F474973

General Info

Members Datasets Scaffolds Average Seq Length
683 351 1366 262

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10479361|Ga0163163_104793611
Length 285
Sequence VSPSGREPLSRXXLNHGALAASVRAGMPLLGTFIGGASPVAAEVCAAAGVDWVLLDLEHGTGGEEQVRDVVPAAASYGVPTVVRVESAARIRMGRVLDTGAAGIMLPRMNTAEEVAEAVRHLRYPPDGDRGVATYNRACRFGLDPGALDRANAEVLGVVQIESAIAVGNAGAIAALDGVDVLFVGPRDLSHDLGVPGDLTAPAFTEALERVLAAGRQHGKACGLLVNDGAAAARRLEQGWSFVGIGSDSTLLAAAVTAEFGRARSVFKNLGGSEGSSHPESTEPQ

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
206 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
207 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
208 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
209 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
210 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
339 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
340 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
346 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
347 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
348 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
349 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
350 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
351 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.15
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 5.12
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10479361 3300014325 Bacteria 1305
2 LJQas_1000669 3300000549 Bacteria 5515
3 JGI25406J46586_10001032 3300003203 Bacteria 13007
4 JGI25406J46586_10007102 3300003203 Bacteria 5130
5 JGI25407J50210_10002425 3300003373 Bacteria 4382
6 JGI25407J50210_10040058 3300003373 Bacteria 1201
7 Ga0070690_100035989 3300005330 Bacteria 3109
8 Ga0068869_100035928 3300005334 Bacteria 3515
9 Ga0070666_10145206 3300005335 Bacteria 1654
10 Ga0070682_100061414 3300005337 Bacteria 2378
11 Ga0070682_100128185 3300005337 Bacteria 1714
12 Ga0068868_100238126 3300005338 Bacteria 1528
13 Ga0068868_100239033 3300005338 Bacteria 1525
14 Ga0070660_100091995 3300005339 Bacteria 2393
15 Ga0070689_100337795 3300005340 Bacteria 1261
16 Ga0070691_10031031 3300005341 Bacteria 2505
17 Ga0070687_100077841 3300005343 Bacteria 1801
18 Ga0070668_100013509 3300005347 Bacteria 6095
19 Ga0070668_100037876 3300005347 Bacteria 3684
20 Ga0070668_100292161 3300005347 Bacteria 1364
21 Ga0070671_100362642 3300005355 Unclassified 1237
22 Ga0070674_100422722 3300005356 Unclassified 1094
23 Ga0070673_100058589 3300005364 Bacteria 3045
24 Ga0070688_100280503 3300005365 Bacteria 1197
25 Ga0070659_100031995 3300005366 Bacteria 4077
26 Ga0070667_100141732 3300005367 Bacteria 2105
27 Ga0070709_10154904 3300005434 Bacteria 1587
28 Ga0070714_100071786 3300005435 Bacteria 2995
29 Ga0070714_100207547 3300005435 Bacteria 1794
30 Ga0070714_100316955 3300005435 Bacteria 1457
31 Ga0070713_100065570 3300005436 Bacteria 3051
32 Ga0070713_100466043 3300005436 Bacteria 1188
33 Ga0070713_100608531 3300005436 Bacteria 1038
34 Ga0070710_10138559 3300005437 Bacteria 1490
35 Ga0070710_10266857 3300005437 Bacteria 1105
36 Ga0070701_10103457 3300005438 Bacteria 1581
37 Ga0070701_10364010 3300005438 Bacteria 907
38 Ga0070711_100111641 3300005439 Bacteria 2007
39 Ga0070700_100023386 3300005441 Bacteria 3613
40 Ga0070700_100043777 3300005441 Bacteria 2755
41 Ga0070700_100083414 3300005441 Bacteria 2069
42 Ga0070694_100056755 3300005444 Bacteria 2660
43 Ga0070708_100283825 3300005445 Bacteria 1558
44 Ga0070663_100025585 3300005455 Bacteria 3986
45 Ga0070678_100220984 3300005456 Bacteria 1574
46 Ga0070662_100026801 3300005457 Bacteria 3994
47 Ga0070662_100196592 3300005457 Unclassified 1598
48 Ga0070681_10092822 3300005458 Bacteria 2967
49 Ga0070706_100344530 3300005467 Bacteria 1389
50 Ga0070707_100114947 3300005468 Bacteria 2611
51 Ga0070707_100161352 3300005468 Bacteria 2184
52 Ga0070707_100645030 3300005468 Bacteria 1021
53 Ga0070698_100047558 3300005471 Bacteria 4385
54 Ga0070698_100193307 3300005471 Bacteria 1972
55 Ga0070699_100012113 3300005518 Bacteria 7442
56 Ga0070699_100177128 3300005518 Bacteria 1891
57 Ga0070684_100201499 3300005535 Bacteria 1813
58 Ga0070684_100370029 3300005535 Bacteria 1319
59 Ga0070697_100010563 3300005536 Bacteria 7210
60 Ga0070697_100726828 3300005536 Bacteria 877
61 Ga0068853_100033114 3300005539 Bacteria 4383
62 Ga0068853_100048878 3300005539 Bacteria 3634
63 Ga0070672_100207519 3300005543 Bacteria 1640
64 Ga0070696_100081218 3300005546 Bacteria 2296
65 Ga0070664_100155808 3300005564 Bacteria 2018
66 Ga0068857_100065263 3300005577 Bacteria 3236
67 Ga0068854_100112529 3300005578 Bacteria 2055
68 Ga0068856_100007395 3300005614 Bacteria 10717
69 Ga0068856_100300295 3300005614 Bacteria 1623
70 Ga0070702_100290376 3300005615 Bacteria 1127
71 Ga0068852_100006479 3300005616 Bacteria 8460
72 Ga0068852_100591598 3300005616 Bacteria 1113
73 Ga0068859_100066085 3300005617 Bacteria 3651
74 Ga0068866_10167229 3300005718 Bacteria 1288
75 Ga0068866_10174943 3300005718 Unclassified 1263
76 Ga0068861_100009186 3300005719 Bacteria 6819
77 Ga0068863_100053928 3300005841 Bacteria 3810
78 Ga0068858_100086324 3300005842 Bacteria 2919
79 Ga0068860_100583817 3300005843 Bacteria 1122
80 Ga0081455_10004095 3300005937 Bacteria 16504
81 Ga0081455_10006596 3300005937 Bacteria 12416
82 Ga0081538_10002135 3300005981 Bacteria 19694
83 Ga0081538_10007542 3300005981 Bacteria 9397
84 Ga0081538_10012601 3300005981 Bacteria 6771
85 Ga0081538_10058219 3300005981 Bacteria 2244
86 Ga0081540_1000154 3300005983 Bacteria 70679
87 Ga0081540_1002887 3300005983 Bacteria 13867
88 Ga0081539_10000218 3300005985 Bacteria 134538
89 Ga0081539_10001911 3300005985 Bacteria 32260
90 Ga0081539_10002667 3300005985 Bacteria 24286
91 Ga0081539_10002849 3300005985 Bacteria 23016
92 Ga0081539_10004245 3300005985 Bacteria 16093
93 Ga0081539_10005602 3300005985 Bacteria 12656
94 Ga0081539_10018816 3300005985 Bacteria 4763
95 Ga0081539_10039094 3300005985 Bacteria 2804
96 Ga0081539_10044977 3300005985 Bacteria 2544
97 Ga0070717_10008463 3300006028 Bacteria 7687
98 Ga0070717_10053601 3300006028 Bacteria 3325
99 Ga0070717_10179346 3300006028 Bacteria 1845
100 Ga0075365_10040705 3300006038 Bacteria 3032
101 Ga0075432_10000045 3300006058 Bacteria 24003
102 Ga0075432_10009348 3300006058 Bacteria 3337
103 Ga0070715_10038321 3300006163 Bacteria 1989
104 Ga0070716_100079440 3300006173 Bacteria 1953
105 Ga0070712_100014170 3300006175 Bacteria 5116
106 Ga0070712_100105434 3300006175 Bacteria 2093
