371858 | 3300005718 | Bacteria | 914 |
| 101 | Ga0068866_10492337 | 3300005718 | Bacteria | 810 |
| 102 | Ga0068866_10762682 | 3300005718 | Bacteria | 669 |
| 103 | Ga0068861_100003820 | 3300005719 | Bacteria | 10055 |
| 104 | Ga0068851_10602360 | 3300005834 | Bacteria | 669 |
| 105 | Ga0068863_100001025 | 3300005841 | Bacteria | 27909 |
| 106 | Ga0068863_100007351 | 3300005841 | Bacteria | 10783 |
| 107 | Ga0068863_100529594 | 3300005841 | Bacteria | 1162 |
| 108 | Ga0068858_100004832 | 3300005842 | Bacteria | 13203 |
| 109 | Ga0068858_100016818 | 3300005842 | Bacteria | 6869 |
| 110 | Ga0068858_100858020 | 3300005842 | Bacteria | 887 |
| 111 | Ga0068858_101336074 | 3300005842 | Bacteria | 706 |
| 112 | Ga0068860_100000087 | 3300005843 | Bacteria | 158242 |
| 113 | Ga0068860_100008728 | 3300005843 | Bacteria | 10094 |
| 114 | Ga0068860_100103874 | 3300005843 | Bacteria | 2712 |
| 115 | Ga0068860_100577544 | 3300005843 | Bacteria | 1128 |
| 116 | Ga0068860_100731000 | 3300005843 | Bacteria | 1001 |
| 117 | Ga0068862_100000077 | 3300005844 | Bacteria | 116781 |
| 118 | Ga0068862_100022465 | 3300005844 | Bacteria | 5276 |
| 119 | Ga0068862_100633339 | 3300005844 | Bacteria | 1030 |
| 120 | Ga0081455_10050617 | 3300005937 | Bacteria | 3571 |
| 121 | Ga0081538_10051013 | 3300005981 | Bacteria | 2490 |
| 122 | Ga0075365_10008384 | 3300006038 | Bacteria | 5862 |
| 123 | Ga0075365_10021990 | 3300006038 | Bacteria | 3987 |
| 124 | Ga0075365_10155132 | 3300006038 | Bacteria | 1594 |
| 125 | Ga0075368_10032217 | 3300006042 | Bacteria | 2035 |
| 126 | Ga0075363_100015328 | 3300006048 | Bacteria | 3766 |
| 127 | Ga0075363_100045147 | 3300006048 | Bacteria | 2336 |
| 128 | Ga0075363_100065296 | 3300006048 | Bacteria | 1967 |
| 129 | Ga0075363_100067780 | 3300006048 | Bacteria | 1934 |
| 130 | Ga0075363_100092743 | 3300006048 | Bacteria | 1664 |
| 131 | Ga0075363_100136569 | 3300006048 | Bacteria | 1378 |
| 132 | Ga0075363_100352486 | 3300006048 | Bacteria | 860 |
| 133 | Ga0075363_100903141 | 3300006048 | Bacteria | 541 |
| 134 | Ga0075364_10001414 | 3300006051 | Bacteria | 13011 |
| 135 | Ga0075364_10008782 | 3300006051 | Bacteria | 6047 |
| 136 | Ga0075364_10020127 | 3300006051 | Bacteria | 4196 |
| 137 | Ga0075364_10027813 | 3300006051 | Bacteria | 3615 |
| 138 | Ga0075364_10080694 | 3300006051 | Bacteria | 2151 |
| 139 | Ga0075364_10095173 | 3300006051 | Bacteria | 1980 |
| 140 | Ga0075364_10117299 | 3300006051 | Bacteria | 1780 |
| 141 | Ga0075364_10152366 | 3300006051 | Bacteria | 1558 |
| 142 | Ga0075364_10157763 | 3300006051 | Bacteria | 1531 |
| 143 | Ga0070715_10035753 | 3300006163 | Bacteria | 2045 |
| 144 | Ga0070715_10569780 | 3300006163 | Bacteria | 659 |
| 145 | Ga0070716_100009944 | 3300006173 | Bacteria | 4757 |
| 146 | Ga0070716_100368460 | 3300006173 | Bacteria | 1023 |
| 147 | Ga0070712_100004671 | 3300006175 | Bacteria | 8471 |
| 148 | Ga0070712_100305967 | 3300006175 | Bacteria | 1288 |
| 149 | Ga0075362_10028392 | 3300006177 | Bacteria | 2403 |
| 150 | Ga0075362_10054120 | 3300006177 | Bacteria | 1803 |
| 151 | Ga0075362_10255398 | 3300006177 | Bacteria | 863 |
| 152 | Ga0075362_10324695 | 3300006177 | Bacteria | 767 |
| 153 | Ga0075362_10487996 | 3300006177 | Bacteria | 629 |
| 154 | Ga0075367_10019596 | 3300006178 | Bacteria | 3753 |
| 155 | Ga0075367_10122378 | 3300006178 | Bacteria | 1604 |
| 156 | Ga0075367_10150722 | 3300006178 | Bacteria | 1443 |
| 157 | Ga0075367_10238196 | 3300006178 | Bacteria | 1140 |
| 158 | Ga0075367_10357597 | 3300006178 | Bacteria | 922 |
| 159 | Ga0075369_10004544 | 3300006186 | Bacteria | 5137 |
| 160 | Ga0075369_10017401 | 3300006186 | Bacteria | 2913 |
| 161 | Ga0075369_10054488 | 3300006186 | Bacteria | 1736 |
| 162 | Ga0075369_10110257 | 3300006186 | Bacteria | 1240 |
| 163 | Ga0075369_10158156 | 3300006186 | Bacteria | 1038 |
| 164 | Ga0075369_10210800 | 3300006186 | Bacteria | 898 |
| 165 | Ga0075369_10275887 | 3300006186 | Bacteria | 783 |
| 166 | Ga0075369_10584235 | 3300006186 | Bacteria | 534 |
| 167 | Ga0075366_10130591 | 3300006195 | Bacteria | 1516 |
| 168 | Ga0075370_10024765 | 3300006353 | Bacteria | 3318 |
| 169 | Ga0075370_10055517 | 3300006353 | Bacteria | 2250 |
| 170 | Ga0075370_10090521 | 3300006353 | Bacteria | 1764 |
| 171 | Ga0075370_10353010 | 3300006353 | Bacteria | 879 |
| 172 | Ga0068865_100090172 | 3300006881 | Bacteria | 2222 |
| 173 | Ga0068865_101734730 | 3300006881 | Bacteria | 563 |
| 174 | Ga0097620_100001042 | 3300006931 | Bacteria | 28409 |
| 175 | Ga0097620_100077087 | 3300006931 | Bacteria | 3374 |
| 176 | Ga0097620_102747959 | 3300006931 | Bacteria | 541 |
| 177 | Ga0075435_101459257 | 3300007076 | Bacteria | 600 |
| 178 | Ga0105251_10529354 | 3300009011 | Bacteria | 553 |
| 179 | Ga0105250_10378323 | 3300009092 | Bacteria | 624 |
| 180 | Ga0105245_10008338 | 3300009098 | Bacteria | 9053 |
| 181 | Ga0105245_10611967 | 3300009098 | Bacteria | 1117 |
| 182 | Ga0105245_12432130 | 3300009098 | Bacteria | 577 |
| 183 | Ga0105247_10000060 | 3300009101 | Bacteria | 127879 |
| 184 | Ga0105247_10000298 | 3300009101 | Bacteria | 44765 |
| 185 | Ga0114129_12700063 | 3300009147 | Bacteria | 592 |
| 186 | Ga0105243_10000700 | 3300009148 | Bacteria | 32410 |
| 187 | Ga0105241_11597817 | 3300009174 | Bacteria | 630 |
| 188 | Ga0105242_10000325 | 3300009176 | Bacteria | 38289 |
| 189 | Ga0105242_11214453 | 3300009176 | Bacteria | 774 |
| 190 | Ga0105248_10000050 | 3300009177 | Bacteria | 152667 |
| 191 | Ga0105248_10088134 | 3300009177 | Bacteria | 3493 |
| 192 | Ga0105248_13114414 | 3300009177 | Bacteria | 528 |
| 193 | Ga0105237_10006011 | 3300009545 | Bacteria | 13581 |
| 194 | Ga0105237_10011826 | 3300009545 | Bacteria | 9231 |
| 195 | Ga0105237_12693346 | 3300009545 | Bacteria | 508 |
| 196 | Ga0105238_10217724 | 3300009551 | Bacteria | 1885 |
| 197 | Ga0105238_10829792 | 3300009551 | Bacteria | 941 |
| 198 | Ga0105238_11169866 | 3300009551 | Bacteria | 793 |
| 199 | Ga0105249_10000042 | 3300009553 | Bacteria | 195242 |
| 200 | Ga0105249_10000470 | 3300009553 | Bacteria | 37482 |
| 201 | Ga0105249_10052537 | 3300009553 | Bacteria | 3722 |
| 202 | Ga0105249_10463722 | 3300009553 | Bacteria | 1307 |
| 203 | Ga0099796_10029743 | 3300010159 | Bacteria | 1766 |
| 204 | Ga0105239_10016841 | 3300010375 | Bacteria | 8078 |
| 205 | Ga0105239_10024596 | 3300010375 | Bacteria | 6634 |
| 206 | Ga0105239_10415751 | 3300010375 | Bacteria | 1523 |
| 207 | Ga0105239_11068124 | 3300010375 | Bacteria | 929 |
| 208 | Ga0105246_10268090 | 3300011119 | Bacteria | 1364 |
| 209 | Ga0105246_10422698 | 3300011119 | Bacteria | 1113 |
| 210 | Ga0105246_10700830 | 3300011119 | Bacteria | 887 |
| 211 | Ga0157369_10785184 | 3300013105 | Bacteria | 979 |
| 212 | Ga0157378_10013827 | 3300013297 | Bacteria | 7058 |
| 213 | Ga0157378_12874990 | 3300013297 | Bacteria | 534 |
| 214 | Ga0163162_10089165 | 3300013306 | Bacteria | 3164 |
| 215 | Ga0163162_10270692 | 3300013306 | Bacteria | 1830 |
| 216 | Ga0163162_11128478 | 3300013306 | Bacteria | 889 |
| 217 | Ga0163162_11335687 | 3300013306 | Bacteria | 815 |
| 218 | Ga0157372_10048234 | 3300013307 | Bacteria | 4734 |
| 219 | Ga0157372_10673523 | 3300013307 | Bacteria | 1204 |
| 220 | Ga0157375_10467692 | 3300013308 | Bacteria | 1426 |
| 221 | Ga0163163_10175729 | 3300014325 | Bacteria | 2188 |
| 222 | Ga0163163_10245027 | 3300014325 | Bacteria | 1842 |
| 223 | Ga0157380_10019608 | 3300014326 | Bacteria | 5041 |
| 224 | Ga0157377_10476126 | 3300014745 | Bacteria | 867 |
| 225 | Ga0157379_10002499 | 3300014968 | Bacteria | 15398 |
| 226 | Ga0157376_10135466 | 3300014969 | Bacteria | 2203 |
| 227 | Ga0163161_10027061 | 3300017792 | Bacteria | 4066 |
| 228 | Ga0213876_10002110 | 3300021384 | Bacteria | 11766 |
| 229 | Ga0213875_10036304 | 3300021388 | Bacteria | 2324 |
| 230 | Ga0213875_10081020 | 3300021388 | Bacteria | 1514 |
| 231 | Ga0209051_1001345 | 3300025303 | Bacteria | 21360 |
| 232 | Ga0209051_1010755 | 3300025303 | Bacteria | 4581 |
| 233 | Ga0207692_10007732 | 3300025898 | Bacteria | 4417 |
| 234 | Ga0207642_10001048 | 3300025899 | Bacteria | 8570 |
| 235 | Ga0207642_10251767 | 3300025899 | Bacteria | 1003 |
| 236 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 237 | Ga0207710_10023951 | 3300025900 | Bacteria | 2627 |
| 238 | Ga0207688_10344949 | 3300025901 | Bacteria | 917 |
| 239 | Ga0207688_10914849 | 3300025901 | Bacteria | 555 |
| 240 | Ga0207680_10014842 | 3300025903 | Bacteria | 4047 |
| 241 | Ga0207680_10210406 | 3300025903 | Bacteria | 1329 |
| 242 | Ga0207647_10190458 | 3300025904 | Bacteria | 1189 |
| 243 | Ga0207685_10150813 | 3300025905 | Bacteria | 1052 |
| 244 | Ga0207699_11100125 | 3300025906 | Bacteria | 588 |
| 245 | Ga0207645_10706452 | 3300025907 | Bacteria | 685 |
| 246 | Ga0207671_10007606 | 3300025914 | Bacteria | 9375 |
| 247 | Ga0207671_10074011 | 3300025914 | Bacteria | 2545 |
| 248 | Ga0207671_10402997 | 3300025914 | Bacteria | 1088 |
| 249 | Ga0207693_10000754 | 3300025915 | Bacteria | 29034 |
| 250 | Ga0207663_10004087 | 3300025916 | Bacteria | 7234 |
| 251 | Ga0207663_10697294 | 3300025916 | Bacteria | 804 |
| 252 | Ga0207657_11413786 | 3300025919 | Bacteria | 522 |
| 253 | Ga0207652_11098335 | 3300025921 | Bacteria | 696 |
| 254 | Ga0207681_10034834 | 3300025923 | Bacteria | 3313 |
| 255 | Ga0207681_10071094 | 3300025923 | Bacteria | 2426 |
| 256 | Ga0207694_10051458 | 3300025924 | Bacteria | 3193 |
| 257 | Ga0207650_10354730 | 3300025925 | Bacteria | 1207 |
| 258 | Ga0207687_10003034 | 3300025927 | Bacteria | 11378 |
| 259 | Ga0207687_11440980 | 3300025927 | Bacteria | 592 |
| 260 | Ga0207700_10451888 | 3300025928 | Bacteria | 1133 |
| 261 | Ga0207664_10099464 | 3300025929 | Bacteria | 2400 |
| 262 | Ga0207664_10539498 | 3300025929 | Bacteria | 1046 |
| 263 | Ga0207664_10733868 | 3300025929 | Bacteria | 888 |
| 264 | Ga0207644_10019755 | 3300025931 | Bacteria | 4574 |
| 265 | Ga0207644_10600516 | 3300025931 | Bacteria | 914 |
| 266 | Ga0207644_10647832 | 3300025931 | Bacteria | 879 |
| 267 | Ga0207690_10222592 | 3300025932 | Bacteria | 1445 |
| 268 | Ga0207706_10021979 | 3300025933 | Bacteria | 5726 |
| 269 | Ga0207706_10823668 | 3300025933 | Bacteria | 787 |
| 270 | Ga0207686_10002494 | 3300025934 | Bacteria | 9999 |
| 271 | Ga0207686_10644655 | 3300025934 | Bacteria | 837 |
| 272 | Ga0207709_10007107 | 3300025935 | Bacteria | 6252 |
| 273 | Ga0207709_10174362 | 3300025935 | Bacteria | 1512 |
| 274 | Ga0207670_10496316 | 3300025936 | Bacteria | 990 |
| 275 | Ga0207669_10001189 | 3300025937 | Bacteria | 11053 |
| 276 | Ga0207669_10021180 | 3300025937 | Bacteria | 3426 |
| 277 | Ga0207704_10002289 | 3300025938 | Bacteria | 8608 |
| 278 | Ga0207665_10009094 | 3300025939 | Bacteria | 6524 |
| 279 | Ga0207665_10699682 | 3300025939 | Bacteria | 797 |
