F474992

General Info

Members Datasets Scaffolds Average Seq Length
683 313 675 115

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1011217|Ga0436361_1011217_590_970
Length 126
Sequence MASRPDQAVIYHNPKCSTSRKTLELLRDNGVEPTLVQYLKTPPGGTSRLRGTRGELVTMIRDAGIDVRSAIRKRESLCGELNLADASDDQLLDAMAEHPVLIERPFVVTPKGTRLARPVDRVREIL

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
188 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
189 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
308 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.37
Nodule 0.15
Rhizoplane 11.13
Rhizosphere 66.62
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10100835 3300001989 Bacteria 872
2 JGI24737J22298_10083722 3300001990 Bacteria 948
3 JGI24735J21928_10062902 3300002067 Bacteria 1065
4 JGI24735J21928_10080511 3300002067 Bacteria 933
5 JGI24744J21845_10002910 3300002077 Bacteria 3500
6 JGI24034J26672_10014121 3300002239 Bacteria 1216
7 Ga0055540_1010510 3300003792 Bacteria 3075
8 Ga0055540_1010819 3300003792 Bacteria 3007
9 Ga0070676_10059747 3300005328 Bacteria 2262
10 Ga0070690_100251515 3300005330 Bacteria 1250
11 Ga0070677_10243331 3300005333 Bacteria 889
12 Ga0068869_101084253 3300005334 Bacteria 700
13 Ga0070666_10014436 3300005335 Bacteria 5029
14 Ga0070666_10066179 3300005335 Bacteria 2452
15 Ga0070682_100003080 3300005337 Bacteria 9232
16 Ga0070682_100038791 3300005337 Bacteria 2924
17 Ga0070682_100066156 3300005337 Bacteria 2299
18 Ga0070682_100695119 3300005337 Bacteria 815
19 Ga0068868_100001163 3300005338 Bacteria 18048
20 Ga0070660_100354907 3300005339 Bacteria 1208
21 Ga0070689_100076385 3300005340 Bacteria 2624
22 Ga0070689_101282709 3300005340 Bacteria 659
23 Ga0070691_10109073 3300005341 Bacteria 1383
24 Ga0070692_10563468 3300005345 Bacteria 748
25 Ga0070668_100001540 3300005347 Bacteria 16632
26 Ga0070668_100013630 3300005347 Bacteria 6070
27 Ga0070668_101183060 3300005347 Bacteria 692
28 Ga0070668_101721540 3300005347 Bacteria 576
29 Ga0070669_100018910 3300005353 Bacteria 4924
30 Ga0070671_100012258 3300005355 Bacteria 6897
31 Ga0070671_100173699 3300005355 Bacteria 1823
32 Ga0070671_100827414 3300005355 Bacteria 807
33 Ga0070674_100003394 3300005356 Bacteria 8927
34 Ga0070674_100004262 3300005356 Bacteria 8136
35 Ga0070674_100389244 3300005356 Bacteria 1136
36 Ga0070674_100771590 3300005356 Bacteria 828
37 Ga0070688_100054103 3300005365 Bacteria 2513
38 Ga0070659_100254920 3300005366 Bacteria 1455
39 Ga0070659_100553719 3300005366 Bacteria 985
40 Ga0070667_100000791 3300005367 Bacteria 29649
41 Ga0070667_100013169 3300005367 Bacteria 6836
42 Ga0070667_100013973 3300005367 Bacteria 6635
43 Ga0070667_100027611 3300005367 Bacteria 4723
44 Ga0070667_100055913 3300005367 Bacteria 3332
45 Ga0070667_100244906 3300005367 Bacteria 1602
46 Ga0070667_101554950 3300005367 Bacteria 621
47 Ga0070667_101987443 3300005367 Bacteria 548
48 Ga0070709_10469052 3300005434 Bacteria 951
49 Ga0070714_100003669 3300005435 Bacteria 11491
50 Ga0070714_100261269 3300005435 Bacteria 1603
51 Ga0070713_100111408 3300005436 Bacteria 2387
52 Ga0070710_10000690 3300005437 Bacteria 16057
53 Ga0070701_10011800 3300005438 Bacteria 3923
54 Ga0070711_100000160 3300005439 Bacteria 36517
55 Ga0070711_100992985 3300005439 Bacteria 720
56 Ga0070705_100056197 3300005440 Bacteria 2317
57 Ga0070700_100072711 3300005441 Bacteria 2199
58 Ga0070700_100566538 3300005441 Bacteria 885
59 Ga0070694_100023962 3300005444 Bacteria 3934
60 Ga0070708_100429423 3300005445 Bacteria 1246
61 Ga0070663_100032577 3300005455 Bacteria 3594
62 Ga0070663_100358948 3300005455 Bacteria 1182
63 Ga0070678_100000117 3300005456 Bacteria 31126
64 Ga0070678_100747911 3300005456 Bacteria 884
65 Ga0070678_101724462 3300005456 Bacteria 590
66 Ga0070662_100016792 3300005457 Bacteria 4921
67 Ga0070662_101505328 3300005457 Bacteria 580
68 Ga0068867_100004067 3300005459 Bacteria 10296
69 Ga0070685_10086894 3300005466 Bacteria 1886
70 Ga0070684_100318328 3300005535 Bacteria 1429
71 Ga0070684_101335652 3300005535 Bacteria 675
72 Ga0068853_100023917 3300005539 Bacteria 5120
73 Ga0068853_100419449 3300005539 Bacteria 1255
74 Ga0068853_100470462 3300005539 Bacteria 1184
75 Ga0070686_100801663 3300005544 Bacteria 759
76 Ga0070696_100010017 3300005546 Bacteria 6339
77 Ga0070696_100566175 3300005546 Bacteria 912
78 Ga0070693_100149329 3300005547 Bacteria 1479
79 Ga0070693_100946008 3300005547 Bacteria 648
80 Ga0070665_100007248 3300005548 Bacteria 11267
81 Ga0070665_100009840 3300005548 Bacteria 9663
82 Ga0070665_101297107 3300005548 Bacteria 738
83 Ga0070665_102181598 3300005548 Bacteria 558
84 Ga0070704_100019594 3300005549 Bacteria 4349
85 Ga0068855_100228057 3300005563 Bacteria 2087
86 Ga0068855_100753020 3300005563 Bacteria 1038
87 Ga0068854_100009069 3300005578 Bacteria 6411
88 Ga0068856_101110798 3300005614 Bacteria 808
89 Ga0068856_102256597 3300005614 Bacteria 553
90 Ga0070702_100050964 3300005615 Bacteria 2367
91 Ga0070702_101432387 3300005615 Bacteria 566
92 Ga0068852_101148598 3300005616 Bacteria 797
93 Ga0068859_100001042 3300005617 Bacteria 28409
94 Ga0068859_100077098 3300005617 Bacteria 3374
95 Ga0068859_102748165 3300005617 Bacteria 541
96 Ga0068864_100317667 3300005618 Bacteria 1462
97 Ga0068864_100852037 3300005618 Bacteria 898
98 Ga0068864_101833201 3300005618 Bacteria 612
99 Ga0068866_10000441 3300005718 Bacteria 19171
100 Ga0068866_10371858 3300005718 Bacteria 914
101 Ga0068866_10492337 3300005718 Bacteria 810
102 Ga0068866_10762682 3300005718 Bacteria 669
103 Ga0068861_100003820 3300005719 Bacteria 10055
104 Ga0068851_10602360 3300005834 Bacteria 669
105 Ga0068863_100001025 3300005841 Bacteria 27909
106 Ga0068863_100007351 3300005841 Bacteria 10783
107 Ga0068863_100529594 3300005841 Bacteria 1162
108 Ga0068858_100004832 3300005842 Bacteria 13203
109 Ga0068858_100016818 3300005842 Bacteria 6869
110 Ga0068858_100858020 3300005842 Bacteria 887
111 Ga0068858_101336074 3300005842 Bacteria 706
112 Ga0068860_100000087 3300005843 Bacteria 158242
113 Ga0068860_100008728 3300005843 Bacteria 10094
114 Ga0068860_100103874 3300005843 Bacteria 2712
115 Ga0068860_100577544 3300005843 Bacteria 1128
116 Ga0068860_100731000 3300005843 Bacteria 1001
117 Ga0068862_100000077 3300005844 Bacteria 116781
118 Ga0068862_100022465 3300005844 Bacteria 5276
119 Ga0068862_100633339 3300005844 Bacteria 1030
120 Ga0081455_10050617 3300005937 Bacteria 3571
121 Ga0081538_10051013 3300005981 Bacteria 2490
122 Ga0075365_10008384 3300006038 Bacteria 5862
123 Ga0075365_10021990 3300006038 Bacteria 3987
124 Ga0075365_10155132 3300006038 Bacteria 1594
125 Ga0075368_10032217 3300006042 Bacteria 2035
126 Ga0075363_100015328 3300006048 Bacteria 3766
127 Ga0075363_100045147 3300006048 Bacteria 2336
128 Ga0075363_100065296 3300006048 Bacteria 1967
129 Ga0075363_100067780 3300006048 Bacteria 1934
130 Ga0075363_100092743 3300006048 Bacteria 1664
131 Ga0075363_100136569 3300006048 Bacteria 1378
132 Ga0075363_100352486 3300006048 Bacteria 860
133 Ga0075363_100903141 3300006048 Bacteria 541
134 Ga0075364_10001414 3300006051 Bacteria 13011
135 Ga0075364_10008782 3300006051 Bacteria 6047
136 Ga0075364_10020127 3300006051 Bacteria 4196
137 Ga0075364_10027813 3300006051 Bacteria 3615
138 Ga0075364_10080694 3300006051 Bacteria 2151
139 Ga0075364_10095173 3300006051 Bacteria 1980
140 Ga0075364_10117299 3300006051 Bacteria 1780
141 Ga0075364_10152366 3300006051 Bacteria 1558
142 Ga0075364_10157763 3300006051 Bacteria 1531
143 Ga0070715_10035753 3300006163 Bacteria 2045
144 Ga0070715_10569780 3300006163 Bacteria 659
145 Ga0070716_100009944 3300006173 Bacteria 4757
146 Ga0070716_100368460 3300006173 Bacteria 1023
147 Ga0070712_100004671 3300006175 Bacteria 8471
148 Ga0070712_100305967 3300006175 Bacteria 1288
149 Ga0075362_10028392 3300006177 Bacteria 2403
150 Ga0075362_10054120 3300006177 Bacteria 1803
151 Ga0075362_10255398 3300006177 Bacteria 863
152 Ga0075362_10324695 3300006177 Bacteria 767
153 Ga0075362_10487996 3300006177 Bacteria 629
154 Ga0075367_10019596 3300006178 Bacteria 3753
155 Ga0075367_10122378 3300006178 Bacteria 1604
156 Ga0075367_10150722 3300006178 Bacteria 1443
157 Ga0075367_10238196 3300006178 Bacteria 1140
158 Ga0075367_10357597 3300006178 Bacteria 922
159 Ga0075369_10004544 3300006186 Bacteria 5137
160 Ga0075369_10017401 3300006186 Bacteria 2913
161 Ga0075369_10054488 3300006186 Bacteria 1736
162 Ga0075369_10110257 3300006186 Bacteria 1240
163 Ga0075369_10158156 3300006186 Bacteria 1038
164 Ga0075369_10210800 3300006186 Bacteria 898
165 Ga0075369_10275887 3300006186 Bacteria 783
166 Ga0075369_10584235 3300006186 Bacteria 534
167 Ga0075366_10130591 3300006195 Bacteria 1516
168 Ga0075370_10024765 3300006353 Bacteria 3318
169 Ga0075370_10055517 3300006353 Bacteria 2250
170 Ga0075370_10090521 3300006353 Bacteria 1764
171 Ga0075370_10353010 3300006353 Bacteria 879
172 Ga0068865_100090172 3300006881 Bacteria 2222
173 Ga0068865_101734730 3300006881 Bacteria 563
174 Ga0097620_100001042 3300006931 Bacteria 28409
175 Ga0097620_100077087 3300006931 Bacteria 3374
176 Ga0097620_102747959 3300006931 Bacteria 541
177 Ga0075435_101459257 3300007076 Bacteria 600
178 Ga0105251_10529354 3300009011 Bacteria 553
179 Ga0105250_10378323 3300009092 Bacteria 624
180 Ga0105245_10008338 3300009098 Bacteria 9053
181 Ga0105245_10611967 3300009098 Bacteria 1117
182 Ga0105245_12432130 3300009098 Bacteria 577
183 Ga0105247_10000060 3300009101 Bacteria 127879
184 Ga0105247_10000298 3300009101 Bacteria 44765
185 Ga0114129_12700063 3300009147 Bacteria 592
186 Ga0105243_10000700 3300009148 Bacteria 32410