107 Ga0097621_100138607 3300006237 Bacteria 2077
108 Ga0097621_100592392 3300006237 Unclassified 1013
109 Ga0068871_100327514 3300006358 Bacteria 1350
110 Ga0075428_100002335 3300006844 Bacteria 20588
111 Ga0075428_100003159 3300006844 Bacteria 17990
112 Ga0075428_100130111 3300006844 Bacteria 2738
113 Ga0075428_100271450 3300006844 Bacteria 1825
114 Ga0075428_100341910 3300006844 Bacteria 1606
115 Ga0075428_100433293 3300006844 Bacteria 1409
116 Ga0075430_100003041 3300006846 Bacteria 14023
117 Ga0075430_100036206 3300006846 Bacteria 4185
118 Ga0075430_100061549 3300006846 Bacteria 3154
119 Ga0075430_100253181 3300006846 Bacteria 1459
120 Ga0075431_100010904 3300006847 Bacteria 9143
121 Ga0075431_100016508 3300006847 Bacteria 7494
122 Ga0075433_10002663 3300006852 Bacteria 13631
123 Ga0075433_10003081 3300006852 Bacteria 12813
124 Ga0075433_10032960 3300006852 Bacteria 4439
125 Ga0075434_100003526 3300006871 Bacteria 13968
126 Ga0075434_100004620 3300006871 Bacteria 12440
127 Ga0075434_100307505 3300006871 Bacteria 1605
128 Ga0068865_100322100 3300006881 Unclassified 1244
129 Ga0068865_100514917 3300006881 Unclassified 1000
130 Ga0075436_100002297 3300006914 Bacteria 13188
131 Ga0097620_100066083 3300006931 Bacteria 3651
132 Ga0075435_100003949 3300007076 Bacteria 10134
133 Ga0075435_100007846 3300007076 Bacteria 7638
134 Ga0075435_100127878 3300007076 Bacteria 2124
135 Ga0105240_10375301 3300009093 Bacteria 1607
136 Ga0111539_10001067 3300009094 Bacteria 36168
137 Ga0111539_10003808 3300009094 Bacteria 19849
138 Ga0111539_10016171 3300009094 Bacteria 9256
139 Ga0111539_10103913 3300009094 Bacteria 3334
140 Ga0111539_10305314 3300009094 Bacteria 1852
141 Ga0105245_10019373 3300009098 Bacteria 5959
142 Ga0105245_10095581 3300009098 Bacteria 2741
143 Ga0105245_10169140 3300009098 Bacteria 2080
144 Ga0105247_10110892 3300009101 Bacteria 1766
145 Ga0114129_10003514 3300009147 Bacteria 22049
146 Ga0114129_10027115 3300009147 Bacteria 8111
147 Ga0114129_10093503 3300009147 Bacteria 4165
148 Ga0114129_10123667 3300009147 Bacteria 3558
149 Ga0114129_10242147 3300009147 Bacteria 2424
150 Ga0114129_10269273 3300009147 Bacteria 2280
151 Ga0105243_10008440 3300009148 Bacteria 7909
152 Ga0105243_10014918 3300009148 Bacteria 5881
153 Ga0105243_10448288 3300009148 Bacteria 1210
154 Ga0105241_10098947 3300009174 Bacteria 2315
155 Ga0105242_10419136 3300009176 Bacteria 1254
156 Ga0105242_11448054 3300009176 Unclassified 716
157 Ga0105249_10014013 3300009553 Bacteria 7087
158 Ga0105249_10019673 3300009553 Bacteria 6026
159 Ga0105249_10167625 3300009553 Bacteria 2127
160 Ga0105239_10298981 3300010375 Bacteria 1812
161 Ga0105239_10490245 3300010375 Bacteria 1397
162 Ga0157342_1001404 3300012507 Unclassified 1774
163 Ga0157370_10297614 3300013104 Bacteria 1490
164 Ga0157374_10029944 3300013296 Bacteria 4938
165 Ga0157378_10496176 3300013297 Bacteria 1219
166 Ga0163162_10047834 3300013306 Bacteria 4285
167 Ga0163162_10590782 3300013306 Bacteria 1237
168 Ga0157372_10186105 3300013307 Bacteria 2405
169 Ga0157372_10703329 3300013307 Bacteria 1176
170 Ga0157375_10180599 3300013308 Bacteria 2261
171 Ga0157375_11255894 3300013308 Bacteria 870
172 Ga0163163_10246147 3300014325 Bacteria 1838
173 Ga0157380_10014939 3300014326 Bacteria 5693
174 Ga0157380_10351512 3300014326 Bacteria 1379
175 Ga0157380_10369816 3300014326 Unclassified 1349
176 Ga0157377_10066103 3300014745 Bacteria 2078
177 Ga0157377_10102590 3300014745 Bacteria 1707
178 Ga0157377_10444276 3300014745 Unclassified 894
179 Ga0224712_10074915 3300022467 Bacteria 1383
180 Ga0228598_1011066 3300024227 Bacteria 1797
181 Ga0207426_1018725 3300025302 Bacteria 2435
182 Ga0207656_10061811 3300025321 Bacteria 1645
183 Ga0207653_10013330 3300025885 Bacteria 2573
184 Ga0207692_10011022 3300025898 Bacteria 3827
185 Ga0207692_10177011 3300025898 Bacteria 1240
186 Ga0207642_10054343 3300025899 Bacteria 1826
187 Ga0207642_10176630 3300025899 Bacteria 1160
188 Ga0207710_10117261 3300025900 Bacteria 1269
189 Ga0207688_10079592 3300025901 Bacteria 1869
190 Ga0207688_10107225 3300025901 Bacteria 1619
191 Ga0207688_10164594 3300025901 Unclassified 1316
192 Ga0207647_10148829 3300025904 Bacteria 1369
193 Ga0207699_10085724 3300025906 Bacteria 1965
194 Ga0207699_10217506 3300025906 Bacteria 1302
195 Ga0207699_10274080 3300025906 Bacteria 1170
196 Ga0207643_10061698 3300025908 Bacteria 2141
197 Ga0207684_10024381 3300025910 Bacteria 5158
198 Ga0207707_10435844 3300025912 Bacteria 1122
199 Ga0207693_10058607 3300025915 Bacteria 3017
200 Ga0207693_10150575 3300025915 Bacteria 1830
201 Ga0207693_10200729 3300025915 Bacteria 1568
202 Ga0207663_10025091 3300025916 Bacteria 3441
203 Ga0207662_10012372 3300025918 Bacteria 4750
204 Ga0207657_10009240 3300025919 Bacteria 9935
205 Ga0207649_10177689 3300025920 Bacteria 1488
206 Ga0207646_10004738 3300025922 Bacteria 14651
207 Ga0207646_10181441 3300025922 Bacteria 1901
208 Ga0207659_10021286 3300025926 Bacteria 4302
209 Ga0207687_10209737 3300025927 Bacteria 1528
210 Ga0207687_10606913 3300025927 Unclassified 923
211 Ga0207700_10009016 3300025928 Bacteria 6211
212 Ga0207700_10143904 3300025928 Bacteria 1962
213 Ga0207700_10225063 3300025928 Bacteria 1592
214 Ga0207664_10114958 3300025929 Bacteria 2243
215 Ga0207664_10268362 3300025929 Bacteria 1494
216 Ga0207706_10011889 3300025933 Bacteria 7924
217 Ga0207706_10035261 3300025933 Bacteria 4449
218 Ga0207706_10036604 3300025933 Bacteria 4359
219 Ga0207706_10059448 3300025933 Bacteria 3365
220 Ga0207709_10088535 3300025935 Bacteria 2016
221 Ga0207670_10037859 3300025936 Bacteria 3146
222 Ga0207670_10328506 3300025936 Bacteria 1205
223 Ga0207669_10104890 3300025937 Bacteria 1879
224 Ga0207669_10174569 3300025937 Bacteria 1534
225 Ga0207704_10091043 3300025938 Bacteria 2003
226 Ga0207704_10250775 3300025938 Bacteria 1329
227 Ga0207665_10085855 3300025939 Bacteria 2173
228 Ga0207691_10212918 3300025940 Bacteria 1678
229 Ga0207689_10002720 3300025942 Bacteria 16354
230 Ga0207667_10088012 3300025949 Bacteria 3212
231 Ga0207651_10368799 3300025960 Bacteria 1214
232 Ga0207712_10118719 3300025961 Bacteria 1997
233 Ga0207712_10291365 3300025961 Unclassified 1336
234 Ga0207668_10366192 3300025972 Bacteria 1209
235 Ga0207668_10511446 3300025972 Bacteria 1035
236 Ga0207640_10348433 3300025981 Bacteria 1189
237 Ga0207640_10502000 3300025981 Bacteria 1010
238 Ga0207677_10024642 3300026023 Bacteria 3741
239 Ga0207677_10181291 3300026023 Bacteria 1657