| 280 | Ga0207711_10001406 | 3300025941 | Bacteria | 22551 |
| 281 | Ga0207711_10032792 | 3300025941 | Bacteria | 4394 |
| 282 | Ga0207689_10031372 | 3300025942 | Bacteria | 4424 |
| 283 | Ga0207689_10752573 | 3300025942 | Bacteria | 822 |
| 284 | Ga0207679_11402795 | 3300025945 | Bacteria | 641 |
| 285 | Ga0207667_10823680 | 3300025949 | Bacteria | 924 |
| 286 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 287 | Ga0207712_10001196 | 3300025961 | Bacteria | 17936 |
| 288 | Ga0207668_10002892 | 3300025972 | Bacteria | 10073 |
| 289 | Ga0207668_10006413 | 3300025972 | Bacteria | 6953 |
| 290 | Ga0207668_10160530 | 3300025972 | Bacteria | 1751 |
| 291 | Ga0207668_10258034 | 3300025972 | Bacteria | 1419 |
| 292 | Ga0207668_11956577 | 3300025972 | Bacteria | 528 |
| 293 | Ga0207640_10009045 | 3300025981 | Bacteria | 5558 |
| 294 | Ga0207640_10267566 | 3300025981 | Bacteria | 1335 |
| 295 | Ga0207658_10000677 | 3300025986 | Bacteria | 29704 |
| 296 | Ga0207658_10001961 | 3300025986 | Bacteria | 15354 |
| 297 | Ga0207658_10007671 | 3300025986 | Bacteria | 7347 |
| 298 | Ga0207658_10061168 | 3300025986 | Bacteria | 2813 |
| 299 | Ga0207658_10125469 | 3300025986 | Bacteria | 2053 |
| 300 | Ga0207658_10697148 | 3300025986 | Bacteria | 917 |
| 301 | Ga0207658_11164123 | 3300025986 | Bacteria | 705 |
| 302 | Ga0207677_10047066 | 3300026023 | Bacteria | 2893 |
| 303 | Ga0207677_10210790 | 3300026023 | Bacteria | 1551 |
| 304 | Ga0207677_10474370 | 3300026023 | Bacteria | 1077 |
| 305 | Ga0207703_10009823 | 3300026035 | Bacteria | 7505 |
| 306 | Ga0207703_10028562 | 3300026035 | Bacteria | 4397 |
| 307 | Ga0207703_10155468 | 3300026035 | Bacteria | 1998 |
| 308 | Ga0207703_10416991 | 3300026035 | Bacteria | 1249 |
| 309 | Ga0207703_10793125 | 3300026035 | Bacteria | 904 |
| 310 | Ga0207703_10930306 | 3300026035 | Bacteria | 833 |
| 311 | Ga0207639_10007030 | 3300026041 | Bacteria | 7672 |
| 312 | Ga0207639_10117806 | 3300026041 | Bacteria | 2177 |
| 313 | Ga0207678_10009360 | 3300026067 | Bacteria | 8622 |
| 314 | Ga0207678_10307275 | 3300026067 | Bacteria | 1363 |
| 315 | Ga0207678_11405819 | 3300026067 | Bacteria | 617 |
| 316 | Ga0207708_10006796 | 3300026075 | Bacteria | 8463 |
| 317 | Ga0207708_10416206 | 3300026075 | Bacteria | 1114 |
| 318 | Ga0207702_12139177 | 3300026078 | Bacteria | 549 |
| 319 | Ga0207641_10000849 | 3300026088 | Bacteria | 32380 |
| 320 | Ga0207641_10020040 | 3300026088 | Bacteria | 5491 |
| 321 | Ga0207641_10026225 | 3300026088 | Bacteria | 4809 |
| 322 | Ga0207641_10060560 | 3300026088 | Bacteria | 3227 |
| 323 | Ga0207648_10008331 | 3300026089 | Bacteria | 10058 |
| 324 | Ga0207676_10241137 | 3300026095 | Bacteria | 1622 |
| 325 | Ga0207676_10780961 | 3300026095 | Bacteria | 931 |
| 326 | Ga0207676_11208545 | 3300026095 | Bacteria | 749 |
| 327 | Ga0207675_100007850 | 3300026118 | Bacteria | 10069 |
| 328 | Ga0207675_100260493 | 3300026118 | Bacteria | 1680 |
| 329 | Ga0207675_101094830 | 3300026118 | Bacteria | 816 |
| 330 | Ga0207675_101991034 | 3300026118 | Bacteria | 598 |
| 331 | Ga0207683_10000984 | 3300026121 | Bacteria | 26143 |
| 332 | Ga0207683_10290362 | 3300026121 | Bacteria | 1495 |
| 333 | Ga0207683_10741899 | 3300026121 | Bacteria | 911 |
| 334 | Ga0207698_10199898 | 3300026142 | Bacteria | 1789 |
| 335 | Ga0209813_10490391 | 3300027866 | Bacteria | 508 |
| 336 | Ga0268266_10006935 | 3300028379 | Bacteria | 10305 |
| 337 | Ga0268266_10763785 | 3300028379 | Bacteria | 933 |
| 338 | Ga0268266_11460448 | 3300028379 | Bacteria | 659 |
| 339 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 340 | Ga0268265_10026662 | 3300028380 | Bacteria | 4113 |
| 341 | Ga0268265_10955307 | 3300028380 | Bacteria | 844 |
| 342 | Ga0268264_10000150 | 3300028381 | Bacteria | 158263 |
| 343 | Ga0268264_10046360 | 3300028381 | Bacteria | 3610 |
| 344 | Ga0268264_10320951 | 3300028381 | Bacteria | 1464 |
| 345 | Ga0268264_11048984 | 3300028381 | Bacteria | 823 |
| 346 | Ga0265327_10002508 | 3300031251 | Bacteria | 19190 |
| 347 | Ga0307405_10073751 | 3300031731 | Bacteria | 2205 |
| 348 | Ga0307413_11210083 | 3300031824 | Bacteria | 657 |
| 349 | Ga0307410_10083330 | 3300031852 | Bacteria | 2251 |
| 350 | Ga0307410_11349601 | 3300031852 | Bacteria | 625 |
| 351 | Ga0307406_12073894 | 3300031901 | Bacteria | 509 |
| 352 | Ga0307407_10251828 | 3300031903 | Bacteria | 1210 |
| 353 | Ga0307412_10208993 | 3300031911 | Bacteria | 1488 |
| 354 | Ga0307409_100004098 | 3300031995 | Bacteria | 8112 |
| 355 | Ga0307409_100039873 | 3300031995 | Bacteria | 3490 |
| 356 | Ga0307409_100729563 | 3300031995 | Bacteria | 993 |
| 357 | Ga0307409_101209931 | 3300031995 | Bacteria | 779 |
| 358 | Ga0307416_100162681 | 3300032002 | Bacteria | 2065 |
| 359 | Ga0307414_11019421 | 3300032004 | Bacteria | 762 |
| 360 | Ga0307411_10510527 | 3300032005 | Bacteria | 1018 |
| 361 | Ga0307415_100303069 | 3300032126 | Bacteria | 1324 |
| 362 | Ga0373930_0137645 | 3300034816 | Bacteria | 605 |
| 363 | Ga0373949_0105793 | 3300035090 | Bacteria | 776 |
| 364 | Ga0373951_0017482 | 3300035091 | Bacteria | 1623 |
| 365 | Ga0373932_0400942 | 3300035112 | Bacteria | 531 |
| 366 | Ga0373962_0010540 | 3300035242 | Bacteria | 2307 |
| 367 | Ga0373962_0137281 | 3300035242 | Bacteria | 792 |
| 368 | Ga0373931_0018006 | 3300035691 | Bacteria | 3505 |
| 369 | Ga0436364_0780709 | 3300037853 | Bacteria | 1822 |
| 370 | Ga0436364_1308388 | 3300037853 | Bacteria | 35210 |
| 371 | Ga0400484_01826 | 3300038725 | Bacteria | 3997 |
| 372 | Ga0400484_11786 | 3300038725 | Unclassified | 2328 |
| 373 | Ga0400488_60352 | 3300038741 | Bacteria | 1648 |
| 374 | Ga0400483_095200 | 3300039062 | Bacteria | 2776 |
| 375 | Ga0400483_112801 | 3300039062 | Unclassified | 3984 |
| 376 | Ga0400483_277034 | 3300039062 | Unclassified | 1013 |
| 377 | Ga0436365_1646946 | 3300039437 | Bacteria | 25220 |
| 378 | Ga0436365_1657364 | 3300039437 | Bacteria | 1954 |
| 379 | Ga0436360_0672569 | 3300039438 | Bacteria | 932 |
| 380 | Ga0436361_0106752 | 3300039447 | Bacteria | 620 |
| 381 | Ga0436361_1011217 | 3300039447 | Bacteria | 1891 |
| 382 | Ga0436363_0344303 | 3300039450 | Bacteria | 1962 |
| 383 | Ga0436363_1376063 | 3300039450 | Bacteria | 1065 |
| 384 | Ga0439461_0000950 | 3300041410 | Bacteria | 4341 |
| 385 | Ga0439461_0007259 | 3300041410 | Bacteria | 1956 |
| 386 | Ga0439461_0096349 | 3300041410 | Bacteria | 715 |
| 387 | Ga0439466_0009584 | 3300041411 | Bacteria | 3620 |
| 388 | Ga0439466_0023180 | 3300041411 | Bacteria | 2185 |
| 389 | Ga0439465_0002866 | 3300041413 | Bacteria | 5645 |
| 390 | Ga0439465_0002904 | 3300041413 | Bacteria | 5617 |
| 391 | Ga0439465_0009759 | 3300041413 | Bacteria | 3024 |
| 392 | Ga0439465_0047333 | 3300041413 | Bacteria | 1401 |
| 393 | Ga0451787_726021 | 3300041441 | Bacteria | 622 |
| 394 | Ga0451793_0435955 | 3300041452 | Bacteria | 560 |
| 395 | Ga0451795_0833080 | 3300041456 | Bacteria | 502 |
| 396 | Ga0451841_0373935 | 3300041498 | Bacteria | 687 |
| 397 | Ga0451851_0672866 | 3300041507 | Bacteria | 624 |
| 398 | Ga0439431_0003200 | 3300041997 | Bacteria | 3599 |
| 399 | Ga0439431_0008285 | 3300041997 | Bacteria | 2334 |
| 400 | Ga0439442_005501 | 3300042002 | Bacteria | 2532 |
| 401 | Ga0439442_026101 | 3300042002 | Bacteria | 1216 |
| 402 | Ga0439445_0060977 | 3300042004 | Bacteria | 1031 |
| 403 | Ga0439450_222286 | 3300042008 | Bacteria | 509 |
| 404 | Ga0439462_0163314 | 3300042015 | Bacteria | 629 |
| 405 | Ga0439434_0029139 | 3300042435 | Bacteria | 1673 |
| 406 | Ga0439434_0192560 | 3300042435 | Bacteria | 685 |
| 407 | Ga0439459_0024743 | 3300042438 | Bacteria | 1180 |
| 408 | Ga0439459_0032932 | 3300042438 | Bacteria | 1065 |
| 409 | Ga0466969_0072566 | 3300044656 | Bacteria | 1653 |
| 410 | Ga0466969_0210912 | 3300044656 | Bacteria | 885 |
| 411 | Ga0466972_0008599 | 3300044658 | Bacteria | 5121 |
| 412 | Ga0466972_0019835 | 3300044658 | Bacteria | 3361 |
| 413 | Ga0466972_0021251 | 3300044658 | Bacteria | 3238 |
| 414 | Ga0466972_0189564 | 3300044658 | Bacteria | 964 |
| 415 | Ga0466965_0000697 | 3300044683 | Bacteria | 12460 |
| 416 | Ga0466965_0002661 | 3300044683 | Bacteria | 7643 |
| 417 | Ga0466965_0010937 | 3300044683 | Bacteria | 4243 |
| 418 | Ga0466965_0106659 | 3300044683 | Bacteria | 1437 |
| 419 | Ga0466966_0001105 | 3300044684 | Bacteria | 17291 |
| 420 | Ga0466966_0001218 | 3300044684 | Bacteria | 16526 |
| 421 | Ga0466966_0028710 | 3300044684 | Bacteria | 3621 |
| 422 | Ga0466966_0351351 | 3300044684 | Bacteria | 886 |
| 423 | Ga0466961_0001949 | 3300044693 | Bacteria | 12864 |
| 424 | Ga0466961_0053399 | 3300044693 | Bacteria | 2578 |
| 425 | Ga0466961_0104802 | 3300044693 | Bacteria | 1780 |
| 426 | Ga0466963_0012616 | 3300044694 | Bacteria | 5176 |
| 427 | Ga0466963_0362558 | 3300044694 | Bacteria | 1021 |
| 428 | Ga0466963_0421711 | 3300044694 | Bacteria | 941 |
| 429 | Ga0466964_0107557 | 3300044706 | Bacteria | 1239 |
| 430 | Ga0466964_0726222 | 3300044706 | Bacteria | 556 |
| 431 | Ga0466971_0003761 | 3300044719 | Bacteria | 6496 |
| 432 | Ga0466971_0022480 | 3300044719 | Bacteria | 2810 |
| 433 | Ga0466971_0133942 | 3300044719 | Bacteria | 1152 |
| 434 | Ga0466971_0150847 | 3300044719 | Bacteria | 1085 |
| 435 | Ga0466968_0001182 | 3300044735 | Bacteria | 9248 |
| 436 | Ga0466968_0001521 | 3300044735 | Bacteria | 8322 |
| 437 | Ga0466968_0033488 | 3300044735 | Bacteria | 2141 |
| 438 | Ga0466970_0015246 | 3300044765 | Bacteria | 3951 |
| 439 | Ga0466970_0040721 | 3300044765 | Bacteria | 2467 |
| 440 | Ga0466970_0077835 | 3300044765 | Bacteria | 1788 |
| 441 | Ga0466970_0379011 | 3300044765 | Bacteria | 805 |
| 442 | Ga0466957_0000981 | 3300044842 | Bacteria | 14668 |
| 443 | Ga0466957_0003667 | 3300044842 | Bacteria | 8475 |
| 444 | Ga0466957_0031268 | 3300044842 | Bacteria | 3180 |
| 445 | Ga0466957_0041631 | 3300044842 | Bacteria | 2778 |
| 446 | Ga0466957_0065523 | 3300044842 | Bacteria | 2238 |
| 447 | Ga0466960_0000319 | 3300044901 | Bacteria | 16503 |
| 448 | Ga0466960_0002911 | 3300044901 | Bacteria | 6510 |
| 449 | Ga0466959_0000774 | 3300045049 | Bacteria | 18746 |
| 450 | Ga0466959_0001867 | 3300045049 | Bacteria | 13243 |
| 451 | Ga0466959_0118544 | 3300045049 | Bacteria | 1883 |
| 452 | Ga0466959_0314834 | 3300045049 | Bacteria | 1070 |
| 453 | Ga0466958_0001942 | 3300045836 | Bacteria | 10134 |
| 454 | Ga0466958_0003868 | 3300045836 | Bacteria | 7832 |
| 455 | Ga0466958_0347027 | 3300045836 | Bacteria | 955 |
| 456 | Ga0466958_0352454 | 3300045836 | Bacteria | 948 |
| 457 | Ga0466958_0507472 | 3300045836 | Bacteria | 783 |
| 458 | Ga0466967_0006454 | 3300045976 | Bacteria | 8301 |
| 459 | Ga0466967_0091130 | 3300045976 | Bacteria | 2770 |
| 460 | Ga0466967_0198657 | 3300045976 | Bacteria | 1898 |
| 461 | Ga0466967_0256355 | 3300045976 | Bacteria | 1672 |