187 Ga0105241_11597817 3300009174 Bacteria 630
188 Ga0105242_10000325 3300009176 Bacteria 38289
189 Ga0105242_11214453 3300009176 Bacteria 774
190 Ga0105248_10000050 3300009177 Bacteria 152667
191 Ga0105248_10088134 3300009177 Bacteria 3493
192 Ga0105248_13114414 3300009177 Bacteria 528
193 Ga0105237_10006011 3300009545 Bacteria 13581
194 Ga0105237_10011826 3300009545 Bacteria 9231
195 Ga0105237_12693346 3300009545 Bacteria 508
196 Ga0105238_10217724 3300009551 Bacteria 1885
197 Ga0105238_10829792 3300009551 Bacteria 941
198 Ga0105238_11169866 3300009551 Bacteria 793
199 Ga0105249_10000042 3300009553 Bacteria 195242
200 Ga0105249_10000470 3300009553 Bacteria 37482
201 Ga0105249_10052537 3300009553 Bacteria 3722
202 Ga0105249_10463722 3300009553 Bacteria 1307
203 Ga0099796_10029743 3300010159 Bacteria 1766
204 Ga0105239_10016841 3300010375 Bacteria 8078
205 Ga0105239_10024596 3300010375 Bacteria 6634
206 Ga0105239_10415751 3300010375 Bacteria 1523
207 Ga0105239_11068124 3300010375 Bacteria 929
208 Ga0105246_10268090 3300011119 Bacteria 1364
209 Ga0105246_10422698 3300011119 Bacteria 1113
210 Ga0105246_10700830 3300011119 Bacteria 887
211 Ga0157369_10785184 3300013105 Bacteria 979
212 Ga0157378_10013827 3300013297 Bacteria 7058
213 Ga0157378_12874990 3300013297 Bacteria 534
214 Ga0163162_10089165 3300013306 Bacteria 3164
215 Ga0163162_10270692 3300013306 Bacteria 1830
216 Ga0163162_11128478 3300013306 Bacteria 889
217 Ga0163162_11335687 3300013306 Bacteria 815
218 Ga0157372_10048234 3300013307 Bacteria 4734
219 Ga0157372_10673523 3300013307 Bacteria 1204
220 Ga0157375_10467692 3300013308 Bacteria 1426
221 Ga0163163_10175729 3300014325 Bacteria 2188
222 Ga0163163_10245027 3300014325 Bacteria 1842
223 Ga0157380_10019608 3300014326 Bacteria 5041
224 Ga0157377_10476126 3300014745 Bacteria 867
225 Ga0157379_10002499 3300014968 Bacteria 15398
226 Ga0157376_10135466 3300014969 Bacteria 2203
227 Ga0163161_10027061 3300017792 Bacteria 4066
228 Ga0213876_10002110 3300021384 Bacteria 11766
229 Ga0213875_10036304 3300021388 Bacteria 2324
230 Ga0213875_10081020 3300021388 Bacteria 1514
231 Ga0209051_1001345 3300025303 Bacteria 21360
232 Ga0209051_1010755 3300025303 Bacteria 4581
233 Ga0207692_10007732 3300025898 Bacteria 4417
234 Ga0207642_10001048 3300025899 Bacteria 8570
235 Ga0207642_10251767 3300025899 Bacteria 1003
236 Ga0207710_10000010 3300025900 Bacteria 482087
237 Ga0207710_10023951 3300025900 Bacteria 2627
238 Ga0207688_10344949 3300025901 Bacteria 917
239 Ga0207688_10914849 3300025901 Bacteria 555
240 Ga0207680_10014842 3300025903 Bacteria 4047
241 Ga0207680_10210406 3300025903 Bacteria 1329
242 Ga0207647_10190458 3300025904 Bacteria 1189
243 Ga0207685_10150813 3300025905 Bacteria 1052
244 Ga0207699_11100125 3300025906 Bacteria 588
245 Ga0207645_10706452 3300025907 Bacteria 685
246 Ga0207671_10007606 3300025914 Bacteria 9375
247 Ga0207671_10074011 3300025914 Bacteria 2545
248 Ga0207671_10402997 3300025914 Bacteria 1088
249 Ga0207693_10000754 3300025915 Bacteria 29034
250 Ga0207663_10004087 3300025916 Bacteria 7234
251 Ga0207663_10697294 3300025916 Bacteria 804
252 Ga0207657_11413786 3300025919 Bacteria 522
253 Ga0207652_11098335 3300025921 Bacteria 696
254 Ga0207681_10034834 3300025923 Bacteria 3313
255 Ga0207681_10071094 3300025923 Bacteria 2426
256 Ga0207694_10051458 3300025924 Bacteria 3193
257 Ga0207650_10354730 3300025925 Bacteria 1207
258 Ga0207687_10003034 3300025927 Bacteria 11378
259 Ga0207687_11440980 3300025927 Bacteria 592
260 Ga0207700_10451888 3300025928 Bacteria 1133
261 Ga0207664_10099464 3300025929 Bacteria 2400
262 Ga0207664_10539498 3300025929 Bacteria 1046
263 Ga0207664_10733868 3300025929 Bacteria 888
264 Ga0207644_10019755 3300025931 Bacteria 4574
265 Ga0207644_10600516 3300025931 Bacteria 914
266 Ga0207644_10647832 3300025931 Bacteria 879
267 Ga0207690_10222592 3300025932 Bacteria 1445
268 Ga0207706_10021979 3300025933 Bacteria 5726
269 Ga0207706_10823668 3300025933 Bacteria 787
270 Ga0207686_10002494 3300025934 Bacteria 9999
271 Ga0207686_10644655 3300025934 Bacteria 837
272 Ga0207709_10007107 3300025935 Bacteria 6252
273 Ga0207709_10174362 3300025935 Bacteria 1512
274 Ga0207670_10496316 3300025936 Bacteria 990
275 Ga0207669_10001189 3300025937 Bacteria 11053
276 Ga0207669_10021180 3300025937 Bacteria 3426
277 Ga0207704_10002289 3300025938 Bacteria 8608
278 Ga0207665_10009094 3300025939 Bacteria 6524
279 Ga0207665_10699682 3300025939 Bacteria 797
280 Ga0207711_10001406 3300025941 Bacteria 22551
281 Ga0207711_10032792 3300025941 Bacteria 4394
282 Ga0207689_10031372 3300025942 Bacteria 4424
283 Ga0207689_10752573 3300025942 Bacteria 822
284 Ga0207679_11402795 3300025945 Bacteria 641
285 Ga0207667_10823680 3300025949 Bacteria 924
286 Ga0207712_10000010 3300025961 Bacteria 455972
287 Ga0207712_10001196 3300025961 Bacteria 17936
288 Ga0207668_10002892 3300025972 Bacteria 10073
289 Ga0207668_10006413 3300025972 Bacteria 6953
290 Ga0207668_10160530 3300025972 Bacteria 1751
291 Ga0207668_10258034 3300025972 Bacteria 1419
292 Ga0207668_11956577 3300025972 Bacteria 528
293 Ga0207640_10009045 3300025981 Bacteria 5558
294 Ga0207640_10267566 3300025981 Bacteria 1335
295 Ga0207658_10000677 3300025986 Bacteria 29704
296 Ga0207658_10001961 3300025986 Bacteria 15354
297 Ga0207658_10007671 3300025986 Bacteria 7347
298 Ga0207658_10061168 3300025986 Bacteria 2813
299 Ga0207658_10125469 3300025986 Bacteria 2053
300 Ga0207658_10697148 3300025986 Bacteria 917
301 Ga0207658_11164123 3300025986 Bacteria 705
302 Ga0207677_10047066 3300026023 Bacteria 2893
303 Ga0207677_10210790 3300026023 Bacteria 1551
304 Ga0207677_10474370 3300026023 Bacteria 1077
305 Ga0207703_10009823 3300026035 Bacteria 7505
306 Ga0207703_10028562 3300026035 Bacteria 4397
307 Ga0207703_10155468 3300026035 Bacteria 1998
308 Ga0207703_10416991 3300026035 Bacteria 1249
309 Ga0207703_10793125 3300026035 Bacteria 904
310 Ga0207703_10930306 3300026035 Bacteria 833
311 Ga0207639_10007030 3300026041 Bacteria 7672
312 Ga0207639_10117806 3300026041 Bacteria 2177
313 Ga0207678_10009360 3300026067 Bacteria 8622
314 Ga0207678_10307275 3300026067 Bacteria 1363
315 Ga0207678_11405819 3300026067 Bacteria 617
316 Ga0207708_10006796 3300026075 Bacteria 8463
317 Ga0207708_10416206 3300026075 Bacteria 1114
318 Ga0207702_12139177 3300026078 Bacteria 549
319 Ga0207641_10000849 3300026088 Bacteria 32380
320 Ga0207641_10020040 3300026088 Bacteria 5491
321 Ga0207641_10026225 3300026088 Bacteria 4809
322 Ga0207641_10060560 3300026088 Bacteria 3227
323 Ga0207648_10008331 3300026089 Bacteria 10058
324 Ga0207676_10241137 3300026095 Bacteria 1622
325 Ga0207676_10780961 3300026095 Bacteria 931
326 Ga0207676_11208545 3300026095 Bacteria 749
327 Ga0207675_100007850 3300026118 Bacteria 10069
328 Ga0207675_100260493 3300026118 Bacteria 1680
329 Ga0207675_101094830 3300026118 Bacteria 816
330 Ga0207675_101991034 3300026118 Bacteria 598
331 Ga0207683_10000984 3300026121 Bacteria 26143
332 Ga0207683_10290362 3300026121 Bacteria 1495
333 Ga0207683_10741899 3300026121 Bacteria 911
334 Ga0207698_10199898 3300026142 Bacteria 1789
335 Ga0209813_10490391 3300027866 Bacteria 508
336 Ga0268266_10006935 3300028379 Bacteria 10305
337 Ga0268266_10763785 3300028379 Bacteria 933
338 Ga0268266_11460448 3300028379 Bacteria 659
339 Ga0268265_10000014 3300028380 Bacteria 330186
340 Ga0268265_10026662 3300028380 Bacteria 4113
341 Ga0268265_10955307 3300028380 Bacteria 844
342 Ga0268264_10000150 3300028381 Bacteria 158263
343 Ga0268264_10046360 3300028381 Bacteria 3610
344 Ga0268264_10320951 3300028381 Bacteria 1464
345 Ga0268264_11048984 3300028381 Bacteria 823
346 Ga0265327_10002508 3300031251 Bacteria 19190
347 Ga0307405_10073751 3300031731 Bacteria 2205
348 Ga0307413_11210083 3300031824 Bacteria 657
349 Ga0307410_10083330 3300031852 Bacteria 2251
350 Ga0307410_11349601 3300031852 Bacteria 625
351 Ga0307406_12073894 3300031901 Bacteria 509
352 Ga0307407_10251828 3300031903 Bacteria 1210
353 Ga0307412_10208993 3300031911 Bacteria 1488
354 Ga0307409_100004098 3300031995 Bacteria 8112
355 Ga0307409_100039873 3300031995 Bacteria 3490
356 Ga0307409_100729563 3300031995 Bacteria 993
357 Ga0307409_101209931 3300031995 Bacteria 779
358 Ga0307416_100162681 3300032002 Bacteria 2065
359 Ga0307414_11019421 3300032004 Bacteria 762
360 Ga0307411_10510527 3300032005 Bacteria 1018
361 Ga0307415_100303069 3300032126 Bacteria 1324
362 Ga0373930_0137645 3300034816 Bacteria 605
363 Ga0373949_0105793 3300035090 Bacteria 776
364 Ga0373951_0017482 3300035091 Bacteria 1623
365 Ga0373932_0400942 3300035112 Bacteria 531
366 Ga0373962_0010540 3300035242 Bacteria 2307
367 Ga0373962_0137281 3300035242 Bacteria 792
368 Ga0373931_0018006 3300035691 Bacteria 3505
369 Ga0436364_0780709 3300037853 Bacteria 1822
370 Ga0436364_1308388 3300037853 Bacteria 35210
371 Ga0400484_01826 3300038725 Bacteria 3997
372 Ga0400484_11786 3300038725 Unclassified 2328
373 Ga0400488_60352 3300038741 Bacteria 1648
374 Ga0400483_095200 3300039062 Bacteria 2776
375 Ga0400483_112801 3300039062 Unclassified 3984
376 Ga0400483_277034 3300039062 Unclassified 1013
377 Ga0436365_1646946 3300039437 Bacteria 25220
378 Ga0436365_1657364 3300039437 Bacteria 1954
379 Ga0436360_0672569 3300039438 Bacteria 932
380 Ga0436361_0106752 3300039447 Bacteria 620
381 Ga0436361_1011217 3300039447 Bacteria 1891
382 Ga0436363_0344303 3300039450 Bacteria 1962
383 Ga0436363_1376063 3300039450 Bacteria 1065
384 Ga0439461_0000950 3300041410 Bacteria 4341
385 Ga0439461_0007259 3300041410 Bacteria 1956
386 Ga0439461_0096349 3300041410 Bacteria 715