240 Ga0207678_10004460 3300026067 Bacteria 12589
241 Ga0207678_10525724 3300026067 Bacteria 1033
242 Ga0207708_10012985 3300026075 Bacteria 6211
243 Ga0207708_10073519 3300026075 Bacteria 2620
244 Ga0207708_10322665 3300026075 Bacteria 1261
245 Ga0207702_10010288 3300026078 Bacteria 7837
246 Ga0207702_10393927 3300026078 Bacteria 1334
247 Ga0207641_10090754 3300026088 Bacteria 2672
248 Ga0207648_10208070 3300026089 Bacteria 1736
249 Ga0207648_10473024 3300026089 Bacteria 1144
250 Ga0207676_10436251 3300026095 Bacteria 1232
251 Ga0207676_10460677 3300026095 Bacteria 1200
252 Ga0207674_10088495 3300026116 Bacteria 3090
253 Ga0207675_100007540 3300026118 Bacteria 10280
254 Ga0207675_100014050 3300026118 Bacteria 7467
255 Ga0207683_10335267 3300026121 Bacteria 1386
256 Ga0207698_10040400 3300026142 Bacteria 3466
257 Ga0207428_10000611 3300027907 Bacteria 42183
258 Ga0207428_10000880 3300027907 Bacteria 33718
259 Ga0207428_10005647 3300027907 Bacteria 11630
260 Ga0207428_10045962 3300027907 Bacteria 3513
261 Ga0268266_10174811 3300028379 Bacteria 1951
262 Ga0268266_10681320 3300028379 Archaea 990
263 Ga0268265_10054714 3300028380 Bacteria 3030
264 Ga0307517_10044792 3300028786 Bacteria 4669
265 Ga0307515_10004563 3300028794 Bacteria 28542
266 Ga0307515_10193611 3300028794 Bacteria 1934
267 Ga0307511_10000237 3300030521 Bacteria 56458
268 Ga0307511_10005998 3300030521 Bacteria 12268
269 Ga0307511_10153296 3300030521 Bacteria 1316
270 Ga0307512_10004917 3300030522 Bacteria 14269
271 Ga0307512_10037680 3300030522 Bacteria 4079
272 Ga0307512_10037792 3300030522 Bacteria 4072
273 Ga0307512_10048731 3300030522 Bacteria 3426
274 Ga0307513_10021453 3300031456 Bacteria 7624
275 Ga0307513_10070326 3300031456 Bacteria 3658
276 Ga0307509_10007456 3300031507 Bacteria 14284
277 Ga0307509_10013427 3300031507 Bacteria 9698
278 Ga0307509_10023524 3300031507 Bacteria 6914
279 Ga0307408_100016312 3300031548 Bacteria 4956
280 Ga0307408_100023540 3300031548 Bacteria 4197
281 Ga0307408_100048481 3300031548 Bacteria 3047
282 Ga0307408_100364594 3300031548 Bacteria 1230
283 Ga0307508_10009350 3300031616 Bacteria 9018
284 Ga0307508_10012562 3300031616 Bacteria 7745
285 Ga0307508_10026045 3300031616 Bacteria 5302
286 Ga0307508_10056769 3300031616 Bacteria 3465
287 Ga0307508_10134356 3300031616 Bacteria 2077
288 Ga0307508_10178546 3300031616 Bacteria 1726
289 Ga0307514_10011984 3300031649 Bacteria 7215
290 Ga0307514_10085181 3300031649 Bacteria 2323
291 Ga0307514_10158417 3300031649 Bacteria 1504
292 Ga0307516_10001112 3300031730 Bacteria 37452
293 Ga0307516_10030785 3300031730 Bacteria 5412
294 Ga0307516_10074427 3300031730 Bacteria 3252
295 Ga0307516_10165357 3300031730 Bacteria 1958
296 Ga0307405_10005418 3300031731 Bacteria 6154
297 Ga0307405_10012733 3300031731 Bacteria 4467
298 Ga0307405_10048369 3300031731 Bacteria 2622
299 Ga0307405_10059681 3300031731 Bacteria 2404
300 Ga0307405_10067714 3300031731 Bacteria 2282
301 Ga0307405_10084634 3300031731 Bacteria 2082
302 Ga0307405_10399832 3300031731 Bacteria 1075
303 Ga0307413_10014821 3300031824 Bacteria 3974
304 Ga0307413_10024388 3300031824 Bacteria 3297
305 Ga0307413_10047461 3300031824 Bacteria 2561
306 Ga0307413_10072252 3300031824 Bacteria 2177
307 Ga0307413_10163951 3300031824 Bacteria 1565
308 Ga0307518_10177825 3300031838 Bacteria 1442
309 Ga0307518_10181814 3300031838 Bacteria 1420
310 Ga0307410_10000513 3300031852 Bacteria 15726
311 Ga0307410_10002556 3300031852 Bacteria 8816
312 Ga0307410_10020897 3300031852 Bacteria 4016
313 Ga0307410_10082677 3300031852 Bacteria 2259
314 Ga0307410_10089999 3300031852 Bacteria 2176
315 Ga0307410_10107205 3300031852 Bacteria 2015
316 Ga0307410_10158858 3300031852 Bacteria 1691
317 Ga0307410_10319405 3300031852 Bacteria 1231
318 Ga0307406_10000219 3300031901 Bacteria 34661
319 Ga0307406_10000246 3300031901 Bacteria 32799
320 Ga0307406_10023805 3300031901 Bacteria 3649
321 Ga0307406_10084133 3300031901 Bacteria 2123
322 Ga0307406_10112690 3300031901 Bacteria 1876
323 Ga0307406_10117774 3300031901 Bacteria 1840
324 Ga0307406_10214597 3300031901 Bacteria 1426
325 Ga0307406_10419367 3300031901 Bacteria 1066
326 Ga0307407_10047251 3300031903 Bacteria 2441
327 Ga0307407_10054800 3300031903 Bacteria 2301
328 Ga0307407_10099685 3300031903 Bacteria 1800
329 Ga0307407_10102290 3300031903 Bacteria 1781
330 Ga0307407_10163410 3300031903 Unclassified 1459
331 Ga0307412_10017972 3300031911 Bacteria 4243
332 Ga0307412_10027348 3300031911 Bacteria 3555
333 Ga0307412_10428979 3300031911 Bacteria 1083
334 Ga0307409_100000284 3300031995 Bacteria 20526
335 Ga0307409_100000594 3300031995 Bacteria 15787
336 Ga0307409_100007963 3300031995 Bacteria 6384
337 Ga0307409_100024753 3300031995 Bacteria 4194
338 Ga0307409_100077489 3300031995 Bacteria 2670
339 Ga0307409_100111990 3300031995 Bacteria 2290
340 Ga0307409_100157078 3300031995 Bacteria 1983
341 Ga0307409_100393360 3300031995 Unclassified 1321
342 Ga0307416_100000283 3300032002 Bacteria 26909
343 Ga0307416_100000297 3300032002 Bacteria 25889
344 Ga0307416_100000548 3300032002 Bacteria 19144
345 Ga0307416_100025611 3300032002 Bacteria 4328
346 Ga0307416_100070207 3300032002 Bacteria 2903
347 Ga0307416_100088308 3300032002 Bacteria 2650
348 Ga0307416_100191708 3300032002 Bacteria 1928
349 Ga0307416_100233148 3300032002 Bacteria 1776
350 Ga0307416_100294815 3300032002 Bacteria 1608
351 Ga0307414_10003969 3300032004 Bacteria 7980
352 Ga0307414_10135032 3300032004 Bacteria 1922
353 Ga0307414_10135244 3300032004 Bacteria 1921
354 Ga0307414_10160661 3300032004 Bacteria 1784
355 Ga0307414_10340880 3300032004 Bacteria 1283
356 Ga0307411_10024619 3300032005 Bacteria 3591
357 Ga0307411_10084021 3300032005 Bacteria 2201
358 Ga0307411_10195177 3300032005 Bacteria 1549
359 Ga0307411_10308473 3300032005 Bacteria 1272
360 Ga0307411_10417008 3300032005 Bacteria 1114
361 Ga0307411_10419141 3300032005 Bacteria 1112
362 Ga0307411_10472722 3300032005 Bacteria 1054
363 Ga0307411_10490792 3300032005 Bacteria 1036
364 Ga0307415_100000587 3300032126 Bacteria 15854
365 Ga0307415_100000874 3300032126 Bacteria 13768
366 Ga0307415_100002706 3300032126 Bacteria 8852
367 Ga0307415_100005966 3300032126 Bacteria 6526
368 Ga0307415_100007495 3300032126 Bacteria 5972
369 Ga0307415_100008815 3300032126 Bacteria 5614
370 Ga0307415_100099280 3300032126 Bacteria 2130
371 Ga0307415_100145629 3300032126 Bacteria 1815
372 Ga0307415_100197644 3300032126 Bacteria 1592
373 Ga0307415_100452316 3300032126 Bacteria 1110