| 462 | Ga0466967_0334416 | 3300045976 | Bacteria | 1463 |
| 463 | Ga0466967_0341220 | 3300045976 | Bacteria | 1449 |
| 464 | Ga0466967_0709277 | 3300045976 | Bacteria | 997 |
| 465 | Ga0466967_0988656 | 3300045976 | Bacteria | 838 |
| 466 | Ga0466967_1016565 | 3300045976 | Bacteria | 825 |
| 467 | Ga0466967_1186410 | 3300045976 | Bacteria | 761 |
| 468 | Ga0466967_1537566 | 3300045976 | Bacteria | 663 |
| 469 | Ga0495629_0050017 | 3300046459 | Bacteria | 2928 |
| 470 | Ga0495641_0171717 | 3300046461 | Bacteria | 970 |
| 471 | Ga0495616_0191824 | 3300046513 | Bacteria | 903 |
| 472 | Ga0495620_0060421 | 3300046515 | Bacteria | 1580 |
| 473 | Ga0495648_0015564 | 3300046524 | Bacteria | 5518 |
| 474 | Ga0495654_0180187 | 3300046530 | Bacteria | 915 |
| 475 | Ga0495665_0119069 | 3300046531 | Bacteria | 1383 |
| 476 | Ga0495640_0048156 | 3300046533 | Bacteria | 2947 |
| 477 | Ga0495668_0060829 | 3300046616 | Bacteria | 2083 |
| 478 | Ga0495611_0052314 | 3300046648 | Bacteria | 1842 |
| 479 | Ga0495625_0336218 | 3300046660 | Bacteria | 958 |
| 480 | Ga0495635_0190327 | 3300046663 | Bacteria | 1393 |
| 481 | Ga0495599_0283133 | 3300046678 | Bacteria | 1004 |
| 482 | Ga0495658_0099821 | 3300046683 | Bacteria | 1731 |
| 483 | Ga0495671_0080694 | 3300046692 | Bacteria | 1594 |
| 484 | Ga0495649_0266459 | 3300046694 | Bacteria | 877 |
| 485 | Ga0495581_0206725 | 3300047315 | Bacteria | 1148 |
| 486 | Ga0495672_0003978 | 3300047320 | Bacteria | 12368 |
| 487 | Ga0495672_0107141 | 3300047320 | Bacteria | 1506 |
| 488 | Ga0495676_0221348 | 3300047321 | Bacteria | 1304 |
| 489 | Ga0495673_0002945 | 3300047469 | Bacteria | 11483 |
| 490 | Ga0495593_0047404 | 3300047673 | Bacteria | 2286 |
| 491 | Ga0495626_0234241 | 3300048091 | Bacteria | 741 |
| 492 | Ga0496100_0000084 | 3300048903 | Bacteria | 53649 |
| 493 | Ga0496100_0000939 | 3300048903 | Bacteria | 13931 |
| 494 | Ga0496100_0001148 | 3300048903 | Bacteria | 12879 |
| 495 | Ga0496100_0001530 | 3300048903 | Bacteria | 11346 |
| 496 | Ga0496100_0386033 | 3300048903 | Bacteria | 1064 |
| 497 | Ga0496100_0642147 | 3300048903 | Bacteria | 826 |
| 498 | Ga0496100_0804696 | 3300048903 | Bacteria | 736 |
| 499 | Ga0496100_1186075 | 3300048903 | Bacteria | 602 |
| 500 | Ga0496101_0000100 | 3300048904 | Bacteria | 89811 |
| 501 | Ga0496101_0000110 | 3300048904 | Bacteria | 85776 |
| 502 | Ga0496101_0001605 | 3300048904 | Bacteria | 13597 |
| 503 | Ga0496101_0013571 | 3300048904 | Bacteria | 5462 |
| 504 | Ga0496101_0142244 | 3300048904 | Bacteria | 1829 |
| 505 | Ga0496101_0159982 | 3300048904 | Bacteria | 1727 |
| 506 | Ga0496101_0245115 | 3300048904 | Bacteria | 1395 |
| 507 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 508 | Ga0496102_0003241 | 3300048905 | Bacteria | 13802 |
| 509 | Ga0496102_0005337 | 3300048905 | Bacteria | 10912 |
| 510 | Ga0496102_0008322 | 3300048905 | Bacteria | 8887 |
| 511 | Ga0496102_0042225 | 3300048905 | Bacteria | 4133 |
| 512 | Ga0496102_0244209 | 3300048905 | Bacteria | 1693 |
| 513 | Ga0496102_0402961 | 3300048905 | Bacteria | 1286 |
| 514 | Ga0496102_0594017 | 3300048905 | Bacteria | 1030 |
| 515 | Ga0496102_0610361 | 3300048905 | Bacteria | 1014 |
| 516 | Ga0496102_0984217 | 3300048905 | Bacteria | 764 |
| 517 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 518 | Ga0496103_0000700 | 3300048906 | Bacteria | 24863 |
| 519 | Ga0496103_0004893 | 3300048906 | Bacteria | 8087 |
| 520 | Ga0496103_0019975 | 3300048906 | Bacteria | 4023 |
| 521 | Ga0496104_0055184 | 3300048907 | Bacteria | 3756 |
| 522 | Ga0496104_1020308 | 3300048907 | Bacteria | 731 |
| 523 | Ga0496105_0044484 | 3300048908 | Bacteria | 3662 |
| 524 | Ga0496105_0050466 | 3300048908 | Bacteria | 3436 |
| 525 | Ga0496105_0134415 | 3300048908 | Bacteria | 2038 |
| 526 | Ga0496106_0000164 | 3300048909 | Bacteria | 47996 |
| 527 | Ga0496106_0000616 | 3300048909 | Bacteria | 25450 |
| 528 | Ga0496106_0011222 | 3300048909 | Bacteria | 6630 |
| 529 | Ga0496106_0168716 | 3300048909 | Bacteria | 1734 |
| 530 | Ga0496106_1109741 | 3300048909 | Bacteria | 619 |
| 531 | Ga0496107_0000650 | 3300048910 | Bacteria | 19593 |
| 532 | Ga0496107_0001329 | 3300048910 | Bacteria | 15163 |
| 533 | Ga0496107_0059658 | 3300048910 | Bacteria | 2761 |
| 534 | Ga0496107_0430982 | 3300048910 | Bacteria | 980 |
| 535 | Ga0496107_1050338 | 3300048910 | Bacteria | 590 |
| 536 | Ga0496108_0006114 | 3300048911 | Bacteria | 9741 |
| 537 | Ga0496108_0131215 | 3300048911 | Bacteria | 2154 |
| 538 | Ga0496108_0186793 | 3300048911 | Bacteria | 1795 |
| 539 | Ga0496108_0670087 | 3300048911 | Bacteria | 901 |
| 540 | Ga0496109_0000356 | 3300048912 | Bacteria | 42608 |
| 541 | Ga0496109_0339670 | 3300048912 | Bacteria | 1418 |
| 542 | Ga0496109_0362499 | 3300048912 | Bacteria | 1369 |
| 543 | Ga0496109_0374002 | 3300048912 | Bacteria | 1346 |
| 544 | Ga0496109_0415287 | 3300048912 | Bacteria | 1271 |
| 545 | Ga0496110_0009262 | 3300048913 | Bacteria | 7960 |
| 546 | Ga0496110_0168417 | 3300048913 | Bacteria | 1987 |
| 547 | Ga0496110_1216350 | 3300048913 | Bacteria | 662 |
| 548 | Ga0496111_0045234 | 3300048914 | Bacteria | 3167 |
| 549 | Ga0496111_0294223 | 3300048914 | Bacteria | 1204 |
| 550 | Ga0496112_0019953 | 3300048915 | Bacteria | 6343 |
| 551 | Ga0496112_0252536 | 3300048915 | Bacteria | 1714 |
| 552 | Ga0496113_0159294 | 3300048916 | Bacteria | 1784 |
| 553 | Ga0496113_0946479 | 3300048916 | Bacteria | 680 |
| 554 | Ga0496114_0000164 | 3300048917 | Bacteria | 47093 |
| 555 | Ga0496114_0000522 | 3300048917 | Bacteria | 28253 |
| 556 | Ga0496114_0013077 | 3300048917 | Bacteria | 6649 |
| 557 | Ga0496114_0217710 | 3300048917 | Bacteria | 1676 |
| 558 | Ga0496114_0653403 | 3300048917 | Bacteria | 925 |
| 559 | Ga0496114_1126697 | 3300048917 | Bacteria | 670 |
| 560 | Ga0496115_0002348 | 3300048918 | Bacteria | 13572 |
| 561 | Ga0496115_0014536 | 3300048918 | Bacteria | 5960 |
| 562 | Ga0496115_0022098 | 3300048918 | Bacteria | 4922 |
| 563 | Ga0496115_0214817 | 3300048918 | Bacteria | 1588 |
| 564 | Ga0496115_0653510 | 3300048918 | Bacteria | 831 |
| 565 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 566 | Ga0496116_0002215 | 3300048919 | Bacteria | 20684 |
| 567 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 568 | Ga0496117_0014625 | 3300048920 | Bacteria | 6749 |
| 569 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 570 | Ga0496118_0077484 | 3300048921 | Bacteria | 2357 |
| 571 | Ga0496119_0000035 | 3300048922 | Bacteria | 217007 |
| 572 | Ga0496119_0004129 | 3300048922 | Bacteria | 14622 |
| 573 | Ga0496119_0438713 | 3300048922 | Bacteria | 617 |
| 574 | Ga0496120_0000079 | 3300048923 | Bacteria | 160413 |
| 575 | Ga0496120_0016802 | 3300048923 | Bacteria | 4768 |
| 576 | Ga0496120_0070643 | 3300048923 | Bacteria | 1920 |
| 577 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 578 | Ga0496121_0000090 | 3300048924 | Bacteria | 217920 |
| 579 | Ga0496122_0000805 | 3300048925 | Bacteria | 60172 |
| 580 | Ga0496123_0003575 | 3300048926 | Bacteria | 17241 |
| 581 | Ga0496124_0000221 | 3300048927 | Bacteria | 110879 |
| 582 | Ga0496124_0429981 | 3300048927 | Bacteria | 907 |
| 583 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 584 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 585 | Ga0496126_0002186 | 3300048929 | Bacteria | 27172 |
| 586 | Ga0496126_0006264 | 3300048929 | Bacteria | 13290 |
| 587 | Ga0496126_0030158 | 3300048929 | Bacteria | 5142 |
| 588 | Ga0501032_0013541 | 3300049569 | Bacteria | 5797 |
| 589 | Ga0501032_0394303 | 3300049569 | Bacteria | 889 |
| 590 | Ga0501034_0026741 | 3300049571 | Bacteria | 5871 |
| 591 | Ga0501034_0091269 | 3300049571 | Bacteria | 3044 |
| 592 | Ga0501036_0319779 | 3300049572 | Bacteria | 1297 |
| 593 | Ga0501037_0001555 | 3300049573 | Bacteria | 16751 |
| 594 | Ga0501038_0026018 | 3300049574 | Bacteria | 5212 |
| 595 | Ga0501039_0000929 | 3300049575 | Bacteria | 21375 |
| 596 | Ga0501043_0002664 | 3300049579 | Bacteria | 14997 |
| 597 | Ga0501046_0238098 | 3300049580 | Bacteria | 1343 |
| 598 | Ga0501047_0011332 | 3300049581 | Bacteria | 8442 |
| 599 | Ga0501047_0649234 | 3300049581 | Bacteria | 875 |
| 600 | Ga0501048_0586807 | 3300049582 | Bacteria | 800 |
| 601 | Ga0501068_0068734 | 3300049584 | Bacteria | 2159 |
| 602 | Ga0501070_0093403 | 3300049586 | Bacteria | 2489 |
| 603 | Ga0501070_0103101 | 3300049586 | Bacteria | 2359 |
| 604 | Ga0501070_0954339 | 3300049586 | Bacteria | 667 |
| 605 | Ga0501080_0542211 | 3300049742 | Bacteria | 1037 |
| 606 | Ga0501035_0000497 | 3300049822 | Bacteria | 44253 |
| 607 | Ga0501044_0007277 | 3300049823 | Bacteria | 12164 |
| 608 | Ga0501044_0042930 | 3300049823 | Bacteria | 4700 |
| 609 | Ga0501044_0139950 | 3300049823 | Bacteria | 2409 |
| 610 | Ga0501044_0444084 | 3300049823 | Bacteria | 1205 |
| 611 | nmdc:mga03683_179253_c1 | 3300050489 | Bacteria | 966 |
| 612 | nmdc:mga03683_23689_c1 | 3300050489 | Bacteria | 2394 |
| 613 | nmdc:mga03683_417253_c1 | 3300050489 | Bacteria | 642 |
| 614 | nmdc:mga03683_49857_c1 | 3300050489 | Bacteria | 1744 |
| 615 | nmdc:mga03n38_148780_c1 | 3300050490 | Bacteria | 1176 |
| 616 | nmdc:mga03n38_2381_c1 | 3300050490 | Bacteria | 5795 |
| 617 | nmdc:mga03n38_323265_c1 | 3300050490 | Bacteria | 834 |
| 618 | nmdc:mga03n38_376702_c1 | 3300050490 | Bacteria | 777 |
| 619 | nmdc:mga03n38_421862_c1 | 3300050490 | Bacteria | 738 |
| 620 | nmdc:mga03n38_656131_c1 | 3300050490 | Bacteria | 602 |
| 621 | nmdc:mga03n38_831841_c1 | 3300050490 | Bacteria | 539 |
| 622 | nmdc:mga03n38_95166_c1 | 3300050490 | Bacteria | 1426 |
| 623 | nmdc:mga00v17_15511_c1 | 3300050491 | Bacteria | 4278 |
| 624 | nmdc:mga00v17_20163_c1 | 3300050491 | Bacteria | 3816 |
| 625 | nmdc:mga00v17_238225_c1 | 3300050491 | Bacteria | 1179 |
| 626 | nmdc:mga00v17_259274_c1 | 3300050491 | Bacteria | 1128 |
| 627 | nmdc:mga00v17_275111_c1 | 3300050491 | Bacteria | 1093 |
| 628 | nmdc:mga00v17_28984_c1 | 3300050491 | Bacteria | 3246 |
| 629 | nmdc:mga00v17_38260_c1 | 3300050491 | Bacteria | 2868 |
| 630 | nmdc:mga00v17_84002_c1 | 3300050491 | Bacteria | 1992 |
| 631 | nmdc:mga0yw44_2784_c1 | 3300050492 | Bacteria | 7572 |
| 632 | nmdc:mga0yw44_47147_c1 | 3300050492 | Bacteria | 2592 |
| 633 | nmdc:mga0yw44_573238_c1 | 3300050492 | Bacteria | 766 |
| 634 | nmdc:mga0yw44_66954_c1 | 3300050492 | Bacteria | 2218 |
| 635 | nmdc:mga0yw44_796516_c1 | 3300050492 | Bacteria | 642 |
| 636 | nmdc:mga0k408_189390_c1 | 3300050493 | Bacteria | 1227 |
| 637 | nmdc:mga06z11_186539_c1 | 3300050494 | Bacteria | 1198 |
| 638 | nmdc:mga06z11_247361_c1 | 3300050494 | Bacteria | 1049 |
| 639 | nmdc:mga06z11_859682_c1 | 3300050494 | Bacteria | 553 |
| 640 | nmdc:mga04h51_528264_c1 | 3300050495 | Bacteria | 507 |
| 641 | nmdc:mga07m45_20108_c1 | 3300050496 | Bacteria | 3624 |