387 Ga0439466_0009584 3300041411 Bacteria 3620
388 Ga0439466_0023180 3300041411 Bacteria 2185
389 Ga0439465_0002866 3300041413 Bacteria 5645
390 Ga0439465_0002904 3300041413 Bacteria 5617
391 Ga0439465_0009759 3300041413 Bacteria 3024
392 Ga0439465_0047333 3300041413 Bacteria 1401
393 Ga0451787_726021 3300041441 Bacteria 622
394 Ga0451793_0435955 3300041452 Bacteria 560
395 Ga0451795_0833080 3300041456 Bacteria 502
396 Ga0451841_0373935 3300041498 Bacteria 687
397 Ga0451851_0672866 3300041507 Bacteria 624
398 Ga0439431_0003200 3300041997 Bacteria 3599
399 Ga0439431_0008285 3300041997 Bacteria 2334
400 Ga0439442_005501 3300042002 Bacteria 2532
401 Ga0439442_026101 3300042002 Bacteria 1216
402 Ga0439445_0060977 3300042004 Bacteria 1031
403 Ga0439450_222286 3300042008 Bacteria 509
404 Ga0439462_0163314 3300042015 Bacteria 629
405 Ga0439434_0029139 3300042435 Bacteria 1673
406 Ga0439434_0192560 3300042435 Bacteria 685
407 Ga0439459_0024743 3300042438 Bacteria 1180
408 Ga0439459_0032932 3300042438 Bacteria 1065
409 Ga0466969_0072566 3300044656 Bacteria 1653
410 Ga0466969_0210912 3300044656 Bacteria 885
411 Ga0466972_0008599 3300044658 Bacteria 5121
412 Ga0466972_0019835 3300044658 Bacteria 3361
413 Ga0466972_0021251 3300044658 Bacteria 3238
414 Ga0466972_0189564 3300044658 Bacteria 964
415 Ga0466965_0000697 3300044683 Bacteria 12460
416 Ga0466965_0002661 3300044683 Bacteria 7643
417 Ga0466965_0010937 3300044683 Bacteria 4243
418 Ga0466965_0106659 3300044683 Bacteria 1437
419 Ga0466966_0001105 3300044684 Bacteria 17291
420 Ga0466966_0001218 3300044684 Bacteria 16526
421 Ga0466966_0028710 3300044684 Bacteria 3621
422 Ga0466966_0351351 3300044684 Bacteria 886
423 Ga0466961_0001949 3300044693 Bacteria 12864
424 Ga0466961_0053399 3300044693 Bacteria 2578
425 Ga0466961_0104802 3300044693 Bacteria 1780
426 Ga0466963_0012616 3300044694 Bacteria 5176
427 Ga0466963_0362558 3300044694 Bacteria 1021
428 Ga0466963_0421711 3300044694 Bacteria 941
429 Ga0466964_0107557 3300044706 Bacteria 1239
430 Ga0466964_0726222 3300044706 Bacteria 556
431 Ga0466971_0003761 3300044719 Bacteria 6496
432 Ga0466971_0022480 3300044719 Bacteria 2810
433 Ga0466971_0133942 3300044719 Bacteria 1152
434 Ga0466971_0150847 3300044719 Bacteria 1085
435 Ga0466968_0001182 3300044735 Bacteria 9248
436 Ga0466968_0001521 3300044735 Bacteria 8322
437 Ga0466968_0033488 3300044735 Bacteria 2141
438 Ga0466970_0015246 3300044765 Bacteria 3951
439 Ga0466970_0040721 3300044765 Bacteria 2467
440 Ga0466970_0077835 3300044765 Bacteria 1788
441 Ga0466970_0379011 3300044765 Bacteria 805
442 Ga0466957_0000981 3300044842 Bacteria 14668
443 Ga0466957_0003667 3300044842 Bacteria 8475
444 Ga0466957_0031268 3300044842 Bacteria 3180
445 Ga0466957_0041631 3300044842 Bacteria 2778
446 Ga0466957_0065523 3300044842 Bacteria 2238
447 Ga0466960_0000319 3300044901 Bacteria 16503
448 Ga0466960_0002911 3300044901 Bacteria 6510
449 Ga0466959_0000774 3300045049 Bacteria 18746
450 Ga0466959_0001867 3300045049 Bacteria 13243
451 Ga0466959_0118544 3300045049 Bacteria 1883
452 Ga0466959_0314834 3300045049 Bacteria 1070
453 Ga0466958_0001942 3300045836 Bacteria 10134
454 Ga0466958_0003868 3300045836 Bacteria 7832
455 Ga0466958_0347027 3300045836 Bacteria 955
456 Ga0466958_0352454 3300045836 Bacteria 948
457 Ga0466958_0507472 3300045836 Bacteria 783
458 Ga0466967_0006454 3300045976 Bacteria 8301
459 Ga0466967_0091130 3300045976 Bacteria 2770
460 Ga0466967_0198657 3300045976 Bacteria 1898
461 Ga0466967_0256355 3300045976 Bacteria 1672
462 Ga0466967_0334416 3300045976 Bacteria 1463
463 Ga0466967_0341220 3300045976 Bacteria 1449
464 Ga0466967_0709277 3300045976 Bacteria 997
465 Ga0466967_0988656 3300045976 Bacteria 838
466 Ga0466967_1016565 3300045976 Bacteria 825
467 Ga0466967_1186410 3300045976 Bacteria 761
468 Ga0466967_1537566 3300045976 Bacteria 663
469 Ga0495629_0050017 3300046459 Bacteria 2928
470 Ga0495641_0171717 3300046461 Bacteria 970
471 Ga0495616_0191824 3300046513 Bacteria 903
472 Ga0495620_0060421 3300046515 Bacteria 1580
473 Ga0495648_0015564 3300046524 Bacteria 5518
474 Ga0495654_0180187 3300046530 Bacteria 915
475 Ga0495665_0119069 3300046531 Bacteria 1383
476 Ga0495640_0048156 3300046533 Bacteria 2947
477 Ga0495668_0060829 3300046616 Bacteria 2083
478 Ga0495611_0052314 3300046648 Bacteria 1842
479 Ga0495625_0336218 3300046660 Bacteria 958
480 Ga0495635_0190327 3300046663 Bacteria 1393
481 Ga0495599_0283133 3300046678 Bacteria 1004
482 Ga0495658_0099821 3300046683 Bacteria 1731
483 Ga0495671_0080694 3300046692 Bacteria 1594
484 Ga0495649_0266459 3300046694 Bacteria 877
485 Ga0495581_0206725 3300047315 Bacteria 1148
486 Ga0495672_0003978 3300047320 Bacteria 12368
487 Ga0495672_0107141 3300047320 Bacteria 1506
488 Ga0495676_0221348 3300047321 Bacteria 1304
489 Ga0495673_0002945 3300047469 Bacteria 11483
490 Ga0495593_0047404 3300047673 Bacteria 2286
491 Ga0495626_0234241 3300048091 Bacteria 741
492 Ga0496100_0000084 3300048903 Bacteria 53649
493 Ga0496100_0000939 3300048903 Bacteria 13931
494 Ga0496100_0001148 3300048903 Bacteria 12879
495 Ga0496100_0001530 3300048903 Bacteria 11346
496 Ga0496100_0386033 3300048903 Bacteria 1064
497 Ga0496100_0642147 3300048903 Bacteria 826
498 Ga0496100_0804696 3300048903 Bacteria 736
499 Ga0496100_1186075 3300048903 Bacteria 602
500 Ga0496101_0000100 3300048904 Bacteria 89811
501 Ga0496101_0000110 3300048904 Bacteria 85776
502 Ga0496101_0001605 3300048904 Bacteria 13597
503 Ga0496101_0013571 3300048904 Bacteria 5462
504 Ga0496101_0142244 3300048904 Bacteria 1829
505 Ga0496101_0159982 3300048904 Bacteria 1727
506 Ga0496101_0245115 3300048904 Bacteria 1395
507 Ga0496102_0000006 3300048905 Bacteria 471494
508 Ga0496102_0003241 3300048905 Bacteria 13802
509 Ga0496102_0005337 3300048905 Bacteria 10912
510 Ga0496102_0008322 3300048905 Bacteria 8887
511 Ga0496102_0042225 3300048905 Bacteria 4133
512 Ga0496102_0244209 3300048905 Bacteria 1693
513 Ga0496102_0402961 3300048905 Bacteria 1286
514 Ga0496102_0594017 3300048905 Bacteria 1030
515 Ga0496102_0610361 3300048905 Bacteria 1014
516 Ga0496102_0984217 3300048905 Bacteria 764
517 Ga0496103_0000006 3300048906 Bacteria 470539
518 Ga0496103_0000700 3300048906 Bacteria 24863
519 Ga0496103_0004893 3300048906 Bacteria 8087
520 Ga0496103_0019975 3300048906 Bacteria 4023
521 Ga0496104_0055184 3300048907 Bacteria 3756
522 Ga0496104_1020308 3300048907 Bacteria 731
523 Ga0496105_0044484 3300048908 Bacteria 3662
524 Ga0496105_0050466 3300048908 Bacteria 3436
525 Ga0496105_0134415 3300048908 Bacteria 2038
526 Ga0496106_0000164 3300048909 Bacteria 47996
527 Ga0496106_0000616 3300048909 Bacteria 25450
528 Ga0496106_0011222 3300048909 Bacteria 6630
529 Ga0496106_0168716 3300048909 Bacteria 1734
530 Ga0496106_1109741 3300048909 Bacteria 619
531 Ga0496107_0000650 3300048910 Bacteria 19593
532 Ga0496107_0001329 3300048910 Bacteria 15163
533 Ga0496107_0059658 3300048910 Bacteria 2761
534 Ga0496107_0430982 3300048910 Bacteria 980
535 Ga0496107_1050338 3300048910 Bacteria 590
536 Ga0496108_0006114 3300048911 Bacteria 9741
537 Ga0496108_0131215 3300048911 Bacteria 2154
538 Ga0496108_0186793 3300048911 Bacteria 1795
539 Ga0496108_0670087 3300048911 Bacteria 901
540 Ga0496109_0000356 3300048912 Bacteria 42608
541 Ga0496109_0339670 3300048912 Bacteria 1418
542 Ga0496109_0362499 3300048912 Bacteria 1369
543 Ga0496109_0374002 3300048912 Bacteria 1346
544 Ga0496109_0415287 3300048912 Bacteria 1271
545 Ga0496110_0009262 3300048913 Bacteria 7960
546 Ga0496110_0168417 3300048913 Bacteria 1987
547 Ga0496110_1216350 3300048913 Bacteria 662
548 Ga0496111_0045234 3300048914 Bacteria 3167
549 Ga0496111_0294223 3300048914 Bacteria 1204
550 Ga0496112_0019953 3300048915 Bacteria 6343
551 Ga0496112_0252536 3300048915 Bacteria 1714
552 Ga0496113_0159294 3300048916 Bacteria 1784
553 Ga0496113_0946479 3300048916 Bacteria 680
554 Ga0496114_0000164 3300048917 Bacteria 47093
555 Ga0496114_0000522 3300048917 Bacteria 28253
556 Ga0496114_0013077 3300048917 Bacteria 6649
557 Ga0496114_0217710 3300048917 Bacteria 1676
558 Ga0496114_0653403 3300048917 Bacteria 925
559 Ga0496114_1126697 3300048917 Bacteria 670
560 Ga0496115_0002348 3300048918 Bacteria 13572
561 Ga0496115_0014536 3300048918 Bacteria 5960
562 Ga0496115_0022098 3300048918 Bacteria 4922
563 Ga0496115_0214817 3300048918 Bacteria 1588
564 Ga0496115_0653510 3300048918 Bacteria 831
565 Ga0496116_0000025 3300048919 Bacteria 470539
566 Ga0496116_0002215 3300048919 Bacteria 20684
567 Ga0496117_0000006 3300048920 Bacteria 758420
568 Ga0496117_0014625 3300048920 Bacteria 6749
569 Ga0496118_0000004 3300048921 Bacteria 758420
570 Ga0496118_0077484 3300048921 Bacteria 2357
571 Ga0496119_0000035 3300048922 Bacteria 217007
572 Ga0496119_0004129 3300048922 Bacteria 14622
573 Ga0496119_0438713 3300048922 Bacteria 617
574 Ga0496120_0000079 3300048923 Bacteria 160413
575 Ga0496120_0016802 3300048923 Bacteria 4768
576 Ga0496120_0070643 3300048923 Bacteria 1920
577 Ga0496121_0000004 3300048924 Bacteria 1139011
578 Ga0496121_0000090 3300048924 Bacteria 217920
579 Ga0496122_0000805 3300048925 Bacteria 60172
580 Ga0496123_0003575 3300048926 Bacteria 17241
581 Ga0496124_0000221 3300048927 Bacteria 110879
582 Ga0496124_0429981 3300048927 Bacteria 907
583 Ga0496125_0000003 3300048928 Bacteria 1189767
584 Ga0496126_0000001 3300048929 Bacteria 1139011
585 Ga0496126_0002186 3300048929 Bacteria 27172
586 Ga0496126_0006264 3300048929 Bacteria 13290
587 Ga0496126_0030158 3300048929 Bacteria 5142
588 Ga0501032_0013541 3300049569 Bacteria 5797
589 Ga0501032_0394303 3300049569 Bacteria 889