374 Ga0307507_10000009 3300033179 Bacteria 265992
375 Ga0307507_10015149 3300033179 Bacteria 9101
376 Ga0307510_10207029 3300033180 Bacteria 1488
377 Ga0373930_0008037 3300034816 Bacteria 1836
378 Ga0373926_0041530 3300035083 Bacteria 1643
379 Ga0373928_0011318 3300035084 Bacteria 1764
380 Ga0373934_0037796 3300035086 Bacteria 1900
381 Ga0373944_0030901 3300035089 Bacteria 1608
382 Ga0373949_0013044 3300035090 Bacteria 1842
383 Ga0373952_0025985 3300035092 Bacteria 1269
384 Ga0373923_0044444 3300035111 Bacteria 1841
385 Ga0373936_0003530 3300035113 Bacteria 5883
386 Ga0373936_0007835 3300035113 Bacteria 4012
387 Ga0373945_0003358 3300035116 Bacteria 5029
388 Ga0373953_0112009 3300035117 Bacteria 1154
389 Ga0373954_0027433 3300035118 Bacteria 2614
390 Ga0373954_0144199 3300035118 Bacteria 1162
391 Ga0373943_0003640 3300035170 Bacteria 7007
392 Ga0373946_0117769 3300035171 Bacteria 1209
393 Ga0373955_0054640 3300035172 Bacteria 2184
394 Ga0373955_0301435 3300035172 Bacteria 966
395 Ga0373924_0005147 3300035410 Bacteria 4615
396 Ga0373931_0094481 3300035691 Bacteria 1672
397 Ga0373935_0077383 3300035692 Bacteria 2156
398 Ga0373935_0131056 3300035692 Bacteria 1685
399 Ga0373933_0005397 3300035724 Bacteria 6954
400 Ga0373933_0012820 3300035724 Bacteria 4635
401 Ga0373937_0053178 3300036401 Bacteria 3714
402 Ga0373937_0210556 3300036401 Bacteria 1829
403 Ga0373925_0000008 3300037068 Bacteria 249158
404 Ga0373925_0015562 3300037068 Bacteria 5503
405 Ga0373925_0511073 3300037068 Bacteria 986
406 Ga0395900_0017408 3300037418 Bacteria 7335
407 Ga0395900_0095811 3300037418 Bacteria 3049
408 Ga0395898_0008936 3300037466 Bacteria 10553
409 Ga0395898_0042189 3300037466 Bacteria 4503
410 Ga0395898_0360284 3300037466 Bacteria 1387
411 Ga0395905_0007686 3300037471 Bacteria 10699
412 Ga0395905_0277038 3300037471 Bacteria 1563
413 Ga0436364_0110013 3300037853 Bacteria 1045
414 Ga0436364_0164275 3300037853 Bacteria 26469
415 Ga0436364_0445581 3300037853 Bacteria 3880
416 Ga0395901_0029874 3300038443 Bacteria 5613
417 Ga0395901_0066056 3300038443 Bacteria 3768
418 Ga0395901_0097214 3300038443 Bacteria 3086
419 Ga0395901_0110797 3300038443 Bacteria 2882
420 Ga0395901_0241643 3300038443 Bacteria 1883
421 Ga0436363_1627078 3300039450 Bacteria 2112
422 Ga0436363_1698184 3300039450 Bacteria 1820
423 Ga0451791_1553832 3300041451 Bacteria 903
424 Ga0451793_0912116 3300041452 Bacteria 12160
425 Ga0451797_1415853 3300041453 Bacteria 6391
426 Ga0451795_0934173 3300041456 Bacteria 1690
427 Ga0451802_1754627 3300041460 Bacteria 3130
428 Ga0451841_0112729 3300041498 Bacteria 2059
429 Ga0439448_0018638 3300042005 Bacteria 2130
430 Ga0439448_0022913 3300042005 Bacteria 1944
431 Ga0439448_0111741 3300042005 Bacteria 934
432 Ga0439450_003265 3300042008 Bacteria 2660
433 Ga0439451_012608 3300042009 Bacteria 1706
434 Ga0439454_001895 3300042011 Bacteria 2104
435 Ga0439454_002891 3300042011 Bacteria 1861
436 Ga0439463_004167 3300042016 Bacteria 3626
437 Ga0439463_011932 3300042016 Bacteria 2135
438 Ga0439463_023095 3300042016 Bacteria 1557
439 Ga0450914_000403 3300042118 Bacteria 1966
440 Ga0450902_003636 3300042137 Bacteria 2261
441 Ga0450904_002943 3300042139 Bacteria 1919
442 Ga0450905_000414 3300042142 Bacteria 5205
443 Ga0450889_005862 3300042144 Bacteria 1229
444 Ga0439435_0035632 3300042436 Bacteria 1373
445 Ga0439444_0003012 3300042437 Bacteria 2349
446 Ga0439444_0012253 3300042437 Bacteria 1403
447 Ga0439459_0020470 3300042438 Bacteria 1263
448 Ga0439464_0007363 3300042439 Bacteria 2879
449 Ga0439460_0005099 3300042461 Bacteria 3213
450 Ga0439460_0082040 3300042461 Bacteria 1013
451 Ga0450916_014442 3300042530 Bacteria 1028
452 Ga0451577_0385704 3300042876 Bacteria 1272
453 Ga0439440_0000230 3300042993 Bacteria 8888
454 Ga0439440_0055955 3300042993 Bacteria 996
455 Ga0466959_0162220 3300045049 Bacteria 1571
456 Ga0466967_0099575 3300045976 Bacteria 2655
457 Ga0466967_0126674 3300045976 Bacteria 2366
458 Ga0495592_0001334 3300046454 Bacteria 17129
459 Ga0495629_0004291 3300046459 Bacteria 10687
460 Ga0495641_0008916 3300046461 Bacteria 6032
461 Ga0495651_0003412 3300046462 Bacteria 12184
462 Ga0495653_0001697 3300046463 Bacteria 17322
463 Ga0495653_0029415 3300046463 Bacteria 4385
464 Ga0495653_0075743 3300046463 Bacteria 2503
465 Ga0495580_0034543 3300046472 Bacteria 3640
466 Ga0495580_0034766 3300046472 Bacteria 3626
467 Ga0495582_0226905 3300046473 Unclassified 1069
468 Ga0495639_0004462 3300046475 Bacteria 5999
469 Ga0495662_0000025 3300046476 Bacteria 52709
470 Ga0495662_0008138 3300046476 Bacteria 5164
471 Ga0495664_0009489 3300046477 Bacteria 5446
472 Ga0495664_0148770 3300046477 Bacteria 1420
473 Ga0495584_0096378 3300046491 Bacteria 1494
474 Ga0495594_0004029 3300046499 Bacteria 7557
475 Ga0495607_0116665 3300046501 Bacteria 1408
476 Ga0495583_0115186 3300046506 Bacteria 1136
477 Ga0495608_0034420 3300046511 Bacteria 3419
478 Ga0495608_0107867 3300046511 Bacteria 1791
479 Ga0495618_0096814 3300046514 Bacteria 1887
480 Ga0495628_0000966 3300046516 Bacteria 26291
481 Ga0495630_0002439 3300046517 Bacteria 12865
482 Ga0495632_0057564 3300046519 Bacteria 1897
483 Ga0495644_0092628 3300046523 Bacteria 1141
484 Ga0495666_0003296 3300046526 Bacteria 8153
485 Ga0495652_0005150 3300046529 Bacteria 12353
486 Ga0495665_0007189 3300046531 Bacteria 6009
487 Ga0495640_0010230 3300046533 Bacteria 7259
488 Ga0495640_0088035 3300046533 Bacteria 2053
489 Ga0495640_0266326 3300046533 Bacteria 1069
490 Ga0495586_0049902 3300046535 Bacteria 2263
491 Ga0495587_0002076 3300046536 Bacteria 13384
492 Ga0495587_0071854 3300046536 Bacteria 2012
493 Ga0495645_0009991 3300046543 Bacteria 6643
494 Ga0495645_0272062 3300046543 Bacteria 1118
495 Ga0495645_0443617 3300046543 Bacteria 820
496 Ga0495667_0002512 3300046559 Bacteria 12249
497 Ga0495667_0004235 3300046559 Bacteria 9667
498 Ga0495667_0062494 3300046559 Bacteria 2440
499 Ga0495656_0097675 3300046615 Bacteria 1353
500 Ga0495634_0013796 3300046642 Bacteria 5835
501 Ga0495634_0032480 3300046642 Bacteria 3590
502 Ga0495625_0018243 3300046660 Bacteria 5484
503 Ga0495635_0002350 3300046663 Bacteria 12865
504 Ga0495635_0014980 3300046663 Bacteria 5423
505 Ga0495635_0018685 3300046663 Bacteria 4835
506 Ga0495588_0100168 3300046674 Bacteria 1522
507 Ga0495657_0012385 3300046675 Bacteria 6337
508 Ga0495657_0046594 3300046675 Bacteria 2934
509 Ga0495599_0001787 3300046678 Bacteria 12469
510 Ga0495623_0001983 3300046679 Bacteria 13741
511 Ga0495646_0000216 3300046680 Bacteria 28707