| 642 | nmdc:mga07m45_223956_c1 | 3300050496 | Bacteria | 1094 |
| 643 | nmdc:mga07m45_391319_c1 | 3300050496 | Bacteria | 807 |
| 644 | nmdc:mga07m45_72746_c1 | 3300050496 | Bacteria | 1957 |
| 645 | nmdc:mga07m45_765773_c1 | 3300050496 | Bacteria | 554 |
| 646 | nmdc:mga0rr50_1224350_c1 | 3300050513 | Bacteria | 637 |
| 647 | nmdc:mga0sz30_142680_c1 | 3300050516 | Bacteria | 1058 |
| 648 | nmdc:mga0sz30_142957_c1 | 3300050516 | Bacteria | 1057 |
| 649 | nmdc:mga0sz30_15363_c1 | 3300050516 | Bacteria | 3025 |
| 650 | nmdc:mga0sz30_235460_c1 | 3300050516 | Bacteria | 815 |
| 651 | nmdc:mga0sz30_23957_c1 | 3300050516 | Bacteria | 2489 |
| 652 | nmdc:mga0sz30_68328_c1 | 3300050516 | Bacteria | 1526 |
| 653 | nmdc:mga0sz30_86067_c1 | 3300050516 | Bacteria | 1364 |
| 654 | Ga0495601_0339808 | 3300053077 | Bacteria | 977 |
| 655 | Ga0500635_0027164 | 3300053080 | Bacteria | 1817 |
| 656 | Ga0495655_0081153 | 3300053083 | Bacteria | 927 |
| 657 | Ga0495655_0133853 | 3300053083 | Bacteria | 766 |
| 658 | Ga0495655_0146864 | 3300053083 | Bacteria | 738 |
| 659 | Ga0495619_0094594 | 3300053085 | Bacteria | 2027 |
| 660 | Ga0500643_003561 | 3300053087 | Bacteria | 7411 |
| 661 | Ga0500651_0651888 | 3300053093 | Bacteria | 567 |
| 662 | Ga0500641_0183658 | 3300053096 | Bacteria | 897 |
| 663 | Ga0500556_0037703 | 3300053104 | Bacteria | 1683 |
| 664 | Ga0500562_018271 | 3300053108 | Bacteria | 1810 |
| 665 | Ga0500628_042736 | 3300053129 | Bacteria | 1043 |
| 666 | Ga0500652_008367 | 3300053131 | Bacteria | 3444 |
| 667 | Ga0500652_012617 | 3300053131 | Bacteria | 2972 |
| 668 | Ga0500568_0173179 | 3300053139 | Bacteria | 794 |
| 669 | Ga0500616_0058960 | 3300053153 | Bacteria | 1995 |
| 670 | Ga0500616_0292747 | 3300053153 | Bacteria | 679 |
| 671 | Ga0500639_115253 | 3300053163 | Bacteria | 1300 |
| 672 | Ga0500645_000490 | 3300053730 | Bacteria | 26762 |
| 673 | Ga0466962_0023192 | 3300061719 | Bacteria | 2983 |
| 674 | Ga0466962_0032563 | 3300061719 | Bacteria | 2495 |
| 675 | Ga0466962_0192561 | 3300061719 | Bacteria | 995 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221715 | 2644636955 | 108 |
| 2 | iso_pu_bacteria | 2939582691 | 2939584658 | 108 |
| 3 | iso_pu_bacteria | 2738541264 | 2738668357 | 109 |
| 4 | iso_pu_bacteria | 2738541356 | 2739147427 | 109 |
| 5 | 3300031251 | Ga0265327_10002508 | Ga0265327_100025088 | 110 |
| 6 | 3300044683 | Ga0466965_0106659 | Ga0466965_0106659_453_791 | 110 |
| 7 | 3300045976 | Ga0466967_0198657 | Ga0466967_0198657_1274_1612 | 110 |
| 8 | 3300045976 | Ga0466967_1186410 | Ga0466967_1186410_26_358 | 110 |
| 9 | iso_pu_bacteria | 2902837492 | 2902838482 | 110 |
| 10 | 3300005335 | Ga0070666_10066179 | Ga0070666_100661793 | 111 |
| 11 | 3300005367 | Ga0070667_100013973 | Ga0070667_1000139738 | 111 |
| 12 | 3300005843 | Ga0068860_100577544 | Ga0068860_1005775442 | 111 |
| 13 | 3300006051 | Ga0075364_10095173 | Ga0075364_100951733 | 111 |
| 14 | 3300006177 | Ga0075362_10054120 | Ga0075362_100541202 | 111 |
| 15 | 3300006178 | Ga0075367_10122378 | Ga0075367_101223782 | 111 |
| 16 | 3300006353 | Ga0075370_10055517 | Ga0075370_100555173 | 111 |
| 17 | 3300013306 | Ga0163162_11128478 | Ga0163162_111284782 | 111 |
| 18 | 3300025903 | Ga0207680_10210406 | Ga0207680_102104062 | 111 |
| 19 | 3300025986 | Ga0207658_10001961 | Ga0207658_100019613 | 111 |
| 20 | 3300026035 | Ga0207703_10793125 | Ga0207703_107931252 | 111 |
| 21 | 3300028381 | Ga0268264_11048984 | Ga0268264_110489842 | 111 |
| 22 | 3300048903 | Ga0496100_0000084 | Ga0496100_0000084_23470_23811 | 111 |
| 23 | 3300048904 | Ga0496101_0000100 | Ga0496101_0000100_14380_14721 | 111 |
| 24 | 3300048905 | Ga0496102_0008322 | Ga0496102_0008322_3505_3846 | 111 |
| 25 | 3300048906 | Ga0496103_0000700 | Ga0496103_0000700_10600_10941 | 111 |
| 26 | 3300048909 | Ga0496106_0000164 | Ga0496106_0000164_16442_16783 | 111 |
| 27 | 3300048910 | Ga0496107_0000650 | Ga0496107_0000650_19071_19412 | 111 |
| 28 | 3300048911 | Ga0496108_0006114 | Ga0496108_0006114_6665_7006 | 111 |
| 29 | 3300048912 | Ga0496109_0000356 | Ga0496109_0000356_23465_23806 | 111 |
| 30 | 3300048913 | Ga0496110_0009262 | Ga0496110_0009262_5024_5365 | 111 |
| 31 | 3300048914 | Ga0496111_0045234 | Ga0496111_0045234_2378_2719 | 111 |
| 32 | 3300048916 | Ga0496113_0946479 | Ga0496113_0946479_303_644 | 111 |
| 33 | 3300048917 | Ga0496114_0000164 | Ga0496114_0000164_20959_21300 | 111 |
| 34 | 3300048918 | Ga0496115_0022098 | Ga0496115_0022098_4369_4710 | 111 |
| 35 | 3300048919 | Ga0496116_0002215 | Ga0496116_0002215_16414_16755 | 111 |
| 36 | 3300048920 | Ga0496117_0014625 | Ga0496117_0014625_5890_6231 | 111 |
| 37 | 3300048921 | Ga0496118_0077484 | Ga0496118_0077484_1498_1839 | 111 |
| 38 | 3300048922 | Ga0496119_0004129 | Ga0496119_0004129_11596_11937 | 111 |
| 39 | 3300048923 | Ga0496120_0016802 | Ga0496120_0016802_1051_1392 | 111 |
| 40 | 3300048923 | Ga0496120_0070643 | Ga0496120_0070643_151_486 | 111 |
| 41 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_239489_239830 | 111 |
| 42 | 3300048925 | Ga0496122_0000805 | Ga0496122_0000805_25128_25469 | 111 |
| 43 | 3300048926 | Ga0496123_0003575 | Ga0496123_0003575_5831_6172 | 111 |
| 44 | 3300048927 | Ga0496124_0000221 | Ga0496124_0000221_75102_75443 | 111 |
| 45 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_949938_950279 | 111 |
| 46 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_239489_239830 | 111 |
| 47 | 3300050489 | nmdc:mga03683_49857_c1 | nmdc:mga03683_49857_c1_1134_1478 | 111 |
| 48 | 3300050490 | nmdc:mga03n38_376702_c1 | nmdc:mga03n38_376702_c1_386_721 | 111 |
| 49 | 3300050496 | nmdc:mga07m45_391319_c1 | nmdc:mga07m45_391319_c1_127_471 | 111 |
| 50 | iso_pu_bacteria | 2902792274 | 2902798710 | 111 |
| 51 | 3300005337 | Ga0070682_100066156 | Ga0070682_1000661563 | 112 |
| 52 | 3300005347 | Ga0070668_100013630 | Ga0070668_1000136303 | 112 |
| 53 | 3300005356 | Ga0070674_100389244 | Ga0070674_1003892442 | 112 |
| 54 | 3300005367 | Ga0070667_101987443 | Ga0070667_1019874431 | 112 |
| 55 | 3300005548 | Ga0070665_101297107 | Ga0070665_1012971072 | 112 |
| 56 | 3300005618 | Ga0068864_100317667 | Ga0068864_1003176672 | 112 |
| 57 | 3300005718 | Ga0068866_10762682 | Ga0068866_107626822 | 112 |
| 58 | 3300005842 | Ga0068858_101336074 | Ga0068858_1013360742 | 112 |
| 59 | 3300006038 | Ga0075365_10155132 | Ga0075365_101551322 | 112 |
| 60 | 3300006048 | Ga0075363_100092743 | Ga0075363_1000927432 | 112 |
| 61 | 3300006048 | Ga0075363_100903141 | Ga0075363_1009031412 | 112 |
| 62 | 3300006051 | Ga0075364_10008782 | Ga0075364_100087823 | 112 |
| 63 | 3300006051 | Ga0075364_10117299 | Ga0075364_101172993 | 112 |
| 64 | 3300006177 | Ga0075362_10255398 | Ga0075362_102553982 | 112 |
| 65 | 3300006178 | Ga0075367_10238196 | Ga0075367_102381961 | 112 |
| 66 | 3300006186 | Ga0075369_10110257 | Ga0075369_101102572 | 112 |
| 67 | 3300006881 | Ga0068865_101734730 | Ga0068865_1017347302 | 112 |
| 68 | 3300009011 | Ga0105251_10529354 | Ga0105251_105293542 | 112 |
| 69 | 3300009092 | Ga0105250_10378323 | Ga0105250_103783232 | 112 |
| 70 | 3300009545 | Ga0105237_12693346 | Ga0105237_126933461 | 112 |
| 71 | 3300011119 | Ga0105246_10700830 | Ga0105246_107008302 | 112 |
| 72 | 3300013308 | Ga0157375_10467692 | Ga0157375_104676922 | 112 |
| 73 | 3300025901 | Ga0207688_10344949 | Ga0207688_103449492 | 112 |
| 74 | 3300025935 | Ga0207709_10174362 | Ga0207709_101743623 | 112 |
| 75 | 3300025945 | Ga0207679_11402795 | Ga0207679_114027951 | 112 |
| 76 | 3300025972 | Ga0207668_10002892 | Ga0207668_100028923 | 112 |
| 77 | 3300025986 | Ga0207658_11164123 | Ga0207658_111641232 | 112 |
| 78 | 3300026035 | Ga0207703_10155468 | Ga0207703_101554682 | 112 |
| 79 | 3300026035 | Ga0207703_10930306 | Ga0207703_109303062 | 112 |
| 80 | 3300026095 | Ga0207676_10241137 | Ga0207676_102411372 | 112 |
| 81 | 3300028379 | Ga0268266_11460448 | Ga0268266_114604482 | 112 |
| 82 | 3300031901 | Ga0307406_12073894 | Ga0307406_120738941 | 112 |
| 83 | 3300031995 | Ga0307409_100729563 | Ga0307409_1007295631 | 112 |
| 84 | 3300031995 | Ga0307409_101209931 | Ga0307409_1012099312 | 112 |
| 85 | 3300038725 | Ga0400484_01826 | Ga0400484_01826_2903_3256 | 112 |
| 86 | 3300038725 | Ga0400484_11786 | Ga0400484_11786_1590_1943 | 112 |
| 87 | 3300038741 | Ga0400488_60352 | Ga0400488_60352_360_713 | 112 |
| 88 | 3300039062 | Ga0400483_095200 | Ga0400483_095200_425_778 | 112 |
| 89 | 3300039062 | Ga0400483_112801 | Ga0400483_112801_3000_3353 | 112 |
| 90 | 3300039062 | Ga0400483_277034 | Ga0400483_277034_64_417 | 112 |
| 91 | 3300041410 | Ga0439461_0000950 | Ga0439461_0000950_2351_2689 | 112 |
| 92 | 3300041413 | Ga0439465_0009759 | Ga0439465_0009759_1829_2167 | 112 |
| 93 | 3300041498 | Ga0451841_0373935 | Ga0451841_0373935_159_500 | 112 |
| 94 | 3300041997 | Ga0439431_0003200 | Ga0439431_0003200_1117_1455 | 112 |
| 95 | 3300042004 | Ga0439445_0060977 | Ga0439445_0060977_565_903 | 112 |
| 96 | 3300042008 | Ga0439450_222286 | Ga0439450_222286_19_363 | 112 |
| 97 | 3300042015 | Ga0439462_0163314 | Ga0439462_0163314_18_356 | 112 |
| 98 | 3300042438 | Ga0439459_0032932 | Ga0439459_0032932_10_354 | 112 |
| 99 | 3300044656 | Ga0466969_0210912 | Ga0466969_0210912_285_626 | 112 |
| 100 | 3300044658 | Ga0466972_0019835 | Ga0466972_0019835_386_727 | 112 |
| 101 | 3300044658 | Ga0466972_0021251 | Ga0466972_0021251_2559_2906 | 112 |
| 102 | 3300044683 | Ga0466965_0000697 | Ga0466965_0000697_8380_8721 | 112 |
| 103 | 3300044683 | Ga0466965_0002661 | Ga0466965_0002661_384_731 | 112 |
| 104 | 3300044684 | Ga0466966_0351351 | Ga0466966_0351351_393_734 | 112 |
| 105 | 3300044706 | Ga0466964_0726222 | Ga0466964_0726222_132_473 | 112 |
| 106 | 3300044719 | Ga0466971_0133942 | Ga0466971_0133942_786_1127 | 112 |
| 107 | 3300044735 | Ga0466968_0001521 | Ga0466968_0001521_700_1041 | 112 |
| 108 | 3300044765 | Ga0466970_0015246 | Ga0466970_0015246_2065_2406 | 112 |
| 109 | 3300044842 | Ga0466957_0003667 | Ga0466957_0003667_3072_3413 | 112 |
| 110 | 3300044901 | Ga0466960_0000319 | Ga0466960_0000319_2983_3330 | 112 |
| 111 | 3300044901 | Ga0466960_0002911 | Ga0466960_0002911_3384_3725 | 112 |
| 112 | 3300045049 | Ga0466959_0118544 | Ga0466959_0118544_301_642 | 112 |
| 113 | 3300045836 | Ga0466958_0507472 | Ga0466958_0507472_90_431 | 112 |
| 114 | 3300045976 | Ga0466967_0091130 | Ga0466967_0091130_674_1015 | 112 |
| 115 | 3300045976 | Ga0466967_0256355 | Ga0466967_0256355_1106_1447 | 112 |
| 116 | 3300045976 | Ga0466967_0341220 | Ga0466967_0341220_780_1124 | 112 |
| 117 | 3300046524 | Ga0495648_0015564 | Ga0495648_0015564_2270_2632 | 112 |
| 118 | 3300046530 | Ga0495654_0180187 | Ga0495654_0180187_378_740 | 112 |
| 119 | 3300046616 | Ga0495668_0060829 | Ga0495668_0060829_1198_1560 | 112 |
| 120 | 3300046648 | Ga0495611_0052314 | Ga0495611_0052314_488_850 | 112 |