590 Ga0501034_0026741 3300049571 Bacteria 5871
591 Ga0501034_0091269 3300049571 Bacteria 3044
592 Ga0501036_0319779 3300049572 Bacteria 1297
593 Ga0501037_0001555 3300049573 Bacteria 16751
594 Ga0501038_0026018 3300049574 Bacteria 5212
595 Ga0501039_0000929 3300049575 Bacteria 21375
596 Ga0501043_0002664 3300049579 Bacteria 14997
597 Ga0501046_0238098 3300049580 Bacteria 1343
598 Ga0501047_0011332 3300049581 Bacteria 8442
599 Ga0501047_0649234 3300049581 Bacteria 875
600 Ga0501048_0586807 3300049582 Bacteria 800
601 Ga0501068_0068734 3300049584 Bacteria 2159
602 Ga0501070_0093403 3300049586 Bacteria 2489
603 Ga0501070_0103101 3300049586 Bacteria 2359
604 Ga0501070_0954339 3300049586 Bacteria 667
605 Ga0501080_0542211 3300049742 Bacteria 1037
606 Ga0501035_0000497 3300049822 Bacteria 44253
607 Ga0501044_0007277 3300049823 Bacteria 12164
608 Ga0501044_0042930 3300049823 Bacteria 4700
609 Ga0501044_0139950 3300049823 Bacteria 2409
610 Ga0501044_0444084 3300049823 Bacteria 1205
611 nmdc:mga03683_179253_c1 3300050489 Bacteria 966
612 nmdc:mga03683_23689_c1 3300050489 Bacteria 2394
613 nmdc:mga03683_417253_c1 3300050489 Bacteria 642
614 nmdc:mga03683_49857_c1 3300050489 Bacteria 1744
615 nmdc:mga03n38_148780_c1 3300050490 Bacteria 1176
616 nmdc:mga03n38_2381_c1 3300050490 Bacteria 5795
617 nmdc:mga03n38_323265_c1 3300050490 Bacteria 834
618 nmdc:mga03n38_376702_c1 3300050490 Bacteria 777
619 nmdc:mga03n38_421862_c1 3300050490 Bacteria 738
620 nmdc:mga03n38_656131_c1 3300050490 Bacteria 602
621 nmdc:mga03n38_831841_c1 3300050490 Bacteria 539
622 nmdc:mga03n38_95166_c1 3300050490 Bacteria 1426
623 nmdc:mga00v17_15511_c1 3300050491 Bacteria 4278
624 nmdc:mga00v17_20163_c1 3300050491 Bacteria 3816
625 nmdc:mga00v17_238225_c1 3300050491 Bacteria 1179
626 nmdc:mga00v17_259274_c1 3300050491 Bacteria 1128
627 nmdc:mga00v17_275111_c1 3300050491 Bacteria 1093
628 nmdc:mga00v17_28984_c1 3300050491 Bacteria 3246
629 nmdc:mga00v17_38260_c1 3300050491 Bacteria 2868
630 nmdc:mga00v17_84002_c1 3300050491 Bacteria 1992
631 nmdc:mga0yw44_2784_c1 3300050492 Bacteria 7572
632 nmdc:mga0yw44_47147_c1 3300050492 Bacteria 2592
633 nmdc:mga0yw44_573238_c1 3300050492 Bacteria 766
634 nmdc:mga0yw44_66954_c1 3300050492 Bacteria 2218
635 nmdc:mga0yw44_796516_c1 3300050492 Bacteria 642
636 nmdc:mga0k408_189390_c1 3300050493 Bacteria 1227
637 nmdc:mga06z11_186539_c1 3300050494 Bacteria 1198
638 nmdc:mga06z11_247361_c1 3300050494 Bacteria 1049
639 nmdc:mga06z11_859682_c1 3300050494 Bacteria 553
640 nmdc:mga04h51_528264_c1 3300050495 Bacteria 507
641 nmdc:mga07m45_20108_c1 3300050496 Bacteria 3624
642 nmdc:mga07m45_223956_c1 3300050496 Bacteria 1094
643 nmdc:mga07m45_391319_c1 3300050496 Bacteria 807
644 nmdc:mga07m45_72746_c1 3300050496 Bacteria 1957
645 nmdc:mga07m45_765773_c1 3300050496 Bacteria 554
646 nmdc:mga0rr50_1224350_c1 3300050513 Bacteria 637
647 nmdc:mga0sz30_142680_c1 3300050516 Bacteria 1058
648 nmdc:mga0sz30_142957_c1 3300050516 Bacteria 1057
649 nmdc:mga0sz30_15363_c1 3300050516 Bacteria 3025
650 nmdc:mga0sz30_235460_c1 3300050516 Bacteria 815
651 nmdc:mga0sz30_23957_c1 3300050516 Bacteria 2489
652 nmdc:mga0sz30_68328_c1 3300050516 Bacteria 1526
653 nmdc:mga0sz30_86067_c1 3300050516 Bacteria 1364
654 Ga0495601_0339808 3300053077 Bacteria 977
655 Ga0500635_0027164 3300053080 Bacteria 1817
656 Ga0495655_0081153 3300053083 Bacteria 927
657 Ga0495655_0133853 3300053083 Bacteria 766
658 Ga0495655_0146864 3300053083 Bacteria 738
659 Ga0495619_0094594 3300053085 Bacteria 2027
660 Ga0500643_003561 3300053087 Bacteria 7411
661 Ga0500651_0651888 3300053093 Bacteria 567
662 Ga0500641_0183658 3300053096 Bacteria 897
663 Ga0500556_0037703 3300053104 Bacteria 1683
664 Ga0500562_018271 3300053108 Bacteria 1810
665 Ga0500628_042736 3300053129 Bacteria 1043
666 Ga0500652_008367 3300053131 Bacteria 3444
667 Ga0500652_012617 3300053131 Bacteria 2972
668 Ga0500568_0173179 3300053139 Bacteria 794
669 Ga0500616_0058960 3300053153 Bacteria 1995
670 Ga0500616_0292747 3300053153 Bacteria 679
671 Ga0500639_115253 3300053163 Bacteria 1300
672 Ga0500645_000490 3300053730 Bacteria 26762
673 Ga0466962_0023192 3300061719 Bacteria 2983
674 Ga0466962_0032563 3300061719 Bacteria 2495
675 Ga0466962_0192561 3300061719 Bacteria 995

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221715 2644636955 108
2 iso_pu_bacteria 2939582691 2939584658 108
3 iso_pu_bacteria 2738541264 2738668357 109
4 iso_pu_bacteria 2738541356 2739147427 109
5 3300031251 Ga0265327_10002508 Ga0265327_100025088 110
6 3300044683 Ga0466965_0106659 Ga0466965_0106659_453_791 110
7 3300045976 Ga0466967_0198657 Ga0466967_0198657_1274_1612 110
8 3300045976 Ga0466967_1186410 Ga0466967_1186410_26_358 110
9 iso_pu_bacteria 2902837492 2902838482 110
10 3300005335 Ga0070666_10066179 Ga0070666_100661793 111
11 3300005367 Ga0070667_100013973 Ga0070667_1000139738 111
12 3300005843 Ga0068860_100577544 Ga0068860_1005775442 111
13 3300006051 Ga0075364_10095173 Ga0075364_100951733 111
14 3300006177 Ga0075362_10054120 Ga0075362_100541202 111
15 3300006178 Ga0075367_10122378 Ga0075367_101223782 111
16 3300006353 Ga0075370_10055517 Ga0075370_100555173 111
17 3300013306 Ga0163162_11128478 Ga0163162_111284782 111
18 3300025903 Ga0207680_10210406 Ga0207680_102104062 111
19 3300025986 Ga0207658_10001961 Ga0207658_100019613 111
20 3300026035 Ga0207703_10793125 Ga0207703_107931252 111
21 3300028381 Ga0268264_11048984 Ga0268264_110489842 111
22 3300048903 Ga0496100_0000084 Ga0496100_0000084_23470_23811 111
23 3300048904 Ga0496101_0000100 Ga0496101_0000100_14380_14721 111
24 3300048905 Ga0496102_0008322 Ga0496102_0008322_3505_3846 111
25 3300048906 Ga0496103_0000700 Ga0496103_0000700_10600_10941 111
26 3300048909 Ga0496106_0000164 Ga0496106_0000164_16442_16783 111
27 3300048910 Ga0496107_0000650 Ga0496107_0000650_19071_19412 111
28 3300048911 Ga0496108_0006114 Ga0496108_0006114_6665_7006 111
29 3300048912 Ga0496109_0000356 Ga0496109_0000356_23465_23806 111
30 3300048913 Ga0496110_0009262 Ga0496110_0009262_5024_5365 111
31 3300048914 Ga0496111_0045234 Ga0496111_0045234_2378_2719 111
32 3300048916 Ga0496113_0946479 Ga0496113_0946479_303_644 111
33 3300048917 Ga0496114_0000164 Ga0496114_0000164_20959_21300 111
34 3300048918 Ga0496115_0022098 Ga0496115_0022098_4369_4710 111
35 3300048919 Ga0496116_0002215 Ga0496116_0002215_16414_16755 111
36 3300048920 Ga0496117_0014625 Ga0496117_0014625_5890_6231 111
37 3300048921 Ga0496118_0077484 Ga0496118_0077484_1498_1839 111
38 3300048922 Ga0496119_0004129 Ga0496119_0004129_11596_11937 111
39 3300048923 Ga0496120_0016802 Ga0496120_0016802_1051_1392 111
40 3300048923 Ga0496120_0070643 Ga0496120_0070643_151_486 111
41 3300048924 Ga0496121_0000004 Ga0496121_0000004_239489_239830 111
42 3300048925 Ga0496122_0000805 Ga0496122_0000805_25128_25469 111
43 3300048926 Ga0496123_0003575 Ga0496123_0003575_5831_6172 111
44 3300048927 Ga0496124_0000221 Ga0496124_0000221_75102_75443 111
45 3300048928 Ga0496125_0000003 Ga0496125_0000003_949938_950279 111
46 3300048929 Ga0496126_0000001 Ga0496126_0000001_239489_239830 111
47 3300050489 nmdc:mga03683_49857_c1 nmdc:mga03683_49857_c1_1134_1478 111
48 3300050490 nmdc:mga03n38_376702_c1 nmdc:mga03n38_376702_c1_386_721 111
49 3300050496 nmdc:mga07m45_391319_c1 nmdc:mga07m45_391319_c1_127_471 111
50 iso_pu_bacteria 2902792274 2902798710 111
51 3300005337 Ga0070682_100066156 Ga0070682_1000661563 112
52 3300005347 Ga0070668_100013630 Ga0070668_1000136303 112
53 3300005356 Ga0070674_100389244 Ga0070674_1003892442 112
54 3300005367 Ga0070667_101987443 Ga0070667_1019874431 112
55 3300005548 Ga0070665_101297107 Ga0070665_1012971072 112
56 3300005618 Ga0068864_100317667 Ga0068864_1003176672 112
57 3300005718 Ga0068866_10762682 Ga0068866_107626822 112
58 3300005842 Ga0068858_101336074 Ga0068858_1013360742 112
59 3300006038 Ga0075365_10155132 Ga0075365_101551322 112
60 3300006048 Ga0075363_100092743 Ga0075363_1000927432 112
61 3300006048 Ga0075363_100903141 Ga0075363_1009031412 112
62 3300006051 Ga0075364_10008782 Ga0075364_100087823 112
63 3300006051 Ga0075364_10117299 Ga0075364_101172993 112
64 3300006177 Ga0075362_10255398 Ga0075362_102553982 112
65 3300006178 Ga0075367_10238196 Ga0075367_102381961 112
66 3300006186 Ga0075369_10110257 Ga0075369_101102572 112
67 3300006881 Ga0068865_101734730 Ga0068865_1017347302 112
68 3300009011 Ga0105251_10529354 Ga0105251_105293542 112
69 3300009092 Ga0105250_10378323 Ga0105250_103783232 112
70 3300009545 Ga0105237_12693346 Ga0105237_126933461 112
71 3300011119 Ga0105246_10700830 Ga0105246_107008302 112
72 3300013308 Ga0157375_10467692 Ga0157375_104676922 112
73 3300025901 Ga0207688_10344949 Ga0207688_103449492 112
74 3300025935 Ga0207709_10174362 Ga0207709_101743623 112
75 3300025945 Ga0207679_11402795 Ga0207679_114027951 112
76 3300025972 Ga0207668_10002892 Ga0207668_100028923 112
77 3300025986 Ga0207658_11164123 Ga0207658_111641232 112
78 3300026035 Ga0207703_10155468 Ga0207703_101554682 112
79 3300026035 Ga0207703_10930306 Ga0207703_109303062 112
80 3300026095 Ga0207676_10241137 Ga0207676_102411372 112
81 3300028379 Ga0268266_11460448 Ga0268266_114604482 112
82 3300031901 Ga0307406_12073894 Ga0307406_120738941 112
83 3300031995 Ga0307409_100729563 Ga0307409_1007295631 112
84 3300031995 Ga0307409_101209931 Ga0307409_1012099312 112
85 3300038725 Ga0400484_01826 Ga0400484_01826_2903_3256 112
86 3300038725 Ga0400484_11786 Ga0400484_11786_1590_1943 112
87 3300038741 Ga0400488_60352 Ga0400488_60352_360_713 112
88 3300039062 Ga0400483_095200 Ga0400483_095200_425_778 112