512 Ga0495647_0008079 3300046681 Bacteria 3536
513 Ga0495658_0007897 3300046683 Bacteria 5267
514 Ga0495658_0230543 3300046683 Bacteria 1161
515 Ga0495613_0013770 3300046689 Bacteria 5999
516 Ga0495624_0004115 3300046690 Bacteria 10701
517 Ga0495600_0001459 3300046809 Bacteria 13113
518 Ga0495600_0004199 3300046809 Bacteria 8597
519 Ga0495581_0037580 3300047315 Bacteria 2802
520 Ga0495581_0043592 3300047315 Bacteria 2595
521 Ga0495604_0000053 3300047317 Bacteria 101884
522 Ga0495604_0038888 3300047317 Bacteria 3742
523 Ga0495604_0216627 3300047317 Bacteria 1320
524 Ga0495636_0005916 3300047318 Bacteria 4800
525 Ga0495636_0020753 3300047318 Bacteria 2649
526 Ga0495674_0132517 3300047319 Bacteria 2099
527 Ga0495676_0028215 3300047321 Bacteria 4798
528 Ga0495680_0011863 3300047322 Bacteria 7691
529 Ga0495687_002523 3300047443 Bacteria 14532
530 Ga0495687_002959 3300047443 Bacteria 12866
531 Ga0495687_005241 3300047443 Bacteria 8335
532 Ga0495687_006141 3300047443 Bacteria 7445
533 Ga0495675_0002009 3300047444 Bacteria 12156
534 Ga0495675_0004730 3300047444 Bacteria 8265
535 Ga0495677_0023211 3300047445 Bacteria 2252
536 Ga0495684_0003200 3300047471 Bacteria 12838
537 Ga0495684_0108216 3300047471 Bacteria 2099
538 Ga0495593_0013202 3300047673 Bacteria 4715
539 Ga0495602_0003649 3300048088 Bacteria 15946
540 Ga0495602_0052477 3300048088 Bacteria 3621
541 Ga0495602_0072717 3300048088 Bacteria 2930
542 Ga0495614_0019291 3300048089 Bacteria 2951
543 Ga0496100_0013302 3300048903 Bacteria 4742
544 Ga0496100_0044803 3300048903 Bacteria 2836
545 Ga0496101_0455446 3300048904 Bacteria 1009
546 Ga0496102_0051538 3300048905 Bacteria 3749
547 Ga0496102_0111258 3300048905 Bacteria 2553
548 Ga0496102_0320521 3300048905 Bacteria 1460
549 Ga0496103_0070510 3300048906 Bacteria 2186
550 Ga0496104_0028038 3300048907 Bacteria 5216
551 Ga0496104_0300180 3300048907 Bacteria 1518
552 Ga0496106_0089992 3300048909 Bacteria 2368
553 Ga0496107_0442558 3300048910 Bacteria 966
554 Ga0496108_0024917 3300048911 Bacteria 4927
555 Ga0496109_0001547 3300048912 Bacteria 19137
556 Ga0496109_0066390 3300048912 Bacteria 3303
557 Ga0496109_0075024 3300048912 Bacteria 3109
558 Ga0496109_0304255 3300048912 Bacteria 1504
559 Ga0496109_0418406 3300048912 Bacteria 1266
560 Ga0496109_0556694 3300048912 Bacteria 1082
561 Ga0496110_0055246 3300048913 Bacteria 3494
562 Ga0496110_0056424 3300048913 Bacteria 3456
563 Ga0496110_0374520 3300048913 Bacteria 1297
564 Ga0496111_0002874 3300048914 Bacteria 10514
565 Ga0496112_0399171 3300048915 Unclassified 1315
566 Ga0496113_0006517 3300048916 Bacteria 7409
567 Ga0496113_0030633 3300048916 Bacteria 3896
568 Ga0496113_0116827 3300048916 Bacteria 2082
569 Ga0496113_0220761 3300048916 Bacteria 1510
570 Ga0496114_0043854 3300048917 Bacteria 3709
571 Ga0496114_0279531 3300048917 Bacteria 1472
572 Ga0496115_0048632 3300048918 Bacteria 3392
573 Ga0501031_0001112 3300049568 Bacteria 16411
574 Ga0501031_0024175 3300049568 Bacteria 3960
575 Ga0501032_0076477 3300049569 Bacteria 2229
576 Ga0501033_0003757 3300049570 Bacteria 12337
577 Ga0501036_0000605 3300049572 Bacteria 26042
578 Ga0501036_0136148 3300049572 Bacteria 2073
579 Ga0501038_0015080 3300049574 Bacteria 7035
580 Ga0501038_0037397 3300049574 Bacteria 4255
581 Ga0501038_0111820 3300049574 Bacteria 2262
582 Ga0501039_0002431 3300049575 Bacteria 13866
583 Ga0501040_0001359 3300049576 Bacteria 15441
584 Ga0501040_0005375 3300049576 Bacteria 8282
585 Ga0501040_0094299 3300049576 Bacteria 2082
586 Ga0501041_0007402 3300049577 Bacteria 6445
587 Ga0501041_0032880 3300049577 Bacteria 3135
588 Ga0501042_0016810 3300049578 Bacteria 5031
589 Ga0501042_0035470 3300049578 Bacteria 3538
590 Ga0501043_0275755 3300049579 Bacteria 1290
591 Ga0501046_0008556 3300049580 Bacteria 8905
592 Ga0501046_0023513 3300049580 Bacteria 5068
593 Ga0501046_0023971 3300049580 Bacteria 5011
594 Ga0501048_0000676 3300049582 Bacteria 24721
595 Ga0501048_0001120 3300049582 Bacteria 20116
596 Ga0501067_0000945 3300049583 Bacteria 15577
597 Ga0501068_0091332 3300049584 Bacteria 1879
598 Ga0501068_0364958 3300049584 Bacteria 929
599 Ga0501069_0011123 3300049585 Bacteria 4775
600 Ga0501070_0086818 3300049586 Bacteria 2590
601 Ga0501071_0012111 3300049587 Bacteria 5834
602 Ga0501071_0015866 3300049587 Bacteria 5173
603 Ga0501071_0146148 3300049587 Bacteria 1762
604 Ga0501072_0003532 3300049588 Bacteria 11768
605 Ga0501072_0011324 3300049588 Bacteria 6814
606 Ga0501072_0020304 3300049588 Bacteria 5146
607 Ga0501073_0027303 3300049589 Bacteria 4084
608 Ga0501074_0001773 3300049590 Bacteria 14750
609 Ga0501074_0032633 3300049590 Bacteria 3771
610 Ga0501075_0000334 3300049591 Bacteria 26612
611 Ga0501075_0002536 3300049591 Bacteria 12171
612 Ga0501075_0029876 3300049591 Bacteria 4032
613 Ga0501076_0001024 3300049592 Bacteria 18361
614 Ga0501076_0015368 3300049592 Bacteria 5784
615 Ga0501077_0000414 3300049593 Bacteria 25804
616 Ga0501079_0000087 3300049741 Bacteria 44447
617 Ga0501079_0005413 3300049741 Bacteria 9507
618 Ga0501080_0025748 3300049742 Bacteria 5464
619 Ga0501081_0011060 3300049743 Bacteria 5901
620 Ga0501081_0026821 3300049743 Bacteria 3887
621 Ga0501083_0064826 3300049744 Bacteria 2434
622 Ga0501035_0041843 3300049822 Bacteria 4135
623 Ga0501035_0502962 3300049822 Bacteria 997
624 Ga0501044_0011140 3300049823 Bacteria 9753
625 Ga0501044_0051310 3300049823 Bacteria 4254
626 Ga0501045_0000288 3300049824 Bacteria 29557
627 Ga0501045_0034453 3300049824 Bacteria 3675
628 Ga0501045_0080972 3300049824 Bacteria 2394
629 nmdc:mga0yw44_8709_c1 3300050492 Bacteria 5074
630 nmdc:mga05p37_30748_c2 3300050507 Bacteria 3729
631 nmdc:mga05p37_322920_c1 3300050507 Bacteria 1826
632 nmdc:mga05p37_4084_c1 3300050507 Bacteria 17065
633 nmdc:mga05p37_470908_c1 3300050507 Bacteria 1449
634 nmdc:mga05p37_75162_c1 3300050507 Bacteria 4159
635 nmdc:mga09592_15547_c1 3300050508 Bacteria 6221
636 nmdc:mga09592_353938_c1 3300050508 Bacteria 1271
637 nmdc:mga09592_69761_c1 3300050508 Bacteria 2982
638 nmdc:mga0qj67_108485_c1 3300050509 Bacteria 2240
639 nmdc:mga0qj67_22321_c1 3300050509 Bacteria 4863
640 nmdc:mga0qj67_8134_c1 3300050509 Bacteria 7767
641 nmdc:mga06r32_15364_c1 3300050510 Bacteria 6953
642 nmdc:mga06r32_19108_c1 3300050510 Bacteria 6286
643 nmdc:mga06r32_25618_c1 3300050510 Bacteria 5490
644 nmdc:mga06r32_311819_c1 3300050510 Bacteria 1559
645 nmdc:mga08y16_11499_c1 3300050511 Bacteria 9300
646 nmdc:mga08y16_23357_c1 3300050511 Bacteria 6532