| 121 | 3300046660 | Ga0495625_0336218 | Ga0495625_0336218_447_785 | 112 |
| 122 | 3300046692 | Ga0495671_0080694 | Ga0495671_0080694_927_1289 | 112 |
| 123 | 3300046694 | Ga0495649_0266459 | Ga0495649_0266459_322_669 | 112 |
| 124 | 3300047320 | Ga0495672_0003978 | Ga0495672_0003978_11228_11590 | 112 |
| 125 | 3300047469 | Ga0495673_0002945 | Ga0495673_0002945_8095_8457 | 112 |
| 126 | 3300048091 | Ga0495626_0234241 | Ga0495626_0234241_327_665 | 112 |
| 127 | 3300048903 | Ga0496100_0642147 | Ga0496100_0642147_296_640 | 112 |
| 128 | 3300048903 | Ga0496100_0804696 | Ga0496100_0804696_367_708 | 112 |
| 129 | 3300048904 | Ga0496101_0159982 | Ga0496101_0159982_794_1135 | 112 |
| 130 | 3300048905 | Ga0496102_0042225 | Ga0496102_0042225_3238_3579 | 112 |
| 131 | 3300048905 | Ga0496102_0610361 | Ga0496102_0610361_92_433 | 112 |
| 132 | 3300048905 | Ga0496102_0984217 | Ga0496102_0984217_393_734 | 112 |
| 133 | 3300048907 | Ga0496104_1020308 | Ga0496104_1020308_334_675 | 112 |
| 134 | 3300048909 | Ga0496106_0168716 | Ga0496106_0168716_660_1001 | 112 |
| 135 | 3300048910 | Ga0496107_0430982 | Ga0496107_0430982_373_714 | 112 |
| 136 | 3300048910 | Ga0496107_1050338 | Ga0496107_1050338_154_498 | 112 |
| 137 | 3300048911 | Ga0496108_0131215 | Ga0496108_0131215_1327_1668 | 112 |
| 138 | 3300048912 | Ga0496109_0339670 | Ga0496109_0339670_702_1043 | 112 |
| 139 | 3300048917 | Ga0496114_0217710 | Ga0496114_0217710_1316_1657 | 112 |
| 140 | 3300048917 | Ga0496114_0653403 | Ga0496114_0653403_44_385 | 112 |
| 141 | 3300048917 | Ga0496114_1126697 | Ga0496114_1126697_180_521 | 112 |
| 142 | 3300048918 | Ga0496115_0653510 | Ga0496115_0653510_337_678 | 112 |
| 143 | 3300048929 | Ga0496126_0006264 | Ga0496126_0006264_2731_3072 | 112 |
| 144 | 3300049569 | Ga0501032_0013541 | Ga0501032_0013541_4056_4394 | 112 |
| 145 | 3300049571 | Ga0501034_0026741 | Ga0501034_0026741_1998_2336 | 112 |
| 146 | 3300049572 | Ga0501036_0319779 | Ga0501036_0319779_77_415 | 112 |
| 147 | 3300049573 | Ga0501037_0001555 | Ga0501037_0001555_15521_15859 | 112 |
| 148 | 3300049574 | Ga0501038_0026018 | Ga0501038_0026018_691_1029 | 112 |
| 149 | 3300049575 | Ga0501039_0000929 | Ga0501039_0000929_16982_17320 | 112 |
| 150 | 3300049579 | Ga0501043_0002664 | Ga0501043_0002664_12018_12356 | 112 |
| 151 | 3300049584 | Ga0501068_0068734 | Ga0501068_0068734_1253_1591 | 112 |
| 152 | 3300049586 | Ga0501070_0103101 | Ga0501070_0103101_124_462 | 112 |
| 153 | 3300049586 | Ga0501070_0954339 | Ga0501070_0954339_304_651 | 112 |
| 154 | 3300049823 | Ga0501044_0139950 | Ga0501044_0139950_660_998 | 112 |
| 155 | 3300050490 | nmdc:mga03n38_95166_c1 | nmdc:mga03n38_95166_c1_510_851 | 112 |
| 156 | 3300050491 | nmdc:mga00v17_20163_c1 | nmdc:mga00v17_20163_c1_3256_3594 | 112 |
| 157 | 3300050492 | nmdc:mga0yw44_573238_c1 | nmdc:mga0yw44_573238_c1_32_376 | 112 |
| 158 | 3300050492 | nmdc:mga0yw44_796516_c1 | nmdc:mga0yw44_796516_c1_17_358 | 112 |
| 159 | 3300050516 | nmdc:mga0sz30_68328_c1 | nmdc:mga0sz30_68328_c1_210_551 | 112 |
| 160 | 3300053087 | Ga0500643_003561 | Ga0500643_003561_4138_4482 | 112 |
| 161 | 3300053093 | Ga0500651_0651888 | Ga0500651_0651888_59_400 | 112 |
| 162 | 3300053104 | Ga0500556_0037703 | Ga0500556_0037703_540_884 | 112 |
| 163 | 3300053108 | Ga0500562_018271 | Ga0500562_018271_134_472 | 112 |
| 164 | 3300053131 | Ga0500652_012617 | Ga0500652_012617_2014_2355 | 112 |
| 165 | 3300053139 | Ga0500568_0173179 | Ga0500568_0173179_372_713 | 112 |
| 166 | 3300053153 | Ga0500616_0058960 | Ga0500616_0058960_1363_1710 | 112 |
| 167 | 3300053163 | Ga0500639_115253 | Ga0500639_115253_710_1051 | 112 |
| 168 | 3300053730 | Ga0500645_000490 | Ga0500645_000490_17311_17652 | 112 |
| 169 | iso_pu_bacteria | 2643221687 | 2644490710 | 112 |
| 170 | 3300005356 | Ga0070674_100004262 | Ga0070674_1000042623 | 113 |
| 171 | 3300005434 | Ga0070709_10469052 | Ga0070709_104690522 | 113 |
| 172 | 3300005435 | Ga0070714_100003669 | Ga0070714_1000036693 | 113 |
| 173 | 3300005436 | Ga0070713_100111408 | Ga0070713_1001114082 | 113 |
| 174 | 3300005439 | Ga0070711_100992985 | Ga0070711_1009929852 | 113 |
| 175 | 3300005456 | Ga0070678_101724462 | Ga0070678_1017244622 | 113 |
| 176 | 3300005544 | Ga0070686_100801663 | Ga0070686_1008016632 | 113 |
| 177 | 3300005548 | Ga0070665_102181598 | Ga0070665_1021815982 | 113 |
| 178 | 3300005615 | Ga0070702_101432387 | Ga0070702_1014323871 | 113 |
| 179 | 3300005718 | Ga0068866_10371858 | Ga0068866_103718582 | 113 |
| 180 | 3300005841 | Ga0068863_100529594 | Ga0068863_1005295942 | 113 |
| 181 | 3300006163 | Ga0070715_10569780 | Ga0070715_105697801 | 113 |
| 182 | 3300009176 | Ga0105242_11214453 | Ga0105242_112144531 | 113 |
| 183 | 3300009551 | Ga0105238_11169866 | Ga0105238_111698662 | 113 |
| 184 | 3300013105 | Ga0157369_10785184 | Ga0157369_107851842 | 113 |
| 185 | 3300025899 | Ga0207642_10251767 | Ga0207642_102517672 | 113 |
| 186 | 3300025906 | Ga0207699_11100125 | Ga0207699_111001251 | 113 |
| 187 | 3300025916 | Ga0207663_10697294 | Ga0207663_106972942 | 113 |
| 188 | 3300025919 | Ga0207657_11413786 | Ga0207657_114137861 | 113 |
| 189 | 3300025929 | Ga0207664_10099464 | Ga0207664_100994643 | 113 |
| 190 | 3300025934 | Ga0207686_10644655 | Ga0207686_106446552 | 113 |
| 191 | 3300025937 | Ga0207669_10021180 | Ga0207669_100211802 | 113 |
| 192 | 3300026067 | Ga0207678_11405819 | Ga0207678_114058192 | 113 |
| 193 | 3300026088 | Ga0207641_10060560 | Ga0207641_100605602 | 113 |
| 194 | 3300026121 | Ga0207683_10741899 | Ga0207683_107418992 | 113 |
| 195 | 3300028379 | Ga0268266_10763785 | Ga0268266_107637851 | 113 |
| 196 | 3300048903 | Ga0496100_0000939 | Ga0496100_0000939_320_667 | 113 |
| 197 | 3300048904 | Ga0496101_0001605 | Ga0496101_0001605_10427_10774 | 113 |
| 198 | 3300048905 | Ga0496102_0402961 | Ga0496102_0402961_139_486 | 113 |
| 199 | 3300048908 | Ga0496105_0050466 | Ga0496105_0050466_3054_3401 | 113 |
| 200 | 3300048909 | Ga0496106_0011222 | Ga0496106_0011222_5096_5443 | 113 |
| 201 | 3300048910 | Ga0496107_0059658 | Ga0496107_0059658_1468_1815 | 113 |
| 202 | 3300048912 | Ga0496109_0362499 | Ga0496109_0362499_393_740 | 113 |
| 203 | 3300048917 | Ga0496114_0013077 | Ga0496114_0013077_5061_5408 | 113 |
| 204 | 3300048918 | Ga0496115_0014536 | Ga0496115_0014536_2173_2520 | 113 |
| 205 | iso_pu_bacteria | 2842134933 | 2842139271 | 113 |
| 206 | 3300001989 | JGI24739J22299_10100835 | JGI24739J22299_101008352 | 114 |
| 207 | 3300001990 | JGI24737J22298_10083722 | JGI24737J22298_100837222 | 114 |
| 208 | 3300002067 | JGI24735J21928_10062902 | JGI24735J21928_100629022 | 114 |
| 209 | 3300002067 | JGI24735J21928_10080511 | JGI24735J21928_100805112 | 114 |
| 210 | 3300002077 | JGI24744J21845_10002910 | JGI24744J21845_100029102 | 114 |
| 211 | 3300002239 | JGI24034J26672_10014121 | JGI24034J26672_100141212 | 114 |
| 212 | 3300003792 | Ga0055540_1010510 | Ga0055540_10105102 | 114 |
| 213 | 3300003792 | Ga0055540_1010819 | Ga0055540_10108194 | 114 |
| 214 | 3300005328 | Ga0070676_10059747 | Ga0070676_100597472 | 114 |
| 215 | 3300005330 | Ga0070690_100251515 | Ga0070690_1002515152 | 114 |
| 216 | 3300005333 | Ga0070677_10243331 | Ga0070677_102433312 | 114 |
| 217 | 3300005334 | Ga0068869_101084253 | Ga0068869_1010842531 | 114 |
| 218 | 3300005335 | Ga0070666_10014436 | Ga0070666_100144365 | 114 |
| 219 | 3300005337 | Ga0070682_100003080 | Ga0070682_1000030802 | 114 |
| 220 | 3300005337 | Ga0070682_100038791 | Ga0070682_1000387913 | 114 |
| 221 | 3300005337 | Ga0070682_100695119 | Ga0070682_1006951192 | 114 |
| 222 | 3300005338 | Ga0068868_100001163 | Ga0068868_1000011637 | 114 |
| 223 | 3300005339 | Ga0070660_100354907 | Ga0070660_1003549072 | 114 |
| 224 | 3300005340 | Ga0070689_100076385 | Ga0070689_1000763853 | 114 |
| 225 | 3300005340 | Ga0070689_101282709 | Ga0070689_1012827092 | 114 |
| 226 | 3300005341 | Ga0070691_10109073 | Ga0070691_101090731 | 114 |
| 227 | 3300005345 | Ga0070692_10563468 | Ga0070692_105634682 | 114 |
| 228 | 3300005347 | Ga0070668_100001540 | Ga0070668_10000154010 | 114 |
| 229 | 3300005347 | Ga0070668_101183060 | Ga0070668_1011830601 | 114 |
| 230 | 3300005347 | Ga0070668_101721540 | Ga0070668_1017215401 | 114 |
| 231 | 3300005353 | Ga0070669_100018910 | Ga0070669_1000189103 | 114 |
| 232 | 3300005355 | Ga0070671_100012258 | Ga0070671_1000122585 | 114 |
| 233 | 3300005355 | Ga0070671_100173699 | Ga0070671_1001736992 | 114 |
| 234 | 3300005355 | Ga0070671_100827414 | Ga0070671_1008274141 | 114 |
| 235 | 3300005356 | Ga0070674_100003394 | Ga0070674_1000033943 | 114 |
| 236 | 3300005356 | Ga0070674_100771590 | Ga0070674_1007715902 | 114 |
| 237 | 3300005365 | Ga0070688_100054103 | Ga0070688_1000541032 | 114 |
| 238 | 3300005366 | Ga0070659_100254920 | Ga0070659_1002549201 | 114 |
| 239 | 3300005366 | Ga0070659_100553719 | Ga0070659_1005537192 | 114 |
| 240 | 3300005367 | Ga0070667_100000791 | Ga0070667_10000079121 | 114 |
| 241 | 3300005367 | Ga0070667_100013169 | Ga0070667_1000131693 | 114 |
| 242 | 3300005367 | Ga0070667_100027611 | Ga0070667_1000276113 | 114 |
| 243 | 3300005367 | Ga0070667_100055913 | Ga0070667_1000559134 | 114 |
| 244 | 3300005367 | Ga0070667_100244906 | Ga0070667_1002449062 | 114 |
| 245 | 3300005367 | Ga0070667_101554950 | Ga0070667_1015549501 | 114 |
| 246 | 3300005435 | Ga0070714_100261269 | Ga0070714_1002612692 | 114 |
| 247 | 3300005437 | Ga0070710_10000690 | Ga0070710_100006903 | 114 |
| 248 | 3300005438 | Ga0070701_10011800 | Ga0070701_100118003 | 114 |
| 249 | 3300005439 | Ga0070711_100000160 | Ga0070711_10000016024 | 114 |
| 250 | 3300005440 | Ga0070705_100056197 | Ga0070705_1000561973 | 114 |
| 251 | 3300005441 | Ga0070700_100072711 | Ga0070700_1000727113 | 114 |
| 252 | 3300005441 | Ga0070700_100566538 | Ga0070700_1005665382 | 114 |
| 253 | 3300005444 | Ga0070694_100023962 | Ga0070694_1000239623 | 114 |
| 254 | 3300005445 | Ga0070708_100429423 | Ga0070708_1004294232 | 114 |
| 255 | 3300005455 | Ga0070663_100032577 | Ga0070663_1000325773 | 114 |
| 256 | 3300005455 | Ga0070663_100358948 | Ga0070663_1003589482 | 114 |
| 257 | 3300005456 | Ga0070678_100000117 | Ga0070678_10000011732 | 114 |
| 258 | 3300005456 | Ga0070678_100747911 | Ga0070678_1007479112 | 114 |
| 259 | 3300005457 | Ga0070662_100016792 | Ga0070662_1000167923 | 114 |
| 260 | 3300005457 | Ga0070662_101505328 | Ga0070662_1015053281 | 114 |
| 261 | 3300005459 | Ga0068867_100004067 | Ga0068867_1000040676 | 114 |
| 262 | 3300005466 | Ga0070685_10086894 | Ga0070685_100868943 | 114 |
| 263 | 3300005535 | Ga0070684_100318328 | Ga0070684_1003183282 | 114 |
| 264 | 3300005535 | Ga0070684_101335652 | Ga0070684_1013356521 | 114 |
| 265 | 3300005539 | Ga0068853_100023917 | Ga0068853_1000239174 | 114 |
| 266 | 3300005539 | Ga0068853_100419449 | Ga0068853_1004194492 | 114 |