89 3300039062 Ga0400483_112801 Ga0400483_112801_3000_3353 112
90 3300039062 Ga0400483_277034 Ga0400483_277034_64_417 112
91 3300041410 Ga0439461_0000950 Ga0439461_0000950_2351_2689 112
92 3300041413 Ga0439465_0009759 Ga0439465_0009759_1829_2167 112
93 3300041498 Ga0451841_0373935 Ga0451841_0373935_159_500 112
94 3300041997 Ga0439431_0003200 Ga0439431_0003200_1117_1455 112
95 3300042004 Ga0439445_0060977 Ga0439445_0060977_565_903 112
96 3300042008 Ga0439450_222286 Ga0439450_222286_19_363 112
97 3300042015 Ga0439462_0163314 Ga0439462_0163314_18_356 112
98 3300042438 Ga0439459_0032932 Ga0439459_0032932_10_354 112
99 3300044656 Ga0466969_0210912 Ga0466969_0210912_285_626 112
100 3300044658 Ga0466972_0019835 Ga0466972_0019835_386_727 112
101 3300044658 Ga0466972_0021251 Ga0466972_0021251_2559_2906 112
102 3300044683 Ga0466965_0000697 Ga0466965_0000697_8380_8721 112
103 3300044683 Ga0466965_0002661 Ga0466965_0002661_384_731 112
104 3300044684 Ga0466966_0351351 Ga0466966_0351351_393_734 112
105 3300044706 Ga0466964_0726222 Ga0466964_0726222_132_473 112
106 3300044719 Ga0466971_0133942 Ga0466971_0133942_786_1127 112
107 3300044735 Ga0466968_0001521 Ga0466968_0001521_700_1041 112
108 3300044765 Ga0466970_0015246 Ga0466970_0015246_2065_2406 112
109 3300044842 Ga0466957_0003667 Ga0466957_0003667_3072_3413 112
110 3300044901 Ga0466960_0000319 Ga0466960_0000319_2983_3330 112
111 3300044901 Ga0466960_0002911 Ga0466960_0002911_3384_3725 112
112 3300045049 Ga0466959_0118544 Ga0466959_0118544_301_642 112
113 3300045836 Ga0466958_0507472 Ga0466958_0507472_90_431 112
114 3300045976 Ga0466967_0091130 Ga0466967_0091130_674_1015 112
115 3300045976 Ga0466967_0256355 Ga0466967_0256355_1106_1447 112
116 3300045976 Ga0466967_0341220 Ga0466967_0341220_780_1124 112
117 3300046524 Ga0495648_0015564 Ga0495648_0015564_2270_2632 112
118 3300046530 Ga0495654_0180187 Ga0495654_0180187_378_740 112
119 3300046616 Ga0495668_0060829 Ga0495668_0060829_1198_1560 112
120 3300046648 Ga0495611_0052314 Ga0495611_0052314_488_850 112
121 3300046660 Ga0495625_0336218 Ga0495625_0336218_447_785 112
122 3300046692 Ga0495671_0080694 Ga0495671_0080694_927_1289 112
123 3300046694 Ga0495649_0266459 Ga0495649_0266459_322_669 112
124 3300047320 Ga0495672_0003978 Ga0495672_0003978_11228_11590 112
125 3300047469 Ga0495673_0002945 Ga0495673_0002945_8095_8457 112
126 3300048091 Ga0495626_0234241 Ga0495626_0234241_327_665 112
127 3300048903 Ga0496100_0642147 Ga0496100_0642147_296_640 112
128 3300048903 Ga0496100_0804696 Ga0496100_0804696_367_708 112
129 3300048904 Ga0496101_0159982 Ga0496101_0159982_794_1135 112
130 3300048905 Ga0496102_0042225 Ga0496102_0042225_3238_3579 112
131 3300048905 Ga0496102_0610361 Ga0496102_0610361_92_433 112
132 3300048905 Ga0496102_0984217 Ga0496102_0984217_393_734 112
133 3300048907 Ga0496104_1020308 Ga0496104_1020308_334_675 112
134 3300048909 Ga0496106_0168716 Ga0496106_0168716_660_1001 112
135 3300048910 Ga0496107_0430982 Ga0496107_0430982_373_714 112
136 3300048910 Ga0496107_1050338 Ga0496107_1050338_154_498 112
137 3300048911 Ga0496108_0131215 Ga0496108_0131215_1327_1668 112
138 3300048912 Ga0496109_0339670 Ga0496109_0339670_702_1043 112
139 3300048917 Ga0496114_0217710 Ga0496114_0217710_1316_1657 112
140 3300048917 Ga0496114_0653403 Ga0496114_0653403_44_385 112
141 3300048917 Ga0496114_1126697 Ga0496114_1126697_180_521 112
142 3300048918 Ga0496115_0653510 Ga0496115_0653510_337_678 112
143 3300048929 Ga0496126_0006264 Ga0496126_0006264_2731_3072 112
144 3300049569 Ga0501032_0013541 Ga0501032_0013541_4056_4394 112
145 3300049571 Ga0501034_0026741 Ga0501034_0026741_1998_2336 112
146 3300049572 Ga0501036_0319779 Ga0501036_0319779_77_415 112
147 3300049573 Ga0501037_0001555 Ga0501037_0001555_15521_15859 112
148 3300049574 Ga0501038_0026018 Ga0501038_0026018_691_1029 112
149 3300049575 Ga0501039_0000929 Ga0501039_0000929_16982_17320 112
150 3300049579 Ga0501043_0002664 Ga0501043_0002664_12018_12356 112
151 3300049584 Ga0501068_0068734 Ga0501068_0068734_1253_1591 112
152 3300049586 Ga0501070_0103101 Ga0501070_0103101_124_462 112
153 3300049586 Ga0501070_0954339 Ga0501070_0954339_304_651 112
154 3300049823 Ga0501044_0139950 Ga0501044_0139950_660_998 112
155 3300050490 nmdc:mga03n38_95166_c1 nmdc:mga03n38_95166_c1_510_851 112
156 3300050491 nmdc:mga00v17_20163_c1 nmdc:mga00v17_20163_c1_3256_3594 112
157 3300050492 nmdc:mga0yw44_573238_c1 nmdc:mga0yw44_573238_c1_32_376 112
158 3300050492 nmdc:mga0yw44_796516_c1 nmdc:mga0yw44_796516_c1_17_358 112
159 3300050516 nmdc:mga0sz30_68328_c1 nmdc:mga0sz30_68328_c1_210_551 112
160 3300053087 Ga0500643_003561 Ga0500643_003561_4138_4482 112
161 3300053093 Ga0500651_0651888 Ga0500651_0651888_59_400 112
162 3300053104 Ga0500556_0037703 Ga0500556_0037703_540_884 112
163 3300053108 Ga0500562_018271 Ga0500562_018271_134_472 112
164 3300053131 Ga0500652_012617 Ga0500652_012617_2014_2355 112
165 3300053139 Ga0500568_0173179 Ga0500568_0173179_372_713 112
166 3300053153 Ga0500616_0058960 Ga0500616_0058960_1363_1710 112
167 3300053163 Ga0500639_115253 Ga0500639_115253_710_1051 112
168 3300053730 Ga0500645_000490 Ga0500645_000490_17311_17652 112
169 iso_pu_bacteria 2643221687 2644490710 112
170 3300005356 Ga0070674_100004262 Ga0070674_1000042623 113
171 3300005434 Ga0070709_10469052 Ga0070709_104690522 113
172 3300005435 Ga0070714_100003669 Ga0070714_1000036693 113
173 3300005436 Ga0070713_100111408 Ga0070713_1001114082 113
174 3300005439 Ga0070711_100992985 Ga0070711_1009929852 113
175 3300005456 Ga0070678_101724462 Ga0070678_1017244622 113
176 3300005544 Ga0070686_100801663 Ga0070686_1008016632 113
177 3300005548 Ga0070665_102181598 Ga0070665_1021815982 113
178 3300005615 Ga0070702_101432387 Ga0070702_1014323871 113
179 3300005718 Ga0068866_10371858 Ga0068866_103718582 113
180 3300005841 Ga0068863_100529594 Ga0068863_1005295942 113
181 3300006163 Ga0070715_10569780 Ga0070715_105697801 113
182 3300009176 Ga0105242_11214453 Ga0105242_112144531 113
183 3300009551 Ga0105238_11169866 Ga0105238_111698662 113
184 3300013105 Ga0157369_10785184 Ga0157369_107851842 113
185 3300025899 Ga0207642_10251767 Ga0207642_102517672 113
186 3300025906 Ga0207699_11100125 Ga0207699_111001251 113
187 3300025916 Ga0207663_10697294 Ga0207663_106972942 113
188 3300025919 Ga0207657_11413786 Ga0207657_114137861 113
189 3300025929 Ga0207664_10099464 Ga0207664_100994643 113
190 3300025934 Ga0207686_10644655 Ga0207686_106446552 113
191 3300025937 Ga0207669_10021180 Ga0207669_100211802 113
192 3300026067 Ga0207678_11405819 Ga0207678_114058192 113
193 3300026088 Ga0207641_10060560 Ga0207641_100605602 113
194 3300026121 Ga0207683_10741899 Ga0207683_107418992 113
195 3300028379 Ga0268266_10763785 Ga0268266_107637851 113
196 3300048903 Ga0496100_0000939 Ga0496100_0000939_320_667 113
197 3300048904 Ga0496101_0001605 Ga0496101_0001605_10427_10774 113
198 3300048905 Ga0496102_0402961 Ga0496102_0402961_139_486 113
199 3300048908 Ga0496105_0050466 Ga0496105_0050466_3054_3401 113
200 3300048909 Ga0496106_0011222 Ga0496106_0011222_5096_5443 113
201 3300048910 Ga0496107_0059658 Ga0496107_0059658_1468_1815 113
202 3300048912 Ga0496109_0362499 Ga0496109_0362499_393_740 113
203 3300048917 Ga0496114_0013077 Ga0496114_0013077_5061_5408 113
204 3300048918 Ga0496115_0014536 Ga0496115_0014536_2173_2520 113
205 iso_pu_bacteria 2842134933 2842139271 113
206 3300001989 JGI24739J22299_10100835 JGI24739J22299_101008352 114
207 3300001990 JGI24737J22298_10083722 JGI24737J22298_100837222 114
208 3300002067 JGI24735J21928_10062902 JGI24735J21928_100629022 114
209 3300002067 JGI24735J21928_10080511 JGI24735J21928_100805112 114
210 3300002077 JGI24744J21845_10002910 JGI24744J21845_100029102 114
211 3300002239 JGI24034J26672_10014121 JGI24034J26672_100141212 114
212 3300003792 Ga0055540_1010510 Ga0055540_10105102 114
213 3300003792 Ga0055540_1010819 Ga0055540_10108194 114
214 3300005328 Ga0070676_10059747 Ga0070676_100597472 114
215 3300005330 Ga0070690_100251515 Ga0070690_1002515152 114
216 3300005333 Ga0070677_10243331 Ga0070677_102433312 114
217 3300005334 Ga0068869_101084253 Ga0068869_1010842531 114
218 3300005335 Ga0070666_10014436 Ga0070666_100144365 114
219 3300005337 Ga0070682_100003080 Ga0070682_1000030802 114
220 3300005337 Ga0070682_100038791 Ga0070682_1000387913 114
221 3300005337 Ga0070682_100695119 Ga0070682_1006951192 114
222 3300005338 Ga0068868_100001163 Ga0068868_1000011637 114
223 3300005339 Ga0070660_100354907 Ga0070660_1003549072 114
224 3300005340 Ga0070689_100076385 Ga0070689_1000763853 114
225 3300005340 Ga0070689_101282709 Ga0070689_1012827092 114
226 3300005341 Ga0070691_10109073 Ga0070691_101090731 114
227 3300005345 Ga0070692_10563468 Ga0070692_105634682 114
228 3300005347 Ga0070668_100001540 Ga0070668_10000154010 114
229 3300005347 Ga0070668_101183060 Ga0070668_1011830601 114
230 3300005347 Ga0070668_101721540 Ga0070668_1017215401 114
231 3300005353 Ga0070669_100018910 Ga0070669_1000189103 114
232 3300005355 Ga0070671_100012258 Ga0070671_1000122585 114
233 3300005355 Ga0070671_100173699 Ga0070671_1001736992 114
234 3300005355 Ga0070671_100827414 Ga0070671_1008274141 114
235 3300005356 Ga0070674_100003394 Ga0070674_1000033943 114
236 3300005356 Ga0070674_100771590 Ga0070674_1007715902 114
237 3300005365 Ga0070688_100054103 Ga0070688_1000541032 114
238 3300005366 Ga0070659_100254920 Ga0070659_1002549201 114
239 3300005366 Ga0070659_100553719 Ga0070659_1005537192 114
240 3300005367 Ga0070667_100000791 Ga0070667_10000079121 114
241 3300005367 Ga0070667_100013169 Ga0070667_1000131693 114
242 3300005367 Ga0070667_100027611 Ga0070667_1000276113 114
243 3300005367 Ga0070667_100055913 Ga0070667_1000559134 114
244 3300005367 Ga0070667_100244906 Ga0070667_1002449062 114
245 3300005367 Ga0070667_101554950 Ga0070667_1015549501 114
246 3300005435 Ga0070714_100261269 Ga0070714_1002612692 114
247 3300005437 Ga0070710_10000690 Ga0070710_100006903 114
248 3300005438 Ga0070701_10011800 Ga0070701_100118003 114
249 3300005439 Ga0070711_100000160 Ga0070711_10000016024 114
250 3300005440 Ga0070705_100056197 Ga0070705_1000561973 114
251 3300005441 Ga0070700_100072711 Ga0070700_1000727113 114
252 3300005441 Ga0070700_100566538 Ga0070700_1005665382 114
253 3300005444 Ga0070694_100023962 Ga0070694_1000239623 114
254 3300005445 Ga0070708_100429423 Ga0070708_1004294232 114
255 3300005455 Ga0070663_100032577 Ga0070663_1000325773 114
256 3300005455 Ga0070663_100358948 Ga0070663_1003589482 114
257 3300005456 Ga0070678_100000117 Ga0070678_10000011732 114
258 3300005456 Ga0070678_100747911 Ga0070678_1007479112 114
259 3300005457 Ga0070662_100016792 Ga0070662_1000167923 114
260 3300005457 Ga0070662_101505328 Ga0070662_1015053281 114
261 3300005459 Ga0068867_100004067 Ga0068867_1000040676 114
262 3300005466 Ga0070685_10086894 Ga0070685_100868943 114
263 3300005535 Ga0070684_100318328 Ga0070684_1003183282 114
264 3300005535 Ga0070684_101335652 Ga0070684_1013356521 114
265 3300005539 Ga0068853_100023917 Ga0068853_1000239174 114
266 3300005539 Ga0068853_100419449 Ga0068853_1004194492 114
267 3300005539 Ga0068853_100470462 Ga0068853_1004704622 114
268 3300005546 Ga0070696_100010017 Ga0070696_1000100173 114
269 3300005546 Ga0070696_100566175 Ga0070696_1005661752 114
270 3300005547 Ga0070693_100149329 Ga0070693_1001493292 114
271 3300005547 Ga0070693_100946008 Ga0070693_1009460082 114
272 3300005548 Ga0070665_100007248 Ga0070665_1000072489 114
273 3300005548 Ga0070665_100009840 Ga0070665_1000098409 114
274 3300005549 Ga0070704_100019594 Ga0070704_1000195944 114
275 3300005563 Ga0068855_100228057 Ga0068855_1002280572 114
276 3300005563 Ga0068855_100753020 Ga0068855_1007530202 114
277 3300005578 Ga0068854_100009069 Ga0068854_1000090696 114
278 3300005614 Ga0068856_101110798 Ga0068856_1011107982 114
279 3300005614 Ga0068856_102256597 Ga0068856_1022565972 114
280 3300005615 Ga0070702_100050964 Ga0070702_1000509643 114
281 3300005616 Ga0068852_101148598 Ga0068852_1011485982 114
282 3300005617 Ga0068859_100001042 Ga0068859_10000104214 114
283 3300005617 Ga0068859_100077098 Ga0068859_1000770982 114
284 3300005617 Ga0068859_102748165 Ga0068859_1027481652 114
285 3300005618 Ga0068864_100852037 Ga0068864_1008520372 114
286 3300005618 Ga0068864_101833201 Ga0068864_1018332012 114
287 3300005718 Ga0068866_10000441 Ga0068866_100004416 114
288 3300005718 Ga0068866_10492337 Ga0068866_104923372 114
289 3300005719 Ga0068861_100003820 Ga0068861_10000382011 114
290 3300005834 Ga0068851_10602360 Ga0068851_106023601 114
291 3300005841 Ga0068863_100001025 Ga0068863_10000102519 114
292 3300005841 Ga0068863_100007351 Ga0068863_1000073517 114
293 3300005842 Ga0068858_100004832 Ga0068858_10000483213 114
294 3300005842 Ga0068858_100016818 Ga0068858_1000168185 114
295 3300005842 Ga0068858_100858020 Ga0068858_1008580202 114
296 3300005843 Ga0068860_100000087 Ga0068860_10000008722 114
297 3300005843 Ga0068860_100008728 Ga0068860_10000872811 114
298 3300005843 Ga0068860_100103874 Ga0068860_1001038743 114
299 3300005843 Ga0068860_100731000 Ga0068860_1007310002 114
300 3300005844 Ga0068862_100000077 Ga0068862_10000007773 114
301 3300005844 Ga0068862_100022465 Ga0068862_1000224653 114
302 3300005844 Ga0068862_100633339 Ga0068862_1006333392 114
303 3300005937 Ga0081455_10050617 Ga0081455_100506174 114
304 3300005981 Ga0081538_10051013 Ga0081538_100510133 114
305 3300006038 Ga0075365_10008384 Ga0075365_100083842 114
306 3300006038 Ga0075365_10021990 Ga0075365_100219904 114
307 3300006042 Ga0075368_10032217 Ga0075368_100322173 114
308 3300006048 Ga0075363_100015328 Ga0075363_1000153283 114
309 3300006048 Ga0075363_100045147 Ga0075363_1000451473 114
310 3300006048 Ga0075363_100065296 Ga0075363_1000652961 114
311 3300006048 Ga0075363_100067780 Ga0075363_1000677803 114
312 3300006048 Ga0075363_100136569 Ga0075363_1001365692 114
313 3300006048 Ga0075363_100352486 Ga0075363_1003524862 114
314 3300006051 Ga0075364_10001414 Ga0075364_100014149 114
315 3300006051 Ga0075364_10020127 Ga0075364_100201272 114
316 3300006051 Ga0075364_10027813 Ga0075364_100278134 114
317 3300006051 Ga0075364_10080694 Ga0075364_100806942 114
318 3300006051 Ga0075364_10152366 Ga0075364_101523661 114
319 3300006051 Ga0075364_10157763 Ga0075364_101577632 114
320 3300006163 Ga0070715_10035753 Ga0070715_100357532 114
321 3300006173 Ga0070716_100009944 Ga0070716_1000099442 114
322 3300006173 Ga0070716_100368460 Ga0070716_1003684602 114
323 3300006175 Ga0070712_100004671 Ga0070712_1000046711 114
324 3300006175 Ga0070712_100305967 Ga0070712_1003059672 114
325 3300006177 Ga0075362_10028392 Ga0075362_100283923 114
326 3300006177 Ga0075362_10324695 Ga0075362_103246952 114
327 3300006177 Ga0075362_10487996 Ga0075362_104879962 114
328 3300006178 Ga0075367_10019596 Ga0075367_100195963 114
329 3300006178 Ga0075367_10150722 Ga0075367_101507222 114
330 3300006178 Ga0075367_10357597 Ga0075367_103575972 114
331 3300006186 Ga0075369_10004544 Ga0075369_100045442 114
332 3300006186 Ga0075369_10017401 Ga0075369_100174014 114
333 3300006186 Ga0075369_10054488 Ga0075369_100544881 114
334 3300006186 Ga0075369_10158156 Ga0075369_101581562 114
335 3300006186 Ga0075369_10210800 Ga0075369_102108001 114
336 3300006186 Ga0075369_10275887 Ga0075369_102758871 114
337 3300006186 Ga0075369_10584235 Ga0075369_105842352 114
338 3300006195 Ga0075366_10130591 Ga0075366_101305912 114
339 3300006353 Ga0075370_10024765 Ga0075370_100247652 114
340 3300006353 Ga0075370_10090521 Ga0075370_100905212 114
341 3300006353 Ga0075370_10353010 Ga0075370_103530102 114
342 3300006881 Ga0068865_100090172 Ga0068865_1000901722 114
343 3300006931 Ga0097620_100001042 Ga0097620_10000104214 114
344 3300006931 Ga0097620_100077087 Ga0097620_1000770872 114
345 3300006931 Ga0097620_102747959 Ga0097620_1027479592 114
346 3300007076 Ga0075435_101459257 Ga0075435_1014592572 114
347 3300009098 Ga0105245_10008338 Ga0105245_1000833810 114
348 3300009098 Ga0105245_10611967 Ga0105245_106119672 114
349 3300009098 Ga0105245_12432130 Ga0105245_124321302 114
350 3300009101 Ga0105247_10000060 Ga0105247_1000006074 114
351 3300009101 Ga0105247_10000298 Ga0105247_1000029823 114
352 3300009147 Ga0114129_12700063 Ga0114129_127000632 114
353 3300009148 Ga0105243_10000700 Ga0105243_100007009 114
354 3300009174 Ga0105241_11597817 Ga0105241_115978172 114
355 3300009176 Ga0105242_10000325 Ga0105242_1000032539 114
356 3300009177 Ga0105248_10000050 Ga0105248_1000005017 114
357 3300009177 Ga0105248_10088134 Ga0105248_100881342 114
358 3300009177 Ga0105248_13114414 Ga0105248_131144142 114
359 3300009545 Ga0105237_10006011 Ga0105237_100060118 114
360 3300009545 Ga0105237_10011826 Ga0105237_100118263 114
361 3300009551 Ga0105238_10217724 Ga0105238_102177243 114
362 3300009551 Ga0105238_10829792 Ga0105238_108297922 114
363 3300009553 Ga0105249_10000042 Ga0105249_10000042136 114
364 3300009553 Ga0105249_10000470 Ga0105249_1000047012 114
365 3300009553 Ga0105249_10052537 Ga0105249_100525372 114
366 3300009553 Ga0105249_10463722 Ga0105249_104637221 114
367 3300010159 Ga0099796_10029743 Ga0099796_100297432 114
368 3300010375 Ga0105239_10016841 Ga0105239_100168418 114
369 3300010375 Ga0105239_10024596 Ga0105239_100245962 114
370 3300010375 Ga0105239_10415751 Ga0105239_104157512 114
371 3300010375 Ga0105239_11068124 Ga0105239_110681242 114
372 3300011119 Ga0105246_10268090 Ga0105246_102680902 114
373 3300011119 Ga0105246_10422698 Ga0105246_104226982 114
374 3300013297 Ga0157378_10013827 Ga0157378_100138276 114
375 3300013297 Ga0157378_12874990 Ga0157378_128749901 114
376 3300013306 Ga0163162_10089165 Ga0163162_100891651 114
377 3300013306 Ga0163162_10270692 Ga0163162_102706922 114
378 3300013306 Ga0163162_11335687 Ga0163162_113356872 114
379 3300013307 Ga0157372_10048234 Ga0157372_100482342 114
380 3300013307 Ga0157372_10673523 Ga0157372_106735232 114
381 3300014325 Ga0163163_10175729 Ga0163163_101757292 114
382 3300014325 Ga0163163_10245027 Ga0163163_102450272 114
383 3300014326 Ga0157380_10019608 Ga0157380_100196083 114
384 3300014745 Ga0157377_10476126 Ga0157377_104761262 114
385 3300014968 Ga0157379_10002499 Ga0157379_1000249920 114
386 3300014969 Ga0157376_10135466 Ga0157376_101354662 114
387 3300017792 Ga0163161_10027061 Ga0163161_100270613 114
388 3300021384 Ga0213876_10002110 Ga0213876_100021109 114
389 3300021388 Ga0213875_10036304 Ga0213875_100363043 114
390 3300021388 Ga0213875_10081020 Ga0213875_100810201 114
391 3300025303 Ga0209051_1001345 Ga0209051_100134517 114
392 3300025303 Ga0209051_1010755 Ga0209051_10107553 114
393 3300025898 Ga0207692_10007732 Ga0207692_100077321 114
394 3300025899 Ga0207642_10001048 Ga0207642_100010487 114
395 3300025900 Ga0207710_10000010 Ga0207710_1000001076 114
396 3300025900 Ga0207710_10023951 Ga0207710_100239512 114
397 3300025901 Ga0207688_10914849 Ga0207688_109148492 114
398 3300025903 Ga0207680_10014842 Ga0207680_100148423 114
399 3300025904 Ga0207647_10190458 Ga0207647_101904582 114
400 3300025905 Ga0207685_10150813 Ga0207685_101508132 114
401 3300025907 Ga0207645_10706452 Ga0207645_107064522 114
402 3300025914 Ga0207671_10007606 Ga0207671_100076067 114
403 3300025914 Ga0207671_10074011 Ga0207671_100740113 114
404 3300025914 Ga0207671_10402997 Ga0207671_104029972 114
405 3300025915 Ga0207693_10000754 Ga0207693_1000075427 114
406 3300025916 Ga0207663_10004087 Ga0207663_100040873 114
407 3300025921 Ga0207652_11098335 Ga0207652_110983351 114
408 3300025923 Ga0207681_10034834 Ga0207681_100348344 114
409 3300025923 Ga0207681_10071094 Ga0207681_100710943 114
410 3300025924 Ga0207694_10051458 Ga0207694_100514583 114
411 3300025925 Ga0207650_10354730 Ga0207650_103547302 114
412 3300025927 Ga0207687_10003034 Ga0207687_1000303410 114
413 3300025927 Ga0207687_11440980 Ga0207687_114409802 114
414 3300025928 Ga0207700_10451888 Ga0207700_104518882 114
415 3300025929 Ga0207664_10539498 Ga0207664_105394982 114
416 3300025929 Ga0207664_10733868 Ga0207664_107338682 114
417 3300025931 Ga0207644_10019755 Ga0207644_100197553 114
418 3300025931 Ga0207644_10600516 Ga0207644_106005162 114
419 3300025931 Ga0207644_10647832 Ga0207644_106478322 114
420 3300025932 Ga0207690_10222592 Ga0207690_102225922 114
421 3300025933 Ga0207706_10021979 Ga0207706_100219793 114
422 3300025933 Ga0207706_10823668 Ga0207706_108236682 114
423 3300025934 Ga0207686_10002494 Ga0207686_100024947 114
424 3300025935 Ga0207709_10007107 Ga0207709_100071076 114
425 3300025936 Ga0207670_10496316 Ga0207670_104963161 114
426 3300025937 Ga0207669_10001189 Ga0207669_100011893 114
427 3300025938 Ga0207704_10002289 Ga0207704_100022892 114
428 3300025939 Ga0207665_10009094 Ga0207665_100090946 114
429 3300025939 Ga0207665_10699682 Ga0207665_106996822 114
430 3300025941 Ga0207711_10001406 Ga0207711_1000140619 114
431 3300025941 Ga0207711_10032792 Ga0207711_100327924 114
432 3300025942 Ga0207689_10031372 Ga0207689_100313724 114
433 3300025942 Ga0207689_10752573 Ga0207689_107525732 114
434 3300025949 Ga0207667_10823680 Ga0207667_108236802 114
435 3300025961 Ga0207712_10000010 Ga0207712_10000010315 114
436 3300025961 Ga0207712_10001196 Ga0207712_1000119620 114
437 3300025972 Ga0207668_10006413 Ga0207668_100064136 114
438 3300025972 Ga0207668_10160530 Ga0207668_101605302 114
439 3300025972 Ga0207668_10258034 Ga0207668_102580342 114
440 3300025972 Ga0207668_11956577 Ga0207668_119565771 114
441 3300025981 Ga0207640_10009045 Ga0207640_100090454 114
442 3300025981 Ga0207640_10267566 Ga0207640_102675662 114
443 3300025986 Ga0207658_10000677 Ga0207658_1000067721 114
444 3300025986 Ga0207658_10007671 Ga0207658_100076716 114
445 3300025986 Ga0207658_10061168 Ga0207658_100611684 114
446 3300025986 Ga0207658_10125469 Ga0207658_101254692 114
447 3300025986 Ga0207658_10697148 Ga0207658_106971482 114
448 3300026023 Ga0207677_10047066 Ga0207677_100470663 114
449 3300026023 Ga0207677_10210790 Ga0207677_102107901 114
450 3300026023 Ga0207677_10474370 Ga0207677_104743702 114
451 3300026035 Ga0207703_10009823 Ga0207703_100098236 114
452 3300026035 Ga0207703_10028562 Ga0207703_100285624 114
453 3300026035 Ga0207703_10416991 Ga0207703_104169911 114
454 3300026041 Ga0207639_10007030 Ga0207639_100070305 114
455 3300026041 Ga0207639_10117806 Ga0207639_101178063 114
456 3300026067 Ga0207678_10009360 Ga0207678_1000936011 114
457 3300026067 Ga0207678_10307275 Ga0207678_103072753 114
458 3300026075 Ga0207708_10006796 Ga0207708_100067966 114
459 3300026075 Ga0207708_10416206 Ga0207708_104162062 114
460 3300026078 Ga0207702_12139177 Ga0207702_121391771 114
461 3300026088 Ga0207641_10000849 Ga0207641_100008499 114
462 3300026088 Ga0207641_10020040 Ga0207641_100200403 114
463 3300026088 Ga0207641_10026225 Ga0207641_100262255 114
464 3300026089 Ga0207648_10008331 Ga0207648_100083312 114
465 3300026095 Ga0207676_10780961 Ga0207676_107809612 114
466 3300026095 Ga0207676_11208545 Ga0207676_112085451 114
467 3300026118 Ga0207675_100007850 Ga0207675_1000078504 114
468 3300026118 Ga0207675_100260493 Ga0207675_1002604932 114
469 3300026118 Ga0207675_101094830 Ga0207675_1010948301 114
470 3300026118 Ga0207675_101991034 Ga0207675_1019910342 114
471 3300026121 Ga0207683_10000984 Ga0207683_100009844 114
472 3300026121 Ga0207683_10290362 Ga0207683_102903622 114
473 3300026142 Ga0207698_10199898 Ga0207698_101998982 114
474 3300027866 Ga0209813_10490391 Ga0209813_104903912 114
475 3300028379 Ga0268266_10006935 Ga0268266_100069354 114
476 3300028380 Ga0268265_10000014 Ga0268265_10000014138 114
477 3300028380 Ga0268265_10026662 Ga0268265_100266625 114
478 3300028380 Ga0268265_10955307 Ga0268265_109553072 114
479 3300028381 Ga0268264_10000150 Ga0268264_1000015021 114
480 3300028381 Ga0268264_10046360 Ga0268264_100463602 114
481 3300028381 Ga0268264_10320951 Ga0268264_103209513 114
482 3300031731 Ga0307405_10073751 Ga0307405_100737512 114
483 3300031824 Ga0307413_11210083 Ga0307413_112100831 114
484 3300031852 Ga0307410_10083330 Ga0307410_100833302 114
485 3300031852 Ga0307410_11349601 Ga0307410_113496012 114
486 3300031903 Ga0307407_10251828 Ga0307407_102518282 114
487 3300031911 Ga0307412_10208993 Ga0307412_102089933 114
488 3300031995 Ga0307409_100004098 Ga0307409_1000040985 114
489 3300031995 Ga0307409_100039873 Ga0307409_1000398732 114
490 3300032002 Ga0307416_100162681 Ga0307416_1001626812 114
491 3300032004 Ga0307414_11019421 Ga0307414_110194212 114
492 3300032005 Ga0307411_10510527 Ga0307411_105105271 114
493 3300032126 Ga0307415_100303069 Ga0307415_1003030692 114
494 3300034816 Ga0373930_0137645 Ga0373930_0137645_151_495 114
495 3300035090 Ga0373949_0105793 Ga0373949_0105793_201_545 114
496 3300035091 Ga0373951_0017482 Ga0373951_0017482_28_372 114
497 3300035112 Ga0373932_0400942 Ga0373932_0400942_28_372 114
498 3300035242 Ga0373962_0010540 Ga0373962_0010540_592_936 114
499 3300035242 Ga0373962_0137281 Ga0373962_0137281_269_613 114
500 3300035691 Ga0373931_0018006 Ga0373931_0018006_1341_1685 114
501 3300037853 Ga0436364_0780709 Ga0436364_0780709_968_1315 114
502 3300037853 Ga0436364_1308388 Ga0436364_1308388_16183_16542 114
503 3300039437 Ga0436365_1646946 Ga0436365_1646946_23958_24314 114
504 3300039437 Ga0436365_1657364 Ga0436365_1657364_911_1270 114
505 3300039438 Ga0436360_0672569 Ga0436360_0672569_532_879 114
506 3300039447 Ga0436361_0106752 Ga0436361_0106752_13_360 114
507 3300039447 Ga0436361_1011217 Ga0436361_1011217_590_970 114
508 3300039450 Ga0436363_0344303 Ga0436363_0344303_281_625 114
509 3300039450 Ga0436363_1376063 Ga0436363_1376063_185_532 114
510 3300041410 Ga0439461_0007259 Ga0439461_0007259_1459_1803 114
511 3300041410 Ga0439461_0096349 Ga0439461_0096349_327_671 114
512 3300041411 Ga0439466_0009584 Ga0439466_0009584_1097_1441 114
513 3300041411 Ga0439466_0023180 Ga0439466_0023180_1576_1920 114
514 3300041413 Ga0439465_0002866 Ga0439465_0002866_2400_2747 114
515 3300041413 Ga0439465_0002904 Ga0439465_0002904_2982_3326 114
516 3300041413 Ga0439465_0047333 Ga0439465_0047333_574_918 114
517 3300041441 Ga0451787_726021 Ga0451787_726021_156_524 114
518 3300041452 Ga0451793_0435955 Ga0451793_0435955_77_427 114
519 3300041456 Ga0451795_0833080 Ga0451795_0833080_10_360 114
520 3300041507 Ga0451851_0672866 Ga0451851_0672866_258_602 114
521 3300041997 Ga0439431_0008285 Ga0439431_0008285_1778_2122 114
522 3300042002 Ga0439442_005501 Ga0439442_005501_1201_1545 114
523 3300042002 Ga0439442_026101 Ga0439442_026101_165_509 114
524 3300042435 Ga0439434_0029139 Ga0439434_0029139_1314_1658 114
525 3300042435 Ga0439434_0192560 Ga0439434_0192560_212_556 114
526 3300042438 Ga0439459_0024743 Ga0439459_0024743_456_833 114
527 3300044656 Ga0466969_0072566 Ga0466969_0072566_42_398 114
528 3300044658 Ga0466972_0008599 Ga0466972_0008599_305_649 114
529 3300044658 Ga0466972_0189564 Ga0466972_0189564_486_842 114
530 3300044683 Ga0466965_0010937 Ga0466965_0010937_349_693 114
531 3300044684 Ga0466966_0001105 Ga0466966_0001105_12739_13095 114
532 3300044684 Ga0466966_0001218 Ga0466966_0001218_11151_11498 114
533 3300044684 Ga0466966_0028710 Ga0466966_0028710_502_846 114
534 3300044693 Ga0466961_0001949 Ga0466961_0001949_8899_9255 114
535 3300044693 Ga0466961_0053399 Ga0466961_0053399_2030_2374 114
536 3300044693 Ga0466961_0104802 Ga0466961_0104802_832_1179 114
537 3300044694 Ga0466963_0012616 Ga0466963_0012616_4059_4406 114
538 3300044694 Ga0466963_0362558 Ga0466963_0362558_10_354 114
539 3300044694 Ga0466963_0421711 Ga0466963_0421711_501_857 114
540 3300044706 Ga0466964_0107557 Ga0466964_0107557_210_554 114
541 3300044719 Ga0466971_0003761 Ga0466971_0003761_566_910 114
542 3300044719 Ga0466971_0022480 Ga0466971_0022480_472_816 114
543 3300044719 Ga0466971_0150847 Ga0466971_0150847_344_700 114
544 3300044735 Ga0466968_0001182 Ga0466968_0001182_5861_6208 114
545 3300044735 Ga0466968_0033488 Ga0466968_0033488_1434_1778 114
546 3300044765 Ga0466970_0040721 Ga0466970_0040721_1854_2201 114
547 3300044765 Ga0466970_0077835 Ga0466970_0077835_521_865 114
548 3300044765 Ga0466970_0379011 Ga0466970_0379011_120_482 114
549 3300044842 Ga0466957_0000981 Ga0466957_0000981_5191_5547 114
550 3300044842 Ga0466957_0031268 Ga0466957_0031268_934_1278 114
551 3300044842 Ga0466957_0041631 Ga0466957_0041631_900_1247 114
552 3300044842 Ga0466957_0065523 Ga0466957_0065523_357_704 114
553 3300045049 Ga0466959_0000774 Ga0466959_0000774_13395_13751 114
554 3300045049 Ga0466959_0001867 Ga0466959_0001867_8538_8885 114
555 3300045049 Ga0466959_0314834 Ga0466959_0314834_607_951 114
556 3300045836 Ga0466958_0001942 Ga0466958_0001942_5509_5865 114
557 3300045836 Ga0466958_0003868 Ga0466958_0003868_5415_5762 114
558 3300045836 Ga0466958_0347027 Ga0466958_0347027_104_448 114
559 3300045836 Ga0466958_0352454 Ga0466958_0352454_173_517 114
560 3300045976 Ga0466967_0006454 Ga0466967_0006454_199_543 114
561 3300045976 Ga0466967_0334416 Ga0466967_0334416_644_991 114
562 3300045976 Ga0466967_0709277 Ga0466967_0709277_511_855 114
563 3300045976 Ga0466967_0988656 Ga0466967_0988656_160_504 114
564 3300045976 Ga0466967_1016565 Ga0466967_1016565_57_401 114
565 3300045976 Ga0466967_1537566 Ga0466967_1537566_237_596 114
566 3300046459 Ga0495629_0050017 Ga0495629_0050017_1006_1350 114
567 3300046461 Ga0495641_0171717 Ga0495641_0171717_83_427 114
568 3300046513 Ga0495616_0191824 Ga0495616_0191824_174_518 114
569 3300046515 Ga0495620_0060421 Ga0495620_0060421_1000_1344 114
570 3300046531 Ga0495665_0119069 Ga0495665_0119069_896_1240 114
571 3300046533 Ga0495640_0048156 Ga0495640_0048156_1485_1829 114
572 3300046663 Ga0495635_0190327 Ga0495635_0190327_536_913 114
573 3300046678 Ga0495599_0283133 Ga0495599_0283133_577_921 114
574 3300046683 Ga0495658_0099821 Ga0495658_0099821_156_500 114
575 3300047315 Ga0495581_0206725 Ga0495581_0206725_568_912 114
576 3300047320 Ga0495672_0107141 Ga0495672_0107141_973_1317 114
577 3300047321 Ga0495676_0221348 Ga0495676_0221348_915_1259 114
578 3300047673 Ga0495593_0047404 Ga0495593_0047404_237_581 114
579 3300048903 Ga0496100_0001148 Ga0496100_0001148_11525_11902 114
580 3300048903 Ga0496100_0001530 Ga0496100_0001530_5936_6280 114
581 3300048903 Ga0496100_0386033 Ga0496100_0386033_107_460 114
582 3300048903 Ga0496100_1186075 Ga0496100_1186075_188_532 114
583 3300048904 Ga0496101_0000110 Ga0496101_0000110_18353_18730 114
584 3300048904 Ga0496101_0013571 Ga0496101_0013571_2432_2776 114
585 3300048904 Ga0496101_0142244 Ga0496101_0142244_984_1337 114
586 3300048904 Ga0496101_0245115 Ga0496101_0245115_231_575 114
587 3300048905 Ga0496102_0000006 Ga0496102_0000006_317479_317856 114
588 3300048905 Ga0496102_0003241 Ga0496102_0003241_5471_5824 114
589 3300048905 Ga0496102_0005337 Ga0496102_0005337_1567_1911 114
590 3300048905 Ga0496102_0244209 Ga0496102_0244209_1228_1572 114
591 3300048905 Ga0496102_0594017 Ga0496102_0594017_61_405 114
592 3300048906 Ga0496103_0000006 Ga0496103_0000006_317277_317654 114
593 3300048906 Ga0496103_0004893 Ga0496103_0004893_73_417 114
594 3300048906 Ga0496103_0019975 Ga0496103_0019975_1044_1397 114
595 3300048907 Ga0496104_0055184 Ga0496104_0055184_2651_3004 114
596 3300048908 Ga0496105_0044484 Ga0496105_0044484_3157_3510 114
597 3300048908 Ga0496105_0134415 Ga0496105_0134415_498_875 114
598 3300048909 Ga0496106_0000616 Ga0496106_0000616_9059_9403 114
599 3300048909 Ga0496106_1109741 Ga0496106_1109741_107_484 114
600 3300048910 Ga0496107_0001329 Ga0496107_0001329_1144_1488 114
601 3300048911 Ga0496108_0186793 Ga0496108_0186793_999_1343 114
602 3300048911 Ga0496108_0670087 Ga0496108_0670087_34_378 114
603 3300048912 Ga0496109_0374002 Ga0496109_0374002_503_856 114
604 3300048912 Ga0496109_0415287 Ga0496109_0415287_381_725 114
605 3300048913 Ga0496110_0168417 Ga0496110_0168417_1622_1966 114
606 3300048913 Ga0496110_1216350 Ga0496110_1216350_222_584 114
607 3300048914 Ga0496111_0294223 Ga0496111_0294223_627_980 114
608 3300048915 Ga0496112_0019953 Ga0496112_0019953_5528_5872 114
609 3300048915 Ga0496112_0252536 Ga0496112_0252536_249_593 114
610 3300048916 Ga0496113_0159294 Ga0496113_0159294_640_984 114
611 3300048917 Ga0496114_0000522 Ga0496114_0000522_20366_20710 114
612 3300048918 Ga0496115_0002348 Ga0496115_0002348_365_709 114
613 3300048918 Ga0496115_0214817 Ga0496115_0214817_405_749 114
614 3300048919 Ga0496116_0000025 Ga0496116_0000025_152886_153263 114
615 3300048920 Ga0496117_0000006 Ga0496117_0000006_152886_153263 114
616 3300048921 Ga0496118_0000004 Ga0496118_0000004_152886_153263 114
617 3300048922 Ga0496119_0000035 Ga0496119_0000035_67124_67501 114
618 3300048922 Ga0496119_0438713 Ga0496119_0438713_86_439 114
619 3300048923 Ga0496120_0000079 Ga0496120_0000079_25620_25997 114
620 3300048924 Ga0496121_0000090 Ga0496121_0000090_100676_101053 114
621 3300048927 Ga0496124_0429981 Ga0496124_0429981_191_541 114
622 3300048929 Ga0496126_0002186 Ga0496126_0002186_13659_14003 114
623 3300048929 Ga0496126_0030158 Ga0496126_0030158_282_659 114
624 3300049569 Ga0501032_0394303 Ga0501032_0394303_453_797 114
625 3300049571 Ga0501034_0091269 Ga0501034_0091269_548_892 114
626 3300049580 Ga0501046_0238098 Ga0501046_0238098_337_681 114
627 3300049581 Ga0501047_0011332 Ga0501047_0011332_7542_7886 114
628 3300049581 Ga0501047_0649234 Ga0501047_0649234_366_710 114
629 3300049582 Ga0501048_0586807 Ga0501048_0586807_212_568 114
630 3300049586 Ga0501070_0093403 Ga0501070_0093403_1084_1437 114
631 3300049742 Ga0501080_0542211 Ga0501080_0542211_460_813 114
632 3300049822 Ga0501035_0000497 Ga0501035_0000497_11236_11580 114
633 3300049823 Ga0501044_0007277 Ga0501044_0007277_5123_5467 114
634 3300049823 Ga0501044_0042930 Ga0501044_0042930_3816_4163 114
635 3300049823 Ga0501044_0444084 Ga0501044_0444084_76_432 114
636 3300050489 nmdc:mga03683_179253_c1 nmdc:mga03683_179253_c1_552_896 114
637 3300050489 nmdc:mga03683_23689_c1 nmdc:mga03683_23689_c1_142_486 114
638 3300050489 nmdc:mga03683_417253_c1 nmdc:mga03683_417253_c1_241_594 114
639 3300050490 nmdc:mga03n38_148780_c1 nmdc:mga03n38_148780_c1_532_879 114
640 3300050490 nmdc:mga03n38_2381_c1 nmdc:mga03n38_2381_c1_5349_5693 114
641 3300050490 nmdc:mga03n38_323265_c1 nmdc:mga03n38_323265_c1_315_659 114
642 3300050490 nmdc:mga03n38_421862_c1 nmdc:mga03n38_421862_c1_77_421 114
643 3300050490 nmdc:mga03n38_656131_c1 nmdc:mga03n38_656131_c1_129_473 114
644 3300050490 nmdc:mga03n38_831841_c1 nmdc:mga03n38_831841_c1_66_410 114
645 3300050491 nmdc:mga00v17_15511_c1 nmdc:mga00v17_15511_c1_360_704 114
646 3300050491 nmdc:mga00v17_238225_c1 nmdc:mga00v17_238225_c1_336_686 114
647 3300050491 nmdc:mga00v17_259274_c1 nmdc:mga00v17_259274_c1_754_1098 114
648 3300050491 nmdc:mga00v17_275111_c1 nmdc:mga00v17_275111_c1_238_585 114
649 3300050491 nmdc:mga00v17_28984_c1 nmdc:mga00v17_28984_c1_884_1228 114
650 3300050491 nmdc:mga00v17_38260_c1 nmdc:mga00v17_38260_c1_2034_2390 114
651 3300050491 nmdc:mga00v17_84002_c1 nmdc:mga00v17_84002_c1_831_1184 114
652 3300050492 nmdc:mga0yw44_2784_c1 nmdc:mga0yw44_2784_c1_576_920 114
653 3300050492 nmdc:mga0yw44_47147_c1 nmdc:mga0yw44_47147_c1_1620_1964 114
654 3300050492 nmdc:mga0yw44_66954_c1 nmdc:mga0yw44_66954_c1_729_1073 114
655 3300050493 nmdc:mga0k408_189390_c1 nmdc:mga0k408_189390_c1_812_1156 114
656 3300050494 nmdc:mga06z11_186539_c1 nmdc:mga06z11_186539_c1_678_1022 114
657 3300050494 nmdc:mga06z11_247361_c1 nmdc:mga06z11_247361_c1_323_667 114
658 3300050494 nmdc:mga06z11_859682_c1 nmdc:mga06z11_859682_c1_129_473 114
659 3300050495 nmdc:mga04h51_528264_c1 nmdc:mga04h51_528264_c1_81_431 114
660 3300050496 nmdc:mga07m45_20108_c1 nmdc:mga07m45_20108_c1_313_657 114
661 3300050496 nmdc:mga07m45_223956_c1 nmdc:mga07m45_223956_c1_211_555 114
662 3300050496 nmdc:mga07m45_72746_c1 nmdc:mga07m45_72746_c1_1052_1396 114
663 3300050496 nmdc:mga07m45_765773_c1 nmdc:mga07m45_765773_c1_114_467 114
664 3300050513 nmdc:mga0rr50_1224350_c1 nmdc:mga0rr50_1224350_c1_82_426 114
665 3300050516 nmdc:mga0sz30_142680_c1 nmdc:mga0sz30_142680_c1_653_1003 114
666 3300050516 nmdc:mga0sz30_142957_c1 nmdc:mga0sz30_142957_c1_702_1046 114
667 3300050516 nmdc:mga0sz30_15363_c1 nmdc:mga0sz30_15363_c1_1735_2082 114
668 3300050516 nmdc:mga0sz30_235460_c1 nmdc:mga0sz30_235460_c1_76_423 114
669 3300050516 nmdc:mga0sz30_23957_c1 nmdc:mga0sz30_23957_c1_1813_2157 114
670 3300050516 nmdc:mga0sz30_86067_c1 nmdc:mga0sz30_86067_c1_347_691 114
671 3300053077 Ga0495601_0339808 Ga0495601_0339808_220_564 114
672 3300053080 Ga0500635_0027164 Ga0500635_0027164_1080_1436 114
673 3300053083 Ga0495655_0081153 Ga0495655_0081153_546_890 114
674 3300053083 Ga0495655_0133853 Ga0495655_0133853_122_466 114
675 3300053083 Ga0495655_0146864 Ga0495655_0146864_207_551 114
676 3300053085 Ga0495619_0094594 Ga0495619_0094594_413_757 114
677 3300053096 Ga0500641_0183658 Ga0500641_0183658_266_619 114
678 3300053129 Ga0500628_042736 Ga0500628_042736_302_646 114
679 3300053131 Ga0500652_008367 Ga0500652_008367_495_851 114
680 3300053153 Ga0500616_0292747 Ga0500616_0292747_114_458 114
681 3300061719 Ga0466962_0023192 Ga0466962_0023192_1425_1769 114
682 3300061719 Ga0466962_0032563 Ga0466962_0032563_69_413 114
683 3300061719 Ga0466962_0192561 Ga0466962_0192561_266_622 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

11

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9535 3 114
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9528 3 114
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9526 3 114
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.952 3 114
1sjz-assembly1.cif.gz_A arsenate reductase r60k mutant +0.4m arsenite from e. coli 0.9429 3 114
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9414 3 114 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9237 3 112 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9178 3 114 3.40.30.10
af_A0A1D6IL16_82_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.91 2 32 3.40.30.10
af_P23202_75_198_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8941 2 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2S9GFL3-F1-model_v4 Arsenate reductase (Glutaredoxin) 0.9844 15 97 GO:0046685
AF-A0A7K2HRA7-F1-model_v4 arsenate reductase (glutathione/glutaredoxin) (EC 1.20.4.1) 0.9827 3 114 GO:0008794
GO:0046685
AF-A0A850QCQ4-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9813 4 107 GO:0008794
GO:0046685
AF-X8F164-F1-model_v4 deleted 0.9776 22 114
AF-A0A7V1K3J3-F1-model_v4 Arsenate reductase (Glutaredoxin) (EC 1.20.4.1) 0.9763 1 90 GO:0008794

Feature Viewer

pLDDT pTM Quality
90.88 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map