647 nmdc:mga08y16_34879_c1 3300050511 Bacteria 5286
648 nmdc:mga08y16_655423_c1 3300050511 Bacteria 1053
649 nmdc:mga0n895_121597_c1 3300050512 Bacteria 2632
650 nmdc:mga0n895_22706_c1 3300050512 Bacteria 5885
651 nmdc:mga0n895_303335_c1 3300050512 Bacteria 1619
652 nmdc:mga0n895_47823_c1 3300050512 Bacteria 4184
653 nmdc:mga0rr50_4383_c1 3300050513 Bacteria 8292
654 nmdc:mga0rr50_839_c1 3300050513 Bacteria 16535
655 nmdc:mga0rr50_96343_c1 3300050513 Bacteria 2315
656 nmdc:mga08x19_7787_c1 3300050514 Bacteria 6364
657 nmdc:mga0a205_11828_c1 3300050515 Bacteria 8056
658 nmdc:mga0a205_171486_c1 3300050515 Bacteria 2066
659 nmdc:mga0a205_28237_c1 3300050515 Bacteria 5364
660 nmdc:mga0a205_6015_c1 3300050515 Bacteria 10945
661 Ga0495601_0132226 3300053077 Bacteria 1625
662 Ga0495612_0004310 3300053078 Bacteria 5902
663 Ga0495612_0142059 3300053078 Bacteria 1042
664 Ga0495595_0035313 3300053084 Bacteria 2265
665 Ga0495619_0010063 3300053085 Bacteria 5953
666 Ga0500644_0166488 3300053088 Bacteria 894
667 Ga0500560_006567 3300053107 Bacteria 2672
668 Ga0500652_050283 3300053131 Bacteria 1700
669 Ga0500577_0003501 3300053142 Bacteria 4079
670 Ga0500616_0000495 3300053153 Bacteria 50619
671 Ga0501084_0008790 3300054114 Bacteria 8356
672 Ga0590075_010900 3300059424 Bacteria 2192
673 Ga0501082_0000534 3300060353 Bacteria 33866
674 Ga0501082_0001113 3300060353 Bacteria 23760
675 Ga0501082_0046198 3300060353 Bacteria 3754
676 Ga0530510_0001795 3300061734 Bacteria 14636
677 Ga0530510_0002506 3300061734 Bacteria 12623
678 2616699458 2616644814 Bacteria 11555299
679 2819427573 2818991318 Bacteria 5266538
680 2870785607 2870782633 Bacteria 9624083
681 2995726372 2995726249 Bacteria 3470435
682 8055037593 8055034563 Bacteria 3562128
683 8055039846 8055037949 Bacteria 3337834
684 Ga0163163_10479361
685 LJQas_1000669
686 JGI25406J46586_10001032
687 JGI25406J46586_10007102
688 JGI25407J50210_10002425
689 JGI25407J50210_10040058
690 Ga0070690_100035989
691 Ga0068869_100035928
692 Ga0070666_10145206
693 Ga0070682_100061414
694 Ga0070682_100128185
695 Ga0068868_100238126
696 Ga0068868_100239033
697 Ga0070660_100091995
698 Ga0070689_100337795
699 Ga0070691_10031031
700 Ga0070687_100077841
701 Ga0070668_100013509
702 Ga0070668_100037876
703 Ga0070668_100292161
704 Ga0070671_100362642
705 Ga0070674_100422722
706 Ga0070673_100058589
707 Ga0070688_100280503
708 Ga0070659_100031995
709 Ga0070667_100141732
710 Ga0070709_10154904
711 Ga0070714_100071786
712 Ga0070714_100207547
713 Ga0070714_100316955
714 Ga0070713_100065570
715 Ga0070713_100466043
716 Ga0070713_100608531
717 Ga0070710_10138559
718 Ga0070710_10266857
719 Ga0070701_10103457
720 Ga0070701_10364010
721 Ga0070711_100111641
722 Ga0070700_100023386
723 Ga0070700_100043777
724 Ga0070700_100083414
725 Ga0070694_100056755
726 Ga0070708_100283825
727 Ga0070663_100025585
728 Ga0070678_100220984
729 Ga0070662_100026801
730 Ga0070662_100196592
731 Ga0070681_10092822
732 Ga0070706_100344530
733 Ga0070707_100114947
734 Ga0070707_100161352
735 Ga0070707_100645030
736 Ga0070698_100047558
737 Ga0070698_100193307
738 Ga0070699_100012113
739 Ga0070699_100177128
740 Ga0070684_100201499
741 Ga0070684_100370029
742 Ga0070697_100010563
743 Ga0070697_100726828
744 Ga0068853_100033114
745 Ga0068853_100048878
746 Ga0070672_100207519
747 Ga0070696_100081218
748 Ga0070664_100155808
749 Ga0068857_100065263
750 Ga0068854_100112529
751 Ga0068856_100007395
752 Ga0068856_100300295
753 Ga0070702_100290376
754 Ga0068852_100006479
755 Ga0068852_100591598
756 Ga0068859_100066085
757 Ga0068866_10167229
758 Ga0068866_10174943
759 Ga0068861_100009186
760 Ga0068863_100053928
761 Ga0068858_100086324
762 Ga0068860_100583817
763 Ga0081455_10004095
764 Ga0081455_10006596
765 Ga0081538_10002135
766 Ga0081538_10007542
767 Ga0081538_10012601
768 Ga0081538_10058219
769 Ga0081540_1000154
770 Ga0081540_1002887
771 Ga0081539_10000218
772 Ga0081539_10001911
773 Ga0081539_10002667
774 Ga0081539_10002849
775 Ga0081539_10004245
776 Ga0081539_10005602
777 Ga0081539_10018816
778 Ga0081539_10039094
779 Ga0081539_10044977
780 Ga0070717_10008463
781 Ga0070717_10053601
782 Ga0070717_10179346
783 Ga0075365_10040705
784 Ga0075432_10000045
785 Ga0075432_10009348
786 Ga0070715_10038321
787 Ga0070716_100079440
788 Ga0070712_100014170
789 Ga0070712_100105434
790 Ga0097621_100138607
791 Ga0097621_100592392
792 Ga0068871_100327514
793 Ga0075428_100002335
794 Ga0075428_100003159
795 Ga0075428_100130111
796 Ga0075428_100271450
797 Ga0075428_100341910
798 Ga0075428_100433293
799 Ga0075430_100003041
800 Ga0075430_100036206
801 Ga0075430_100061549
802 Ga0075430_100253181
803 Ga0075431_100010904
804 Ga0075431_100016508
805 Ga0075433_10002663
806 Ga0075433_10003081
807 Ga0075433_10032960
808 Ga0075434_100003526
809 Ga0075434_100004620
810 Ga0075434_100307505
811 Ga0068865_100322100
812 Ga0068865_100514917
813 Ga0075436_100002297
814 Ga0097620_100066083
815 Ga0075435_100003949
816 Ga0075435_100007846
817 Ga0075435_100127878
818 Ga0105240_10375301
819 Ga0111539_10001067
820 Ga0111539_10003808
821 Ga0111539_10016171
822 Ga0111539_10103913
823 Ga0111539_10305314
824 Ga0105245_10019373
825 Ga0105245_10095581
826 Ga0105245_10169140
827 Ga0105247_10110892
828 Ga0114129_10003514
829 Ga0114129_10027115
830 Ga0114129_10093503
831 Ga0114129_10123667
832 Ga0114129_10242147
833 Ga0114129_10269273
834 Ga0105243_10008440
835 Ga0105243_10014918
836 Ga0105243_10448288
837 Ga0105241_10098947
838 Ga0105242_10419136
839 Ga0105242_11448054
840 Ga0105249_10014013
841 Ga0105249_10019673
842 Ga0105249_10167625
843 Ga0105239_10298981
844 Ga0105239_10490245
845 Ga0157342_1001404
846 Ga0157370_10297614
847 Ga0157374_10029944
848 Ga0157378_10496176
849 Ga0163162_10047834
850 Ga0163162_10590782
851 Ga0157372_10186105
852 Ga0157372_10703329
853 Ga0157375_10180599
854 Ga0157375_11255894
855 Ga0163163_10246147
856 Ga0157380_10014939
857 Ga0157380_10351512
858 Ga0157380_10369816
859 Ga0157377_10066103
860 Ga0157377_10102590
861 Ga0157377_10444276
862 Ga0224712_10074915
863 Ga0228598_1011066
864 Ga0207426_1018725
865 Ga0207656_10061811
866 Ga0207653_10013330
867 Ga0207692_10011022
868 Ga0207692_10177011
869 Ga0207642_10054343
870 Ga0207642_10176630
871 Ga0207710_10117261
872 Ga0207688_10079592
873 Ga0207688_10107225
874 Ga0207688_10164594
875 Ga0207647_10148829
876 Ga0207699_10085724
877 Ga0207699_10217506
878 Ga0207699_10274080
879 Ga0207643_10061698
880 Ga0207684_10024381
881 Ga0207707_10435844
882 Ga0207693_10058607
883 Ga0207693_10150575
884 Ga0207693_10200729
885 Ga0207663_10025091
886 Ga0207662_10012372
887 Ga0207657_10009240
888 Ga0207649_10177689
889 Ga0207646_10004738
890 Ga0207646_10181441
891 Ga0207659_10021286
892 Ga0207687_10209737
893 Ga0207687_10606913
894 Ga0207700_10009016
895 Ga0207700_10143904
896 Ga0207700_10225063
897 Ga0207664_10114958
898 Ga0207664_10268362
899 Ga0207706_10011889
900 Ga0207706_10035261
901 Ga0207706_10036604
902 Ga0207706_10059448
903 Ga0207709_10088535
904 Ga0207670_10037859
905 Ga0207670_10328506
906 Ga0207669_10104890
907 Ga0207669_10174569
908 Ga0207704_10091043
909 Ga0207704_10250775
910 Ga0207665_10085855
911 Ga0207691_10212918
912 Ga0207689_10002720
913 Ga0207667_10088012
914 Ga0207651_10368799
915 Ga0207712_10118719
916 Ga0207712_10291365
917 Ga0207668_10366192
918 Ga0207668_10511446
919 Ga0207640_10348433
920 Ga0207640_10502000
921 Ga0207677_10024642
922 Ga0207677_10181291
923 Ga0207678_10004460
924 Ga0207678_10525724
925 Ga0207708_10012985
926 Ga0207708_10073519
927 Ga0207708_10322665
928 Ga0207702_10010288
929 Ga0207702_10393927
930 Ga0207641_10090754
931 Ga0207648_10208070
932 Ga0207648_10473024
933 Ga0207676_10436251
934 Ga0207676_10460677
935 Ga0207674_10088495
936 Ga0207675_100007540
937 Ga0207675_100014050
938 Ga0207683_10335267
939 Ga0207698_10040400
940 Ga0207428_10000611
941 Ga0207428_10000880
942 Ga0207428_10005647
943 Ga0207428_10045962
944 Ga0268266_10174811
945 Ga0268266_10681320
946 Ga0268265_10054714
947 Ga0307517_10044792
948 Ga0307515_10004563
949 Ga0307515_10193611
950 Ga0307511_10000237
951 Ga0307511_10005998
952 Ga0307511_10153296
953 Ga0307512_10004917
954 Ga0307512_10037680
955 Ga0307512_10037792
956 Ga0307512_10048731
957 Ga0307513_10021453
958 Ga0307513_10070326
959 Ga0307509_10007456
960 Ga0307509_10013427
961 Ga0307509_10023524
962 Ga0307408_100016312
963 Ga0307408_100023540
964 Ga0307408_100048481
965 Ga0307408_100364594
966 Ga0307508_10009350
967 Ga0307508_10012562
968 Ga0307508_10026045
969 Ga0307508_10056769
970 Ga0307508_10134356
971 Ga0307508_10178546
972 Ga0307514_10011984
973 Ga0307514_10085181
974 Ga0307514_10158417
975 Ga0307516_10001112
976 Ga0307516_10030785
977 Ga0307516_10074427
978 Ga0307516_10165357
979 Ga0307405_10005418
980 Ga0307405_10012733
981 Ga0307405_10048369
982 Ga0307405_10059681
983 Ga0307405_10067714
984 Ga0307405_10084634
985 Ga0307405_10399832
986 Ga0307413_10014821
987 Ga0307413_10024388
988 Ga0307413_10047461
989 Ga0307413_10072252
990 Ga0307413_10163951
991 Ga0307518_10177825
992 Ga0307518_10181814
993 Ga0307410_10000513
994 Ga0307410_10002556
995 Ga0307410_10020897
996 Ga0307410_10082677
997 Ga0307410_10089999
998 Ga0307410_10107205
999 Ga0307410_10158858
1000 Ga0307410_10319405
1001 Ga0307406_10000219
1002 Ga0307406_10000246
1003 Ga0307406_10023805
1004 Ga0307406_10084133
1005 Ga0307406_10112690
1006 Ga0307406_10117774
1007 Ga0307406_10214597
1008 Ga0307406_10419367
1009 Ga0307407_10047251
1010 Ga0307407_10054800
1011 Ga0307407_10099685
1012 Ga0307407_10102290
1013 Ga0307407_10163410
1014 Ga0307412_10017972
1015 Ga0307412_10027348
1016 Ga0307412_10428979
1017 Ga0307409_100000284
1018 Ga0307409_100000594
1019 Ga0307409_100007963
1020 Ga0307409_100024753
1021 Ga0307409_100077489
1022 Ga0307409_100111990
1023 Ga0307409_100157078
1024 Ga0307409_100393360
1025 Ga0307416_100000283
1026 Ga0307416_100000297
1027 Ga0307416_100000548
1028 Ga0307416_100025611
1029 Ga0307416_100070207
1030 Ga0307416_100088308
1031 Ga0307416_100191708
1032 Ga0307416_100233148
1033 Ga0307416_100294815
1034 Ga0307414_10003969
1035 Ga0307414_10135032
1036 Ga0307414_10135244
1037 Ga0307414_10160661
1038 Ga0307414_10340880
1039 Ga0307411_10024619
1040 Ga0307411_10084021
1041 Ga0307411_10195177
1042 Ga0307411_10308473
1043 Ga0307411_10417008
1044 Ga0307411_10419141
1045 Ga0307411_10472722
1046 Ga0307411_10490792
1047 Ga0307415_100000587
1048 Ga0307415_100000874
1049 Ga0307415_100002706
1050 Ga0307415_100005966
1051 Ga0307415_100007495
1052 Ga0307415_100008815
1053 Ga0307415_100099280
1054 Ga0307415_100145629
1055 Ga0307415_100197644
1056 Ga0307415_100452316
1057 Ga0307507_10000009
1058 Ga0307507_10015149
1059 Ga0307510_10207029
1060 Ga0373930_0008037
1061 Ga0373926_0041530
1062 Ga0373928_0011318
1063 Ga0373934_0037796
1064 Ga0373944_0030901
1065 Ga0373949_0013044
1066 Ga0373952_0025985
1067 Ga0373923_0044444
1068 Ga0373936_0003530
1069 Ga0373936_0007835
1070 Ga0373945_0003358
1071 Ga0373953_0112009
1072 Ga0373954_0027433
1073 Ga0373954_0144199
1074 Ga0373943_0003640
1075 Ga0373946_0117769
1076 Ga0373955_0054640
1077 Ga0373955_0301435
1078 Ga0373924_0005147
1079 Ga0373931_0094481
1080 Ga0373935_0077383
1081 Ga0373935_0131056
1082 Ga0373933_0005397
1083 Ga0373933_0012820
1084 Ga0373937_0053178
1085 Ga0373937_0210556
1086 Ga0373925_0000008
1087 Ga0373925_0015562
1088 Ga0373925_0511073
1089 Ga0395900_0017408
1090 Ga0395900_0095811
1091 Ga0395898_0008936
1092 Ga0395898_0042189
1093 Ga0395898_0360284
1094 Ga0395905_0007686
1095 Ga0395905_0277038
1096 Ga0436364_0110013
1097 Ga0436364_0164275
1098 Ga0436364_0445581
1099 Ga0395901_0029874
1100 Ga0395901_0066056
1101 Ga0395901_0097214
1102 Ga0395901_0110797
1103 Ga0395901_0241643
1104 Ga0436363_1627078
1105 Ga0436363_1698184
1106 Ga0451791_1553832
1107 Ga0451793_0912116
1108 Ga0451797_1415853
1109 Ga0451795_0934173
1110 Ga0451802_1754627
1111 Ga0451841_0112729
1112 Ga0439448_0018638
1113 Ga0439448_0022913
1114 Ga0439448_0111741
1115 Ga0439450_003265
1116 Ga0439451_012608
1117 Ga0439454_001895
1118 Ga0439454_002891
1119 Ga0439463_004167
1120 Ga0439463_011932
1121 Ga0439463_023095
1122 Ga0450914_000403
1123 Ga0450902_003636
1124 Ga0450904_002943
1125 Ga0450905_000414
1126 Ga0450889_005862
1127 Ga0439435_0035632
1128 Ga0439444_0003012
1129 Ga0439444_0012253
1130 Ga0439459_0020470
1131 Ga0439464_0007363
1132 Ga0439460_0005099
1133 Ga0439460_0082040
1134 Ga0450916_014442
1135 Ga0451577_0385704
1136 Ga0439440_0000230
1137 Ga0439440_0055955
1138 Ga0466959_0162220
1139 Ga0466967_0099575
1140 Ga0466967_0126674
1141 Ga0495592_0001334
1142 Ga0495629_0004291
1143 Ga0495641_0008916
1144 Ga0495651_0003412
1145 Ga0495653_0001697
1146 Ga0495653_0029415
1147 Ga0495653_0075743
1148 Ga0495580_0034543
1149 Ga0495580_0034766
1150 Ga0495582_0226905
1151 Ga0495639_0004462
1152 Ga0495662_0000025
1153 Ga0495662_0008138
1154 Ga0495664_0009489
1155 Ga0495664_0148770
1156 Ga0495584_0096378
1157 Ga0495594_0004029
1158 Ga0495607_0116665
1159 Ga0495583_0115186
1160 Ga0495608_0034420
1161 Ga0495608_0107867
1162 Ga0495618_0096814
1163 Ga0495628_0000966
1164 Ga0495630_0002439
1165 Ga0495632_0057564
1166 Ga0495644_0092628
1167 Ga0495666_0003296
1168 Ga0495652_0005150
1169 Ga0495665_0007189
1170 Ga0495640_0010230
1171 Ga0495640_0088035
1172 Ga0495640_0266326
1173 Ga0495586_0049902
1174 Ga0495587_0002076
1175 Ga0495587_0071854
1176 Ga0495645_0009991
1177 Ga0495645_0272062
1178 Ga0495645_0443617
1179 Ga0495667_0002512
1180 Ga0495667_0004235
1181 Ga0495667_0062494
1182 Ga0495656_0097675
1183 Ga0495634_0013796
1184 Ga0495634_0032480
1185 Ga0495625_0018243
1186 Ga0495635_0002350
1187 Ga0495635_0014980
1188 Ga0495635_0018685
1189 Ga0495588_0100168
1190 Ga0495657_0012385
1191 Ga0495657_0046594
1192 Ga0495599_0001787
1193 Ga0495623_0001983
1194 Ga0495646_0000216
1195 Ga0495647_0008079
1196 Ga0495658_0007897
1197 Ga0495658_0230543
1198 Ga0495613_0013770
1199 Ga0495624_0004115
1200 Ga0495600_0001459
1201 Ga0495600_0004199
1202 Ga0495581_0037580
1203 Ga0495581_0043592
1204 Ga0495604_0000053
1205 Ga0495604_0038888
1206 Ga0495604_0216627
1207 Ga0495636_0005916
1208 Ga0495636_0020753
1209 Ga0495674_0132517
1210 Ga0495676_0028215
1211 Ga0495680_0011863
1212 Ga0495687_002523
1213 Ga0495687_002959
1214 Ga0495687_005241
1215 Ga0495687_006141
1216 Ga0495675_0002009
1217 Ga0495675_0004730
1218 Ga0495677_0023211
1219 Ga0495684_0003200
1220 Ga0495684_0108216
1221 Ga0495593_0013202
1222 Ga0495602_0003649
1223 Ga0495602_0052477
1224 Ga0495602_0072717
1225 Ga0495614_0019291
1226 Ga0496100_0013302
1227 Ga0496100_0044803
1228 Ga0496101_0455446
1229 Ga0496102_0051538
1230 Ga0496102_0111258
1231 Ga0496102_0320521
1232 Ga0496103_0070510
1233 Ga0496104_0028038
1234 Ga0496104_0300180
1235 Ga0496106_0089992
1236 Ga0496107_0442558
1237 Ga0496108_0024917
1238 Ga0496109_0001547
1239 Ga0496109_0066390
1240 Ga0496109_0075024
1241 Ga0496109_0304255
1242 Ga0496109_0418406
1243 Ga0496109_0556694
1244 Ga0496110_0055246
1245 Ga0496110_0056424
1246 Ga0496110_0374520
1247 Ga0496111_0002874
1248 Ga0496112_0399171
1249 Ga0496113_0006517
1250 Ga0496113_0030633
1251 Ga0496113_0116827
1252 Ga0496113_0220761
1253 Ga0496114_0043854
1254 Ga0496114_0279531
1255 Ga0496115_0048632
1256 Ga0501031_0001112
1257 Ga0501031_0024175
1258 Ga0501032_0076477
1259 Ga0501033_0003757
1260 Ga0501036_0000605
1261 Ga0501036_0136148
1262 Ga0501038_0015080
1263 Ga0501038_0037397
1264 Ga0501038_0111820
1265 Ga0501039_0002431
1266 Ga0501040_0001359
1267 Ga0501040_0005375
1268 Ga0501040_0094299
1269 Ga0501041_0007402
1270 Ga0501041_0032880
1271 Ga0501042_0016810
1272 Ga0501042_0035470
1273 Ga0501043_0275755
1274 Ga0501046_0008556
1275 Ga0501046_0023513
1276 Ga0501046_0023971
1277 Ga0501048_0000676
1278 Ga0501048_0001120
1279 Ga0501067_0000945
1280 Ga0501068_0091332
1281 Ga0501068_0364958
1282 Ga0501069_0011123
1283 Ga0501070_0086818
1284 Ga0501071_0012111
1285 Ga0501071_0015866
1286 Ga0501071_0146148
1287 Ga0501072_0003532
1288 Ga0501072_0011324
1289 Ga0501072_0020304
1290 Ga0501073_0027303
1291 Ga0501074_0001773
1292 Ga0501074_0032633
1293 Ga0501075_0000334
1294 Ga0501075_0002536
1295 Ga0501075_0029876
1296 Ga0501076_0001024
1297 Ga0501076_0015368
1298 Ga0501077_0000414
1299 Ga0501079_0000087
1300 Ga0501079_0005413
1301 Ga0501080_0025748
1302 Ga0501081_0011060
1303 Ga0501081_0026821
1304 Ga0501083_0064826
1305 Ga0501035_0041843
1306 Ga0501035_0502962
1307 Ga0501044_0011140
1308 Ga0501044_0051310
1309 Ga0501045_0000288
1310 Ga0501045_0034453
1311 Ga0501045_0080972
1312 nmdc:mga0yw44_8709_c1
1313 nmdc:mga05p37_30748_c2
1314 nmdc:mga05p37_322920_c1
1315 nmdc:mga05p37_4084_c1
1316 nmdc:mga05p37_470908_c1
1317 nmdc:mga05p37_75162_c1
1318 nmdc:mga09592_15547_c1
1319 nmdc:mga09592_353938_c1
1320 nmdc:mga09592_69761_c1
1321 nmdc:mga0qj67_108485_c1
1322 nmdc:mga0qj67_22321_c1
1323 nmdc:mga0qj67_8134_c1
1324 nmdc:mga06r32_15364_c1
1325 nmdc:mga06r32_19108_c1
1326 nmdc:mga06r32_25618_c1
1327 nmdc:mga06r32_311819_c1
1328 nmdc:mga08y16_11499_c1
1329 nmdc:mga08y16_23357_c1
1330 nmdc:mga08y16_34879_c1
1331 nmdc:mga08y16_655423_c1
1332 nmdc:mga0n895_121597_c1
1333 nmdc:mga0n895_22706_c1
1334 nmdc:mga0n895_303335_c1
1335 nmdc:mga0n895_47823_c1
1336 nmdc:mga0rr50_4383_c1
1337 nmdc:mga0rr50_839_c1
1338 nmdc:mga0rr50_96343_c1
1339 nmdc:mga08x19_7787_c1
1340 nmdc:mga0a205_11828_c1
1341 nmdc:mga0a205_171486_c1
1342 nmdc:mga0a205_28237_c1
1343 nmdc:mga0a205_6015_c1
1344 Ga0495601_0132226
1345 Ga0495612_0004310
1346 Ga0495612_0142059
1347 Ga0495595_0035313
1348 Ga0495619_0010063
1349 Ga0500644_0166488
1350 Ga0500560_006567
1351 Ga0500652_050283
1352 Ga0500577_0003501
1353 Ga0500616_0000495
1354 Ga0501084_0008790
1355 Ga0590075_010900
1356 Ga0501082_0000534
1357 Ga0501082_0001113
1358 Ga0501082_0046198
1359 Ga0530510_0001795
1360 Ga0530510_0002506
1361 2616699458
1362 2819427573
1363 2870785607
1364 2995726372
1365 8055037593
1366 8055039846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

29

255

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mf4-assembly1.cif.gz_E crystal structure of a hpch/hpal aldolase/citrate lyase family protein from burkholderia cenocepacia j2315 0.9421 17 244
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9402 18 242
7et9-assembly1.cif.gz_A crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii 0.937 18 242
7nnk-assembly1.cif.gz_B crystal structure of s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 in complex with hydroxypyruvate 0.936 20 244
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.9349 18 242
ID Description Score Start End Superfamily
af_Q4DGT6_3_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9486 20 247 3.20.20.60
af_A0A1D6N2B9_1_126_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9442 20 102 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9437 18 244 3.20.20.60
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9368 17 244 3.20.20.60
4tv5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9244 18 247 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7Y3LPL0-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.974 18 244 GO:0005737
GO:0016832
AF-A0A3D3BMM4-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9649 20 240 GO:0005737
GO:0016832
AF-A0A7C4RBN0-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.9645 22 247 GO:0005737
GO:0016832
AF-A0A7Y3KXD1-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9632 17 242 GO:0005737
GO:0016832
AF-A0A537LBG7-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.9596 18 246 GO:0005737
GO:0016832

Map