| 267 | 3300005539 | Ga0068853_100470462 | Ga0068853_1004704622 | 114 |
| 268 | 3300005546 | Ga0070696_100010017 | Ga0070696_1000100173 | 114 |
| 269 | 3300005546 | Ga0070696_100566175 | Ga0070696_1005661752 | 114 |
| 270 | 3300005547 | Ga0070693_100149329 | Ga0070693_1001493292 | 114 |
| 271 | 3300005547 | Ga0070693_100946008 | Ga0070693_1009460082 | 114 |
| 272 | 3300005548 | Ga0070665_100007248 | Ga0070665_1000072489 | 114 |
| 273 | 3300005548 | Ga0070665_100009840 | Ga0070665_1000098409 | 114 |
| 274 | 3300005549 | Ga0070704_100019594 | Ga0070704_1000195944 | 114 |
| 275 | 3300005563 | Ga0068855_100228057 | Ga0068855_1002280572 | 114 |
| 276 | 3300005563 | Ga0068855_100753020 | Ga0068855_1007530202 | 114 |
| 277 | 3300005578 | Ga0068854_100009069 | Ga0068854_1000090696 | 114 |
| 278 | 3300005614 | Ga0068856_101110798 | Ga0068856_1011107982 | 114 |
| 279 | 3300005614 | Ga0068856_102256597 | Ga0068856_1022565972 | 114 |
| 280 | 3300005615 | Ga0070702_100050964 | Ga0070702_1000509643 | 114 |
| 281 | 3300005616 | Ga0068852_101148598 | Ga0068852_1011485982 | 114 |
| 282 | 3300005617 | Ga0068859_100001042 | Ga0068859_10000104214 | 114 |
| 283 | 3300005617 | Ga0068859_100077098 | Ga0068859_1000770982 | 114 |
| 284 | 3300005617 | Ga0068859_102748165 | Ga0068859_1027481652 | 114 |
| 285 | 3300005618 | Ga0068864_100852037 | Ga0068864_1008520372 | 114 |
| 286 | 3300005618 | Ga0068864_101833201 | Ga0068864_1018332012 | 114 |
| 287 | 3300005718 | Ga0068866_10000441 | Ga0068866_100004416 | 114 |
| 288 | 3300005718 | Ga0068866_10492337 | Ga0068866_104923372 | 114 |
| 289 | 3300005719 | Ga0068861_100003820 | Ga0068861_10000382011 | 114 |
| 290 | 3300005834 | Ga0068851_10602360 | Ga0068851_106023601 | 114 |
| 291 | 3300005841 | Ga0068863_100001025 | Ga0068863_10000102519 | 114 |
| 292 | 3300005841 | Ga0068863_100007351 | Ga0068863_1000073517 | 114 |
| 293 | 3300005842 | Ga0068858_100004832 | Ga0068858_10000483213 | 114 |
| 294 | 3300005842 | Ga0068858_100016818 | Ga0068858_1000168185 | 114 |
| 295 | 3300005842 | Ga0068858_100858020 | Ga0068858_1008580202 | 114 |
| 296 | 3300005843 | Ga0068860_100000087 | Ga0068860_10000008722 | 114 |
| 297 | 3300005843 | Ga0068860_100008728 | Ga0068860_10000872811 | 114 |
| 298 | 3300005843 | Ga0068860_100103874 | Ga0068860_1001038743 | 114 |
| 299 | 3300005843 | Ga0068860_100731000 | Ga0068860_1007310002 | 114 |
| 300 | 3300005844 | Ga0068862_100000077 | Ga0068862_10000007773 | 114 |
| 301 | 3300005844 | Ga0068862_100022465 | Ga0068862_1000224653 | 114 |
| 302 | 3300005844 | Ga0068862_100633339 | Ga0068862_1006333392 | 114 |
| 303 | 3300005937 | Ga0081455_10050617 | Ga0081455_100506174 | 114 |
| 304 | 3300005981 | Ga0081538_10051013 | Ga0081538_100510133 | 114 |
| 305 | 3300006038 | Ga0075365_10008384 | Ga0075365_100083842 | 114 |
| 306 | 3300006038 | Ga0075365_10021990 | Ga0075365_100219904 | 114 |
| 307 | 3300006042 | Ga0075368_10032217 | Ga0075368_100322173 | 114 |
| 308 | 3300006048 | Ga0075363_100015328 | Ga0075363_1000153283 | 114 |
| 309 | 3300006048 | Ga0075363_100045147 | Ga0075363_1000451473 | 114 |
| 310 | 3300006048 | Ga0075363_100065296 | Ga0075363_1000652961 | 114 |
| 311 | 3300006048 | Ga0075363_100067780 | Ga0075363_1000677803 | 114 |
| 312 | 3300006048 | Ga0075363_100136569 | Ga0075363_1001365692 | 114 |
| 313 | 3300006048 | Ga0075363_100352486 | Ga0075363_1003524862 | 114 |
| 314 | 3300006051 | Ga0075364_10001414 | Ga0075364_100014149 | 114 |
| 315 | 3300006051 | Ga0075364_10020127 | Ga0075364_100201272 | 114 |
| 316 | 3300006051 | Ga0075364_10027813 | Ga0075364_100278134 | 114 |
| 317 | 3300006051 | Ga0075364_10080694 | Ga0075364_100806942 | 114 |
| 318 | 3300006051 | Ga0075364_10152366 | Ga0075364_101523661 | 114 |
| 319 | 3300006051 | Ga0075364_10157763 | Ga0075364_101577632 | 114 |
| 320 | 3300006163 | Ga0070715_10035753 | Ga0070715_100357532 | 114 |
| 321 | 3300006173 | Ga0070716_100009944 | Ga0070716_1000099442 | 114 |
| 322 | 3300006173 | Ga0070716_100368460 | Ga0070716_1003684602 | 114 |
| 323 | 3300006175 | Ga0070712_100004671 | Ga0070712_1000046711 | 114 |
| 324 | 3300006175 | Ga0070712_100305967 | Ga0070712_1003059672 | 114 |
| 325 | 3300006177 | Ga0075362_10028392 | Ga0075362_100283923 | 114 |
| 326 | 3300006177 | Ga0075362_10324695 | Ga0075362_103246952 | 114 |
| 327 | 3300006177 | Ga0075362_10487996 | Ga0075362_104879962 | 114 |
| 328 | 3300006178 | Ga0075367_10019596 | Ga0075367_100195963 | 114 |
| 329 | 3300006178 | Ga0075367_10150722 | Ga0075367_101507222 | 114 |
| 330 | 3300006178 | Ga0075367_10357597 | Ga0075367_103575972 | 114 |
| 331 | 3300006186 | Ga0075369_10004544 | Ga0075369_100045442 | 114 |
| 332 | 3300006186 | Ga0075369_10017401 | Ga0075369_100174014 | 114 |
| 333 | 3300006186 | Ga0075369_10054488 | Ga0075369_100544881 | 114 |
| 334 | 3300006186 | Ga0075369_10158156 | Ga0075369_101581562 | 114 |
| 335 | 3300006186 | Ga0075369_10210800 | Ga0075369_102108001 | 114 |
| 336 | 3300006186 | Ga0075369_10275887 | Ga0075369_102758871 | 114 |
| 337 | 3300006186 | Ga0075369_10584235 | Ga0075369_105842352 | 114 |
| 338 | 3300006195 | Ga0075366_10130591 | Ga0075366_101305912 | 114 |
| 339 | 3300006353 | Ga0075370_10024765 | Ga0075370_100247652 | 114 |
| 340 | 3300006353 | Ga0075370_10090521 | Ga0075370_100905212 | 114 |
| 341 | 3300006353 | Ga0075370_10353010 | Ga0075370_103530102 | 114 |
| 342 | 3300006881 | Ga0068865_100090172 | Ga0068865_1000901722 | 114 |
| 343 | 3300006931 | Ga0097620_100001042 | Ga0097620_10000104214 | 114 |
| 344 | 3300006931 | Ga0097620_100077087 | Ga0097620_1000770872 | 114 |
| 345 | 3300006931 | Ga0097620_102747959 | Ga0097620_1027479592 | 114 |
| 346 | 3300007076 | Ga0075435_101459257 | Ga0075435_1014592572 | 114 |
| 347 | 3300009098 | Ga0105245_10008338 | Ga0105245_1000833810 | 114 |
| 348 | 3300009098 | Ga0105245_10611967 | Ga0105245_106119672 | 114 |
| 349 | 3300009098 | Ga0105245_12432130 | Ga0105245_124321302 | 114 |
| 350 | 3300009101 | Ga0105247_10000060 | Ga0105247_1000006074 | 114 |
| 351 | 3300009101 | Ga0105247_10000298 | Ga0105247_1000029823 | 114 |
| 352 | 3300009147 | Ga0114129_12700063 | Ga0114129_127000632 | 114 |
| 353 | 3300009148 | Ga0105243_10000700 | Ga0105243_100007009 | 114 |
| 354 | 3300009174 | Ga0105241_11597817 | Ga0105241_115978172 | 114 |
| 355 | 3300009176 | Ga0105242_10000325 | Ga0105242_1000032539 | 114 |
| 356 | 3300009177 | Ga0105248_10000050 | Ga0105248_1000005017 | 114 |
| 357 | 3300009177 | Ga0105248_10088134 | Ga0105248_100881342 | 114 |
| 358 | 3300009177 | Ga0105248_13114414 | Ga0105248_131144142 | 114 |
| 359 | 3300009545 | Ga0105237_10006011 | Ga0105237_100060118 | 114 |
| 360 | 3300009545 | Ga0105237_10011826 | Ga0105237_100118263 | 114 |
| 361 | 3300009551 | Ga0105238_10217724 | Ga0105238_102177243 | 114 |
| 362 | 3300009551 | Ga0105238_10829792 | Ga0105238_108297922 | 114 |
| 363 | 3300009553 | Ga0105249_10000042 | Ga0105249_10000042136 | 114 |
| 364 | 3300009553 | Ga0105249_10000470 | Ga0105249_1000047012 | 114 |
| 365 | 3300009553 | Ga0105249_10052537 | Ga0105249_100525372 | 114 |
| 366 | 3300009553 | Ga0105249_10463722 | Ga0105249_104637221 | 114 |
| 367 | 3300010159 | Ga0099796_10029743 | Ga0099796_100297432 | 114 |
| 368 | 3300010375 | Ga0105239_10016841 | Ga0105239_100168418 | 114 |
| 369 | 3300010375 | Ga0105239_10024596 | Ga0105239_100245962 | 114 |
| 370 | 3300010375 | Ga0105239_10415751 | Ga0105239_104157512 | 114 |
| 371 | 3300010375 | Ga0105239_11068124 | Ga0105239_110681242 | 114 |
| 372 | 3300011119 | Ga0105246_10268090 | Ga0105246_102680902 | 114 |
| 373 | 3300011119 | Ga0105246_10422698 | Ga0105246_104226982 | 114 |
| 374 | 3300013297 | Ga0157378_10013827 | Ga0157378_100138276 | 114 |
| 375 | 3300013297 | Ga0157378_12874990 | Ga0157378_128749901 | 114 |
| 376 | 3300013306 | Ga0163162_10089165 | Ga0163162_100891651 | 114 |
| 377 | 3300013306 | Ga0163162_10270692 | Ga0163162_102706922 | 114 |
| 378 | 3300013306 | Ga0163162_11335687 | Ga0163162_113356872 | 114 |
| 379 | 3300013307 | Ga0157372_10048234 | Ga0157372_100482342 | 114 |
| 380 | 3300013307 | Ga0157372_10673523 | Ga0157372_106735232 | 114 |
| 381 | 3300014325 | Ga0163163_10175729 | Ga0163163_101757292 | 114 |
| 382 | 3300014325 | Ga0163163_10245027 | Ga0163163_102450272 | 114 |
| 383 | 3300014326 | Ga0157380_10019608 | Ga0157380_100196083 | 114 |
| 384 | 3300014745 | Ga0157377_10476126 | Ga0157377_104761262 | 114 |
| 385 | 3300014968 | Ga0157379_10002499 | Ga0157379_1000249920 | 114 |
| 386 | 3300014969 | Ga0157376_10135466 | Ga0157376_101354662 | 114 |
| 387 | 3300017792 | Ga0163161_10027061 | Ga0163161_100270613 | 114 |
| 388 | 3300021384 | Ga0213876_10002110 | Ga0213876_100021109 | 114 |
| 389 | 3300021388 | Ga0213875_10036304 | Ga0213875_100363043 | 114 |
| 390 | 3300021388 | Ga0213875_10081020 | Ga0213875_100810201 | 114 |
| 391 | 3300025303 | Ga0209051_1001345 | Ga0209051_100134517 | 114 |
| 392 | 3300025303 | Ga0209051_1010755 | Ga0209051_10107553 | 114 |
| 393 | 3300025898 | Ga0207692_10007732 | Ga0207692_100077321 | 114 |
| 394 | 3300025899 | Ga0207642_10001048 | Ga0207642_100010487 | 114 |
| 395 | 3300025900 | Ga0207710_10000010 | Ga0207710_1000001076 | 114 |
| 396 | 3300025900 | Ga0207710_10023951 | Ga0207710_100239512 | 114 |
| 397 | 3300025901 | Ga0207688_10914849 | Ga0207688_109148492 | 114 |
| 398 | 3300025903 | Ga0207680_10014842 | Ga0207680_100148423 | 114 |
| 399 | 3300025904 | Ga0207647_10190458 | Ga0207647_101904582 | 114 |
| 400 | 3300025905 | Ga0207685_10150813 | Ga0207685_101508132 | 114 |
| 401 | 3300025907 | Ga0207645_10706452 | Ga0207645_107064522 | 114 |
| 402 | 3300025914 | Ga0207671_10007606 | Ga0207671_100076067 | 114 |
| 403 | 3300025914 | Ga0207671_10074011 | Ga0207671_100740113 | 114 |
| 404 | 3300025914 | Ga0207671_10402997 | Ga0207671_104029972 | 114 |
| 405 | 3300025915 | Ga0207693_10000754 | Ga0207693_1000075427 | 114 |
| 406 | 3300025916 | Ga0207663_10004087 | Ga0207663_100040873 | 114 |
| 407 | 3300025921 | Ga0207652_11098335 | Ga0207652_110983351 | 114 |
| 408 | 3300025923 | Ga0207681_10034834 | Ga0207681_100348344 | 114 |
| 409 | 3300025923 | Ga0207681_10071094 | Ga0207681_100710943 | 114 |
| 410 | 3300025924 | Ga0207694_10051458 | Ga0207694_100514583 | 114 |
| 411 | 3300025925 | Ga0207650_10354730 | Ga0207650_103547302 | 114 |
| 412 | 3300025927 | Ga0207687_10003034 | Ga0207687_1000303410 | 114 |
| 413 | 3300025927 | Ga0207687_11440980 | Ga0207687_114409802 | 114 |
| 414 | 3300025928 | Ga0207700_10451888 | Ga0207700_104518882 | 114 |
| 415 | 3300025929 | Ga0207664_10539498 | Ga0207664_105394982 | 114 |
| 416 | 3300025929 | Ga0207664_10733868 | Ga0207664_107338682 | 114 |
| 417 | 3300025931 | Ga0207644_10019755 | Ga0207644_100197553 | 114 |
| 418 | 3300025931 | Ga0207644_10600516 | Ga0207644_106005162 | 114 |
| 419 | 3300025931 | Ga0207644_10647832 | Ga0207644_106478322 | 114 |
| 420 | 3300025932 | Ga0207690_10222592 | Ga0207690_102225922 | 114 |
| 421 | 3300025933 | Ga0207706_10021979 | Ga0207706_100219793 | 114 |
| 422 | 3300025933 | Ga0207706_10823668 | Ga0207706_108236682 | 114 |
| 423 | 3300025934 | Ga0207686_10002494 | Ga0207686_100024947 | 114 |
| 424 | 3300025935 | Ga0207709_10007107 | Ga0207709_100071076 | 114 |
| 425 | 3300025936 | Ga0207670_10496316 | Ga0207670_104963161 | 114 |
| 426 | 3300025937 | Ga0207669_10001189 | Ga0207669_100011893 | 114 |
| 427 | 3300025938 | Ga0207704_10002289 | Ga0207704_100022892 | 114 |
| 428 | 3300025939 | Ga0207665_10009094 | Ga0207665_100090946 | 114 |
| 429 | 3300025939 | Ga0207665_10699682 | Ga0207665_106996822 | 114 |
| 430 | 3300025941 | Ga0207711_10001406 | Ga0207711_1000140619 | 114 |
| 431 | 3300025941 | Ga0207711_10032792 | Ga0207711_100327924 | 114 |
| 432 | 3300025942 | Ga0207689_10031372 | Ga0207689_100313724 | 114 |
| 433 | 3300025942 | Ga0207689_10752573 | Ga0207689_107525732 | 114 |
| 434 | 3300025949 | Ga0207667_10823680 | Ga0207667_108236802 | 114 |
| 435 | 3300025961 | Ga0207712_10000010 | Ga0207712_10000010315 | 114 |
| 436 | 3300025961 | Ga0207712_10001196 | Ga0207712_1000119620 | 114 |
| 437 | 3300025972 | Ga0207668_10006413 | Ga0207668_100064136 | 114 |
| 438 | 3300025972 | Ga0207668_10160530 | Ga0207668_101605302 | 114 |
| 439 | 3300025972 | Ga0207668_10258034 | Ga0207668_102580342 | 114 |
| 440 | 3300025972 | Ga0207668_11956577 | Ga0207668_119565771 | 114 |
| 441 | 3300025981 | Ga0207640_10009045 | Ga0207640_100090454 | 114 |
| 442 | 3300025981 | Ga0207640_10267566 | Ga0207640_102675662 | 114 |
| 443 | 3300025986 | Ga0207658_10000677 | Ga0207658_1000067721 | 114 |
| 444 | 3300025986 | Ga0207658_10007671 | Ga0207658_100076716 | 114 |
| 445 | 3300025986 | Ga0207658_10061168 | Ga0207658_100611684 | 114 |
| 446 | 3300025986 | Ga0207658_10125469 | Ga0207658_101254692 | 114 |
| 447 | 3300025986 | Ga0207658_10697148 | Ga0207658_106971482 | 114 |
| 448 | 3300026023 | Ga0207677_10047066 | Ga0207677_100470663 | 114 |
| 449 | 3300026023 | Ga0207677_10210790 | Ga0207677_102107901 | 114 |
| 450 | 3300026023 | Ga0207677_10474370 | Ga0207677_104743702 | 114 |
| 451 | 3300026035 | Ga0207703_10009823 | Ga0207703_100098236 | 114 |
| 452 | 3300026035 | Ga0207703_10028562 | Ga0207703_100285624 | 114 |
| 453 | 3300026035 | Ga0207703_10416991 | Ga0207703_104169911 | 114 |
| 454 | 3300026041 | Ga0207639_10007030 | Ga0207639_100070305 | 114 |
| 455 | 3300026041 | Ga0207639_10117806 | Ga0207639_101178063 | 114 |
| 456 | 3300026067 | Ga0207678_10009360 | Ga0207678_1000936011 | 114 |
| 457 | 3300026067 | Ga0207678_10307275 | Ga0207678_103072753 | 114 |
| 458 | 3300026075 | Ga0207708_10006796 | Ga0207708_100067966 | 114 |
| 459 | 3300026075 | Ga0207708_10416206 | Ga0207708_104162062 | 114 |
| 460 | 3300026078 | Ga0207702_12139177 | Ga0207702_121391771 | 114 |
| 461 | 3300026088 | Ga0207641_10000849 | Ga0207641_100008499 | 114 |
| 462 | 3300026088 | Ga0207641_10020040 | Ga0207641_100200403 | 114 |
| 463 | 3300026088 | Ga0207641_10026225 | Ga0207641_100262255 | 114 |
| 464 | 3300026089 | Ga0207648_10008331 | Ga0207648_100083312 | 114 |
| 465 | 3300026095 | Ga0207676_10780961 | Ga0207676_107809612 | 114 |
| 466 | 3300026095 | Ga0207676_11208545 | Ga0207676_112085451 | 114 |
| 467 | 3300026118 | Ga0207675_100007850 | Ga0207675_1000078504 | 114 |
| 468 | 3300026118 | Ga0207675_100260493 | Ga0207675_1002604932 | 114 |
| 469 | 3300026118 | Ga0207675_101094830 | Ga0207675_1010948301 | 114 |
| 470 | 3300026118 | Ga0207675_101991034 | Ga0207675_1019910342 | 114 |
| 471 | 3300026121 | Ga0207683_10000984 | Ga0207683_100009844 | 114 |
| 472 | 3300026121 | Ga0207683_10290362 | Ga0207683_102903622 | 114 |
| 473 | 3300026142 | Ga0207698_10199898 | Ga0207698_101998982 | 114 |
| 474 | 3300027866 | Ga0209813_10490391 | Ga0209813_104903912 | 114 |
| 475 | 3300028379 | Ga0268266_10006935 | Ga0268266_100069354 | 114 |
| 476 | 3300028380 | Ga0268265_10000014 | Ga0268265_10000014138 | 114 |
| 477 | 3300028380 | Ga0268265_10026662 | Ga0268265_100266625 | 114 |
| 478 | 3300028380 | Ga0268265_10955307 | Ga0268265_109553072 | 114 |
| 479 | 3300028381 | Ga0268264_10000150 | Ga0268264_1000015021 | 114 |
| 480 | 3300028381 | Ga0268264_10046360 | Ga0268264_100463602 | 114 |
| 481 | 3300028381 | Ga0268264_10320951 | Ga0268264_103209513 | 114 |
| 482 | 3300031731 | Ga0307405_10073751 | Ga0307405_100737512 | 114 |
| 483 | 3300031824 | Ga0307413_11210083 | Ga0307413_112100831 | 114 |
| 484 | 3300031852 | Ga0307410_10083330 | Ga0307410_100833302 | 114 |
| 485 | 3300031852 | Ga0307410_11349601 | Ga0307410_113496012 | 114 |
| 486 | 3300031903 | Ga0307407_10251828 | Ga0307407_102518282 | 114 |
| 487 | 3300031911 | Ga0307412_10208993 | Ga0307412_102089933 | 114 |
| 488 | 3300031995 | Ga0307409_100004098 | Ga0307409_1000040985 | 114 |
| 489 | 3300031995 | Ga0307409_100039873 | Ga0307409_1000398732 | 114 |
| 490 | 3300032002 | Ga0307416_100162681 | Ga0307416_1001626812 | 114 |
| 491 | 3300032004 | Ga0307414_11019421 | Ga0307414_110194212 | 114 |
| 492 | 3300032005 | Ga0307411_10510527 | Ga0307411_105105271 | 114 |
| 493 | 3300032126 | Ga0307415_100303069 | Ga0307415_1003030692 | 114 |
| 494 | 3300034816 | Ga0373930_0137645 | Ga0373930_0137645_151_495 | 114 |
| 495 | 3300035090 | Ga0373949_0105793 | Ga0373949_0105793_201_545 | 114 |
| 496 | 3300035091 | Ga0373951_0017482 | Ga0373951_0017482_28_372 | 114 |
| 497 | 3300035112 | Ga0373932_0400942 | Ga0373932_0400942_28_372 | 114 |
| 498 | 3300035242 | Ga0373962_0010540 | Ga0373962_0010540_592_936 | 114 |
| 499 | 3300035242 | Ga0373962_0137281 | Ga0373962_0137281_269_613 | 114 |
| 500 | 3300035691 | Ga0373931_0018006 | Ga0373931_0018006_1341_1685 | 114 |
| 501 | 3300037853 | Ga0436364_0780709 | Ga0436364_0780709_968_1315 | 114 |
| 502 | 3300037853 | Ga0436364_1308388 | Ga0436364_1308388_16183_16542 | 114 |
| 503 | 3300039437 | Ga0436365_1646946 | Ga0436365_1646946_23958_24314 | 114 |
| 504 | 3300039437 | Ga0436365_1657364 | Ga0436365_1657364_911_1270 | 114 |
| 505 | 3300039438 | Ga0436360_0672569 | Ga0436360_0672569_532_879 | 114 |
| 506 | 3300039447 | Ga0436361_0106752 | Ga0436361_0106752_13_360 | 114 |
| 507 | 3300039447 | Ga0436361_1011217 | Ga0436361_1011217_590_970 | 114 |
| 508 | 3300039450 | Ga0436363_0344303 | Ga0436363_0344303_281_625 | 114 |
| 509 | 3300039450 | Ga0436363_1376063 | Ga0436363_1376063_185_532 | 114 |
| 510 | 3300041410 | Ga0439461_0007259 | Ga0439461_0007259_1459_1803 | 114 |
| 511 | 3300041410 | Ga0439461_0096349 | Ga0439461_0096349_327_671 | 114 |
| 512 | 3300041411 | Ga0439466_0009584 | Ga0439466_0009584_1097_1441 | 114 |
| 513 | 3300041411 | Ga0439466_0023180 | Ga0439466_0023180_1576_1920 | 114 |
| 514 | 3300041413 | Ga0439465_0002866 | Ga0439465_0002866_2400_2747 | 114 |
| 515 | 3300041413 | Ga0439465_0002904 | Ga0439465_0002904_2982_3326 | 114 |
| 516 | 3300041413 | Ga0439465_0047333 | Ga0439465_0047333_574_918 | 114 |
| 517 | 3300041441 | Ga0451787_726021 | Ga0451787_726021_156_524 | 114 |
| 518 | 3300041452 | Ga0451793_0435955 | Ga0451793_0435955_77_427 | 114 |
| 519 | 3300041456 | Ga0451795_0833080 | Ga0451795_0833080_10_360 | 114 |
| 520 | 3300041507 | Ga0451851_0672866 | Ga0451851_0672866_258_602 | 114 |
| 521 | 3300041997 | Ga0439431_0008285 | Ga0439431_0008285_1778_2122 | 114 |
| 522 | 3300042002 | Ga0439442_005501 | Ga0439442_005501_1201_1545 | 114 |
| 523 | 3300042002 | Ga0439442_026101 | Ga0439442_026101_165_509 | 114 |
| 524 | 3300042435 | Ga0439434_0029139 | Ga0439434_0029139_1314_1658 | 114 |
| 525 | 3300042435 | Ga0439434_0192560 | Ga0439434_0192560_212_556 | 114 |
| 526 | 3300042438 | Ga0439459_0024743 | Ga0439459_0024743_456_833 | 114 |
| 527 | 3300044656 | Ga0466969_0072566 | Ga0466969_0072566_42_398 | 114 |
| 528 | 3300044658 | Ga0466972_0008599 | Ga0466972_0008599_305_649 | 114 |
| 529 | 3300044658 | Ga0466972_0189564 | Ga0466972_0189564_486_842 | 114 |
| 530 | 3300044683 | Ga0466965_0010937 | Ga0466965_0010937_349_693 | 114 |
| 531 | 3300044684 | Ga0466966_0001105 | Ga0466966_0001105_12739_13095 | 114 |
| 532 | 3300044684 | Ga0466966_0001218 | Ga0466966_0001218_11151_11498 | 114 |
| 533 | 3300044684 | Ga0466966_0028710 | Ga0466966_0028710_502_846 | 114 |
| 534 | 3300044693 | Ga0466961_0001949 | Ga0466961_0001949_8899_9255 | 114 |
| 535 | 3300044693 | Ga0466961_0053399 | Ga0466961_0053399_2030_2374 | 114 |
| 536 | 3300044693 | Ga0466961_0104802 | Ga0466961_0104802_832_1179 | 114 |
| 537 | 3300044694 | Ga0466963_0012616 | Ga0466963_0012616_4059_4406 | 114 |
| 538 | 3300044694 | Ga0466963_0362558 | Ga0466963_0362558_10_354 | 114 |
| 539 | 3300044694 | Ga0466963_0421711 | Ga0466963_0421711_501_857 | 114 |
| 540 | 3300044706 | Ga0466964_0107557 | Ga0466964_0107557_210_554 | 114 |
| 541 | 3300044719 | Ga0466971_0003761 | Ga0466971_0003761_566_910 | 114 |
| 542 | 3300044719 | Ga0466971_0022480 | Ga0466971_0022480_472_816 | 114 |
| 543 | 3300044719 | Ga0466971_0150847 | Ga0466971_0150847_344_700 | 114 |
| 544 | 3300044735 | Ga0466968_0001182 | Ga0466968_0001182_5861_6208 | 114 |
| 545 | 3300044735 | Ga0466968_0033488 | Ga0466968_0033488_1434_1778 | 114 |
| 546 | 3300044765 | Ga0466970_0040721 | Ga0466970_0040721_1854_2201 | 114 |
| 547 | 3300044765 | Ga0466970_0077835 | Ga0466970_0077835_521_865 | 114 |
| 548 | 3300044765 | Ga0466970_0379011 | Ga0466970_0379011_120_482 | 114 |
| 549 | 3300044842 | Ga0466957_0000981 | Ga0466957_0000981_5191_5547 | 114 |
| 550 | 3300044842 | Ga0466957_0031268 | Ga0466957_0031268_934_1278 | 114 |
| 551 | 3300044842 | Ga0466957_0041631 | Ga0466957_0041631_900_1247 | 114 |
| 552 | 3300044842 | Ga0466957_0065523 | Ga0466957_0065523_357_704 | 114 |
| 553 | 3300045049 | Ga0466959_0000774 | Ga0466959_0000774_13395_13751 | 114 |
| 554 | 3300045049 | Ga0466959_0001867 | Ga0466959_0001867_8538_8885 | 114 |
| 555 | 3300045049 | Ga0466959_0314834 | Ga0466959_0314834_607_951 | 114 |
| 556 | 3300045836 | Ga0466958_0001942 | Ga0466958_0001942_5509_5865 | 114 |
| 557 | 3300045836 | Ga0466958_0003868 | Ga0466958_0003868_5415_5762 | 114 |
| 558 | 3300045836 | Ga0466958_0347027 | Ga0466958_0347027_104_448 | 114 |
| 559 | 3300045836 | Ga0466958_0352454 | Ga0466958_0352454_173_517 | 114 |
| 560 | 3300045976 | Ga0466967_0006454 | Ga0466967_0006454_199_543 | 114 |
| 561 | 3300045976 | Ga0466967_0334416 | Ga0466967_0334416_644_991 | 114 |
| 562 | 3300045976 | Ga0466967_0709277 | Ga0466967_0709277_511_855 | 114 |
| 563 | 3300045976 | Ga0466967_0988656 | Ga0466967_0988656_160_504 | 114 |
| 564 | 3300045976 | Ga0466967_1016565 | Ga0466967_1016565_57_401 | 114 |
| 565 | 3300045976 | Ga0466967_1537566 | Ga0466967_1537566_237_596 | 114 |
| 566 | 3300046459 | Ga0495629_0050017 | Ga0495629_0050017_1006_1350 | 114 |
| 567 | 3300046461 | Ga0495641_0171717 | Ga0495641_0171717_83_427 | 114 |
| 568 | 3300046513 | Ga0495616_0191824 | Ga0495616_0191824_174_518 | 114 |
| 569 | 3300046515 | Ga0495620_0060421 | Ga0495620_0060421_1000_1344 | 114 |
| 570 | 3300046531 | Ga0495665_0119069 | Ga0495665_0119069_896_1240 | 114 |
| 571 | 3300046533 | Ga0495640_0048156 | Ga0495640_0048156_1485_1829 | 114 |
| 572 | 3300046663 | Ga0495635_0190327 | Ga0495635_0190327_536_913 | 114 |
| 573 | 3300046678 | Ga0495599_0283133 | Ga0495599_0283133_577_921 | 114 |
| 574 | 3300046683 | Ga0495658_0099821 | Ga0495658_0099821_156_500 | 114 |
| 575 | 3300047315 | Ga0495581_0206725 | Ga0495581_0206725_568_912 | 114 |
| 576 | 3300047320 | Ga0495672_0107141 | Ga0495672_0107141_973_1317 | 114 |
| 577 | 3300047321 | Ga0495676_0221348 | Ga0495676_0221348_915_1259 | 114 |
| 578 | 3300047673 | Ga0495593_0047404 | Ga0495593_0047404_237_581 | 114 |
| 579 | 3300048903 | Ga0496100_0001148 | Ga0496100_0001148_11525_11902 | 114 |
| 580 | 3300048903 | Ga0496100_0001530 | Ga0496100_0001530_5936_6280 | 114 |
| 581 | 3300048903 | Ga0496100_0386033 | Ga0496100_0386033_107_460 | 114 |
| 582 | 3300048903 | Ga0496100_1186075 | Ga0496100_1186075_188_532 | 114 |
| 583 | 3300048904 | Ga0496101_0000110 | Ga0496101_0000110_18353_18730 | 114 |
| 584 | 3300048904 | Ga0496101_0013571 | Ga0496101_0013571_2432_2776 | 114 |
| 585 | 3300048904 | Ga0496101_0142244 | Ga0496101_0142244_984_1337 | 114 |
| 586 | 3300048904 | Ga0496101_0245115 | Ga0496101_0245115_231_575 | 114 |
| 587 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_317479_317856 | 114 |
| 588 | 3300048905 | Ga0496102_0003241 | Ga0496102_0003241_5471_5824 | 114 |
| 589 | 3300048905 | Ga0496102_0005337 | Ga0496102_0005337_1567_1911 | 114 |
| 590 | 3300048905 | Ga0496102_0244209 | Ga0496102_0244209_1228_1572 | 114 |
| 591 | 3300048905 | Ga0496102_0594017 | Ga0496102_0594017_61_405 | 114 |
| 592 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_317277_317654 | 114 |
| 593 | 3300048906 | Ga0496103_0004893 | Ga0496103_0004893_73_417 | 114 |
| 594 | 3300048906 | Ga0496103_0019975 | Ga0496103_0019975_1044_1397 | 114 |
| 595 | 3300048907 | Ga0496104_0055184 | Ga0496104_0055184_2651_3004 | 114 |
| 596 | 3300048908 | Ga0496105_0044484 | Ga0496105_0044484_3157_3510 | 114 |
| 597 | 3300048908 | Ga0496105_0134415 | Ga0496105_0134415_498_875 | 114 |
| 598 | 3300048909 | Ga0496106_0000616 | Ga0496106_0000616_9059_9403 | 114 |
| 599 | 3300048909 | Ga0496106_1109741 | Ga0496106_1109741_107_484 | 114 |
| 600 | 3300048910 | Ga0496107_0001329 | Ga0496107_0001329_1144_1488 | 114 |
| 601 | 3300048911 | Ga0496108_0186793 | Ga0496108_0186793_999_1343 | 114 |
| 602 | 3300048911 | Ga0496108_0670087 | Ga0496108_0670087_34_378 | 114 |
| 603 | 3300048912 | Ga0496109_0374002 | Ga0496109_0374002_503_856 | 114 |
| 604 | 3300048912 | Ga0496109_0415287 | Ga0496109_0415287_381_725 | 114 |
| 605 | 3300048913 | Ga0496110_0168417 | Ga0496110_0168417_1622_1966 | 114 |
| 606 | 3300048913 | Ga0496110_1216350 | Ga0496110_1216350_222_584 | 114 |
| 607 | 3300048914 | Ga0496111_0294223 | Ga0496111_0294223_627_980 | 114 |
| 608 | 3300048915 | Ga0496112_0019953 | Ga0496112_0019953_5528_5872 | 114 |
| 609 | 3300048915 | Ga0496112_0252536 | Ga0496112_0252536_249_593 | 114 |
| 610 | 3300048916 | Ga0496113_0159294 | Ga0496113_0159294_640_984 | 114 |
| 611 | 3300048917 | Ga0496114_0000522 | Ga0496114_0000522_20366_20710 | 114 |
| 612 | 3300048918 | Ga0496115_0002348 | Ga0496115_0002348_365_709 | 114 |
| 613 | 3300048918 | Ga0496115_0214817 | Ga0496115_0214817_405_749 | 114 |
| 614 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_152886_153263 | 114 |
| 615 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_152886_153263 | 114 |
| 616 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_152886_153263 | 114 |
| 617 | 3300048922 | Ga0496119_0000035 | Ga0496119_0000035_67124_67501 | 114 |
| 618 | 3300048922 | Ga0496119_0438713 | Ga0496119_0438713_86_439 | 114 |
| 619 | 3300048923 | Ga0496120_0000079 | Ga0496120_0000079_25620_25997 | 114 |
| 620 | 3300048924 | Ga0496121_0000090 | Ga0496121_0000090_100676_101053 | 114 |
| 621 | 3300048927 | Ga0496124_0429981 | Ga0496124_0429981_191_541 | 114 |
| 622 | 3300048929 | Ga0496126_0002186 | Ga0496126_0002186_13659_14003 | 114 |
| 623 | 3300048929 | Ga0496126_0030158 | Ga0496126_0030158_282_659 | 114 |
| 624 | 3300049569 | Ga0501032_0394303 | Ga0501032_0394303_453_797 | 114 |
| 625 | 3300049571 | Ga0501034_0091269 | Ga0501034_0091269_548_892 | 114 |
| 626 | 3300049580 | Ga0501046_0238098 | Ga0501046_0238098_337_681 | 114 |
| 627 | 3300049581 | Ga0501047_0011332 | Ga0501047_0011332_7542_7886 | 114 |
| 628 | 3300049581 | Ga0501047_0649234 | Ga0501047_0649234_366_710 | 114 |
| 629 | 3300049582 | Ga0501048_0586807 | Ga0501048_0586807_212_568 | 114 |
| 630 | 3300049586 | Ga0501070_0093403 | Ga0501070_0093403_1084_1437 | 114 |
| 631 | 3300049742 | Ga0501080_0542211 | Ga0501080_0542211_460_813 | 114 |
| 632 | 3300049822 | Ga0501035_0000497 | Ga0501035_0000497_11236_11580 | 114 |
| 633 | 3300049823 | Ga0501044_0007277 | Ga0501044_0007277_5123_5467 | 114 |
| 634 | 3300049823 | Ga0501044_0042930 | Ga0501044_0042930_3816_4163 | 114 |
| 635 | 3300049823 | Ga0501044_0444084 | Ga0501044_0444084_76_432 | 114 |
| 636 | 3300050489 | nmdc:mga03683_179253_c1 | nmdc:mga03683_179253_c1_552_896 | 114 |
| 637 | 3300050489 | nmdc:mga03683_23689_c1 | nmdc:mga03683_23689_c1_142_486 | 114 |
| 638 | 3300050489 | nmdc:mga03683_417253_c1 | nmdc:mga03683_417253_c1_241_594 | 114 |
| 639 | 3300050490 | nmdc:mga03n38_148780_c1 | nmdc:mga03n38_148780_c1_532_879 | 114 |
| 640 | 3300050490 | nmdc:mga03n38_2381_c1 | nmdc:mga03n38_2381_c1_5349_5693 | 114 |
| 641 | 3300050490 | nmdc:mga03n38_323265_c1 | nmdc:mga03n38_323265_c1_315_659 | 114 |
| 642 | 3300050490 | nmdc:mga03n38_421862_c1 | nmdc:mga03n38_421862_c1_77_421 | 114 |
| 643 | 3300050490 | nmdc:mga03n38_656131_c1 | nmdc:mga03n38_656131_c1_129_473 | 114 |
| 644 | 3300050490 | nmdc:mga03n38_831841_c1 | nmdc:mga03n38_831841_c1_66_410 | 114 |
| 645 | 3300050491 | nmdc:mga00v17_15511_c1 | nmdc:mga00v17_15511_c1_360_704 | 114 |
| 646 | 3300050491 | nmdc:mga00v17_238225_c1 | nmdc:mga00v17_238225_c1_336_686 | 114 |
| 647 | 3300050491 | nmdc:mga00v17_259274_c1 | nmdc:mga00v17_259274_c1_754_1098 | 114 |
| 648 | 3300050491 | nmdc:mga00v17_275111_c1 | nmdc:mga00v17_275111_c1_238_585 | 114 |
| 649 | 3300050491 | nmdc:mga00v17_28984_c1 | nmdc:mga00v17_28984_c1_884_1228 | 114 |
| 650 | 3300050491 | nmdc:mga00v17_38260_c1 | nmdc:mga00v17_38260_c1_2034_2390 | 114 |
| 651 | 3300050491 | nmdc:mga00v17_84002_c1 | nmdc:mga00v17_84002_c1_831_1184 | 114 |
| 652 | 3300050492 | nmdc:mga0yw44_2784_c1 | nmdc:mga0yw44_2784_c1_576_920 | 114 |
| 653 | 3300050492 | nmdc:mga0yw44_47147_c1 | nmdc:mga0yw44_47147_c1_1620_1964 | 114 |
| 654 | 3300050492 | nmdc:mga0yw44_66954_c1 | nmdc:mga0yw44_66954_c1_729_1073 | 114 |
| 655 | 3300050493 | nmdc:mga0k408_189390_c1 | nmdc:mga0k408_189390_c1_812_1156 | 114 |
| 656 | 3300050494 | nmdc:mga06z11_186539_c1 | nmdc:mga06z11_186539_c1_678_1022 | 114 |
| 657 | 3300050494 | nmdc:mga06z11_247361_c1 | nmdc:mga06z11_247361_c1_323_667 | 114 |
| 658 | 3300050494 | nmdc:mga06z11_859682_c1 | nmdc:mga06z11_859682_c1_129_473 | 114 |
| 659 | 3300050495 | nmdc:mga04h51_528264_c1 | nmdc:mga04h51_528264_c1_81_431 | 114 |
| 660 | 3300050496 | nmdc:mga07m45_20108_c1 | nmdc:mga07m45_20108_c1_313_657 | 114 |
| 661 | 3300050496 | nmdc:mga07m45_223956_c1 | nmdc:mga07m45_223956_c1_211_555 | 114 |
| 662 | 3300050496 | nmdc:mga07m45_72746_c1 | nmdc:mga07m45_72746_c1_1052_1396 | 114 |
| 663 | 3300050496 | nmdc:mga07m45_765773_c1 | nmdc:mga07m45_765773_c1_114_467 | 114 |
| 664 | 3300050513 | nmdc:mga0rr50_1224350_c1 | nmdc:mga0rr50_1224350_c1_82_426 | 114 |
| 665 | 3300050516 | nmdc:mga0sz30_142680_c1 | nmdc:mga0sz30_142680_c1_653_1003 | 114 |
| 666 | 3300050516 | nmdc:mga0sz30_142957_c1 | nmdc:mga0sz30_142957_c1_702_1046 | 114 |
| 667 | 3300050516 | nmdc:mga0sz30_15363_c1 | nmdc:mga0sz30_15363_c1_1735_2082 | 114 |
| 668 | 3300050516 | nmdc:mga0sz30_235460_c1 | nmdc:mga0sz30_235460_c1_76_423 | 114 |
| 669 | 3300050516 | nmdc:mga0sz30_23957_c1 | nmdc:mga0sz30_23957_c1_1813_2157 | 114 |
| 670 | 3300050516 | nmdc:mga0sz30_86067_c1 | nmdc:mga0sz30_86067_c1_347_691 | 114 |
| 671 | 3300053077 | Ga0495601_0339808 | Ga0495601_0339808_220_564 | 114 |
| 672 | 3300053080 | Ga0500635_0027164 | Ga0500635_0027164_1080_1436 | 114 |
| 673 | 3300053083 | Ga0495655_0081153 | Ga0495655_0081153_546_890 | 114 |
| 674 | 3300053083 | Ga0495655_0133853 | Ga0495655_0133853_122_466 | 114 |
| 675 | 3300053083 | Ga0495655_0146864 | Ga0495655_0146864_207_551 | 114 |
| 676 | 3300053085 | Ga0495619_0094594 | Ga0495619_0094594_413_757 | 114 |
| 677 | 3300053096 | Ga0500641_0183658 | Ga0500641_0183658_266_619 | 114 |
| 678 | 3300053129 | Ga0500628_042736 | Ga0500628_042736_302_646 | 114 |
| 679 | 3300053131 | Ga0500652_008367 | Ga0500652_008367_495_851 | 114 |
| 680 | 3300053153 | Ga0500616_0292747 | Ga0500616_0292747_114_458 | 114 |
| 681 | 3300061719 | Ga0466962_0023192 | Ga0466962_0023192_1425_1769 | 114 |
| 682 | 3300061719 | Ga0466962_0032563 | Ga0466962_0032563_69_413 | 114 |
| 683 | 3300061719 | Ga0466962_0192561 | Ga0466962_0192561_266_622 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s3c-assembly1.cif.gz_A | arsenate reductase c12s mutant from e. coli | 0.9535 | 3 | 114 |
| 1i9d-assembly1.cif.gz_A | arsenate reductase from e. coli | 0.9528 | 3 | 114 |
| 1sd8-assembly1.cif.gz_A | arsenate reductase r60k mutant from e. coli | 0.9526 | 3 | 114 |
| 1s3d-assembly1.cif.gz_A | arsenate reductase r60a mutant from e. coli | 0.952 | 3 | 114 |
| 1sjz-assembly1.cif.gz_A | arsenate reductase r60k mutant +0.4m arsenite from e. coli | 0.9429 | 3 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9414 | 3 | 114 | 3.40.30.10 |
| 3rdwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9237 | 3 | 112 | 3.40.30.10 |
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9178 | 3 | 114 | 3.40.30.10 |
| af_A0A1D6IL16_82_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.91 | 2 | 32 | 3.40.30.10 |
| af_P23202_75_198_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8941 | 2 | 32 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9GFL3-F1-model_v4 | Arsenate reductase (Glutaredoxin) | 0.9844 | 15 | 97 |
GO:0046685
|
| AF-A0A7K2HRA7-F1-model_v4 | arsenate reductase (glutathione/glutaredoxin) (EC 1.20.4.1) | 0.9827 | 3 | 114 |
GO:0008794
GO:0046685 |
| AF-A0A850QCQ4-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 0.9813 | 4 | 107 |
GO:0008794
GO:0046685 |
| AF-X8F164-F1-model_v4 | deleted | 0.9776 | 22 | 114 |
|
| AF-A0A7V1K3J3-F1-model_v4 | Arsenate reductase (Glutaredoxin) (EC 1.20.4.1) | 0.9763 | 1 | 90 |
GO:0008794
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar