F474963

General Info

Members Datasets Scaffolds Average Seq Length
683 242 1366 143

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100852914|Ga0070695_1008529141
Length 156
Sequence MQLRRLGYGSLMTAMEVGAEFGPSSWIDVPQEKIQAFADTTGDHNFIHVDPEMAAQTPFGGTVAHGYLTLSLLPQMSYEVLPHDDPGAGMALNYGLNKVRFPAPVPSGSRVRGSFVVAQVDEQEWGRQVTMTATIEREGGDKPVCVADVVYRYYRL

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.49
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100852914 3300005545 Bacteria 733
2 Ga0070658_10003363 3300005327 Bacteria 13183
3 Ga0070658_10008023 3300005327 Bacteria 8491
4 Ga0070683_100382412 3300005329 Bacteria 1341
5 Ga0070680_100026510 3300005336 Bacteria 4636
6 Ga0070680_100103063 3300005336 Bacteria 2370
7 Ga0070680_100319456 3300005336 Bacteria 1318
8 Ga0070682_100027014 3300005337 Bacteria 3441
9 Ga0068868_100970662 3300005338 Bacteria 776
10 Ga0070660_100011701 3300005339 Bacteria 6248
11 Ga0070660_100073607 3300005339 Bacteria 2671
12 Ga0070660_100542571 3300005339 Bacteria 970
13 Ga0070691_10027113 3300005341 Bacteria 2673
14 Ga0070661_100645965 3300005344 Bacteria 859
15 Ga0070692_10297649 3300005345 Bacteria 984
16 Ga0070675_101844156 3300005354 Bacteria 558
17 Ga0070671_101255142 3300005355 Bacteria 653
18 Ga0070659_100097798 3300005366 Bacteria 2359
19 Ga0070659_100778860 3300005366 Bacteria 831
20 Ga0070703_10040362 3300005406 Bacteria 1450
21 Ga0070709_10021226 3300005434 Bacteria 3780
22 Ga0070709_10038852 3300005434 Bacteria 2917
23 Ga0070709_10496892 3300005434 Bacteria 926
24 Ga0070714_100023743 3300005435 Bacteria 5042
25 Ga0070714_100048058 3300005435 Bacteria 3628
26 Ga0070714_100048513 3300005435 Bacteria 3612
27 Ga0070714_100104642 3300005435 Bacteria 2498
28 Ga0070714_100126871 3300005435 Bacteria 2276
29 Ga0070714_100137256 3300005435 Bacteria 2191
30 Ga0070714_100666706 3300005435 Bacteria 1002
31 Ga0070714_100725686 3300005435 Bacteria 960
32 Ga0070714_101239370 3300005435 Bacteria 728
33 Ga0070713_100038507 3300005436 Bacteria 3875
34 Ga0070713_100104944 3300005436 Bacteria 2454
35 Ga0070713_100191580 3300005436 Bacteria 1843
36 Ga0070710_10020928 3300005437 Bacteria 3401
37 Ga0070710_10079832 3300005437 Bacteria 1907
38 Ga0070710_10313117 3300005437 Bacteria 1028
39 Ga0070711_100050663 3300005439 Bacteria 2848
40 Ga0070711_100146865 3300005439 Bacteria 1774
41 Ga0070711_100150975 3300005439 Bacteria 1752
42 Ga0070705_100205320 3300005440 Bacteria 1354
43 Ga0070681_10250640 3300005458 Bacteria 1683
44 Ga0070681_10591856 3300005458 Bacteria 1023
45 Ga0070681_10713265 3300005458 Bacteria 919
46 Ga0070707_100000749 3300005468 Bacteria 32054
47 Ga0070707_100086626 3300005468 Bacteria 3029
48 Ga0070707_100511585 3300005468 Bacteria 1162
49 Ga0070707_101092348 3300005468 Bacteria 764
50 Ga0070698_101302249 3300005471 Bacteria 677
51 Ga0070698_101687834 3300005471 Bacteria 586
52 Ga0070679_100093954 3300005530 Bacteria 2986
53 Ga0070679_100101331 3300005530 Bacteria 2866
54 Ga0070679_100692531 3300005530 Bacteria 962
55 Ga0070684_100278737 3300005535 Bacteria 1532
56 Ga0070684_100355677 3300005535 Bacteria 1347
57 Ga0070684_100379607 3300005535 Bacteria 1302
58 Ga0070684_101027186 3300005535 Bacteria 774
59 Ga0068853_101411437 3300005539 Bacteria 674
60 Ga0070695_100000583 3300005545 Bacteria 19245
61 Ga0070693_100519144 3300005547 Bacteria 848
62 Ga0070704_101163057 3300005549 Bacteria 702
63 Ga0068855_100079888 3300005563 Bacteria 3792
64 Ga0068855_100470921 3300005563 Bacteria 1368
65 Ga0068855_100792676 3300005563 Bacteria 1008
66 Ga0070664_100247817 3300005564 Bacteria 1601
67 Ga0068856_100140350 3300005614 Bacteria 2423
68 Ga0068856_100357358 3300005614 Bacteria 1479
69 Ga0068852_100032146 3300005616 Bacteria 4341
70 Ga0068852_100398953 3300005616 Bacteria 1353
71 Ga0068851_10061579 3300005834 Bacteria 1924
72 Ga0068863_100415804 3300005841 Bacteria 1317
73 Ga0070717_10026710 3300006028 Bacteria 4609
74 Ga0070717_10040261 3300006028 Bacteria 3806
75 Ga0070717_10092259 3300006028 Bacteria 2558
76 Ga0070717_10299935 3300006028 Bacteria 1428
77 Ga0070717_10392030 3300006028 Bacteria 1246
78 Ga0070717_10582431 3300006028 Bacteria 1014
79 Ga0070717_11143484 3300006028 Bacteria 709
80 Ga0075432_10157634 3300006058 Bacteria 876
81 Ga0070715_10001386 3300006163 Bacteria 7003
82 Ga0070716_100018405 3300006173 Bacteria 3639
83 Ga0070716_101068539 3300006173 Bacteria 642
84 Ga0070712_100013667 3300006175 Bacteria 5193
85 Ga0070712_100309807 3300006175 Bacteria 1280
86 Ga0070712_100732739 3300006175 Bacteria 845
87 Ga0070712_100904444 3300006175 Bacteria 761
88 Ga0070712_101030630 3300006175 Bacteria 713
89 Ga0070712_101289864 3300006175 Unclassified 636
90 Ga0068871_101054439 3300006358 Bacteria 759
91 Ga0075433_10662510 3300006852 Bacteria 915
92 Ga0075434_100006191 3300006871 Bacteria 10956
93 Ga0075434_100937849 3300006871 Bacteria 880
94 Ga0105240_10011956 3300009093 Bacteria 12032
95 Ga0105240_10559799 3300009093 Bacteria 1264
96 Ga0105240_10820321 3300009093 Bacteria 1006
97 Ga0111539_10398492 3300009094 Bacteria 1603
98 Ga0105245_10145412 3300009098 Bacteria 2237
99 Ga0105245_10599181 3300009098 Bacteria 1128
100 Ga0105247_10164523 3300009101 Bacteria 1471
101 Ga0105237_11977640 3300009545 Bacteria 591
102 Ga0105238_10419450 3300009551 Bacteria 1333
103 Ga0105238_10479318 3300009551 Bacteria 1243
104 Ga0105238_11754993 3300009551 Bacteria 652
105 Ga0105239_12040381 3300010375 Bacteria 666
106 Ga0157373_10086945 3300013100 Bacteria 2203
107 Ga0157371_10180699 3300013102 Bacteria 1509
108 Ga0157371_10233848 3300013102 Bacteria 1321
109 Ga0157370_10004057 3300013104 Bacteria 16986
110 Ga0157370_10087012 3300013104 Bacteria 2935
111 Ga0157369_10013539 3300013105 Bacteria 9218
112 Ga0157369_10016140 3300013105 Bacteria 8406
113 Ga0157369_10275348 3300013105 Bacteria 1753
114 Ga0157369_10308401 3300013105 Bacteria 1646
115 Ga0157369_10974694 3300013105 Bacteria 868
116 Ga0157369_11228957 3300013105 Bacteria 764
117 Ga0157369_11698235 3300013105 Bacteria 642
118 Ga0157374_10033432 3300013296 Bacteria 4692
119 Ga0163162_11279437 3300013306 Bacteria 833
120 Ga0157372_10135898 3300013307 Bacteria 2831
121 Ga0157372_10222731 3300013307 Bacteria 2187
122 Ga0157372_10379178 3300013307 Bacteria 1648
123 Ga0157372_10518432 3300013307 Bacteria 1390
124 Ga0157375_11371696 3300013308 Bacteria 832
125 Ga0163163_11063372 3300014325 Bacteria 872
126 Ga0157380_12274680 3300014326 Bacteria 606
127 Ga0182008_10083895 3300014497 Bacteria 1569
128 Ga0182008_10199046 3300014497 Bacteria 1019
129 Ga0182008_10613042 3300014497 Bacteria 612
130 Ga0157377_10985693 3300014745 Bacteria 637
131 Ga0157379_11963806 3300014968 Bacteria 578
132 Ga0197907_10430093 3300020069 Bacteria 632
133 Ga0197907_10848793 3300020069 Bacteria 2545
134 Ga0206356_10342049 3300020070 Bacteria 2972
135 Ga0206356_11555266 3300020070 Bacteria 1693
136 Ga0206354_11058585 3300020081 Bacteria 782
137 Ga0206354_11270280 3300020081 Bacteria 4861
138 Ga0206353_11956207 3300020082 Bacteria 2444
139 Ga0206353_12060517 3300020082 Bacteria 1581
140 Ga0213871_10004517 3300021441 Bacteria 2792
141 Ga0224712_10092199 3300022467 Bacteria 1271
142 Ga0207692_10066978 3300025898 Bacteria 1878
143 Ga0207692_10132714 3300025898 Bacteria 1408
144 Ga0207692_10457883 3300025898 Bacteria 804
145 Ga0207710_10257880 3300025900 Bacteria 873
146 Ga0207647_10332571 3300025904 Bacteria 862
147 Ga0207685_10003909 3300025905 Bacteria 3699
148 Ga0207699_10001178 3300025906 Bacteria 12378
149 Ga0207699_10176688 3300025906 Bacteria 1432
150 Ga0207699_10319261 3300025906 Bacteria 1089
151 Ga0207705_10050549 3300025909 Bacteria 2993
152 Ga0207705_10100246 3300025909 Bacteria 2130
153 Ga0207705_10152249 3300025909 Bacteria 1733
154 Ga0207707_10412695 3300025912 Bacteria 1158
155 Ga0207695_10016796 3300025913 Bacteria 8546
156 Ga0207695_10111124 3300025913 Bacteria 2720
157 Ga0207695_10980474 3300025913 Bacteria 725
158 Ga0207671_10137187 3300025914 Bacteria 1882
159 Ga0207693_10035582 3300025915 Bacteria 3925
160 Ga0207693_10046723 3300025915 Bacteria 3401
161 Ga0207693_10137432 3300025915 Bacteria 1922
162 Ga0207693_10394479 3300025915 Bacteria 1082
163 Ga0207663_10003256 3300025916 Bacteria 7917
164 Ga0207663_10223873 3300025916 Bacteria 1370
165 Ga0207660_10067530 3300025917 Bacteria 2590
166 Ga0207660_10192540 3300025917 Bacteria 1589
167 Ga0207660_10352530 3300025917 Bacteria 1179
168 Ga0207660_10669003 3300025917 Bacteria 847
169 Ga0207657_10005594 3300025919 Bacteria 13124
170 Ga0207657_10005928 3300025919 Bacteria 12720
171 Ga0207657_10081884 3300025919 Bacteria 2710
172 Ga0207652_10334067 3300025921 Bacteria 1368
173 Ga0207652_10447758 3300025921 Bacteria 1164
174 Ga0207652_10669678 3300025921 Bacteria 927
175 Ga0207652_10686484 3300025921 Bacteria 914
176 Ga0207646_10002360 3300025922 Bacteria 22302
177 Ga0207646_10089722 3300025922 Bacteria 2752
178 Ga0207694_10633381 3300025924 Bacteria 900
179 Ga0207694_10677579 3300025924 Bacteria 869
180 Ga0207687_10718664 3300025927 Bacteria 849
181 Ga0207700_10466675 3300025928 Bacteria 1114
182 Ga0207700_10631261 3300025928 Bacteria 954
183 Ga0207700_11120762 3300025928 Bacteria 703
184 Ga0207700_11232749 3300025928 Bacteria 667
185 Ga0207664_10002396 3300025929 Bacteria 12399
186 Ga0207664_10023655 3300025929 Bacteria 4606
187 Ga0207664_10033561 3300025929 Bacteria 3944
188 Ga0207664_10129154 3300025929 Bacteria 2125
189 Ga0207664_10142408 3300025929 Bacteria 2030
190 Ga0207664_10339451 3300025929 Bacteria 1328
191 Ga0207664_10547300 3300025929 Bacteria 1038
192 Ga0207664_10890868 3300025929 Bacteria 799
193 Ga0207664_11014252 3300025929 Bacteria 744
194 Ga0207644_10483455 3300025931 Bacteria 1020
195 Ga0207644_10693430 3300025931 Bacteria 849
196 Ga0207690_10141861 3300025932 Bacteria 1771
197 Ga0207690_10257311 3300025932 Bacteria 1351
198 Ga0207665_10019245 3300025939 Bacteria 4487
199 Ga0207665_10750082 3300025939 Bacteria 769
200 Ga0207661_10214394 3300025944 Bacteria 1698
201 Ga0207667_10044140 3300025949 Bacteria 4726
202 Ga0207667_10326948 3300025949 Bacteria 1566
203 Ga0207667_10333116 3300025949 Bacteria 1549
204 Ga0207667_10700956 3300025949 Bacteria 1015
205 Ga0207712_10730651 3300025961 Bacteria 866
206 Ga0207677_11377871 3300026023 Bacteria 649
207 Ga0207639_10843467 3300026041 Bacteria 855
208 Ga0207702_10695189 3300026078 Bacteria 1002
209 Ga0207674_10240051 3300026116 Bacteria 1759
210 Ga0207698_10193985 3300026142 Bacteria 1812
211 Ga0207428_10453862 3300027907 Bacteria 934
212 Ga0265319_1021723 3300028563 Bacteria 2351
213 Ga0265319_1067336 3300028563 Bacteria 1152
214 Ga0265319_1130111 3300028563 Bacteria 783
215 Ga0265318_10118973 3300028577 Bacteria 971
216 Ga0265336_10002075 3300028666 Bacteria 8524
217 Ga0265338_10092584 3300028800 Bacteria 2492
218 Ga0265338_10594984 3300028800 Bacteria 771
219 Ga0265340_10084026 3300031247 Bacteria 1495
220 Ga0265339_10460582 3300031249 Bacteria 590
221 Ga0316583_10080480 3300032133 Bacteria 1138
222 Ga0373926_0069841 3300035083 Bacteria 1289
223 Ga0373928_0042498 3300035084 Bacteria 1048
224 Ga0373940_0058721 3300035088 Bacteria 1096
225 Ga0373944_0148974 3300035089 Bacteria 824
226 Ga0373923_0114126 3300035111 Bacteria 1202
227 Ga0373923_0457119 3300035111 Bacteria 619
228 Ga0373932_0089980 3300035112 Bacteria 983
229 Ga0373936_0115645 3300035113 Bacteria 1142
230 Ga0373945_0274479 3300035116 Bacteria 717
231 Ga0373953_0084094 3300035117 Bacteria 1326
232 Ga0373956_0137336 3300035119 Bacteria 1147
233 Ga0373957_0087415 3300035120 Bacteria 1235
234 Ga0373957_0260631 3300035120 Bacteria 731
235 Ga0373943_0000738 3300035170 Bacteria 14264
236 Ga0373943_0006212 3300035170 Bacteria 5363
237 Ga0373946_0015992 3300035171 Bacteria 2854
238 Ga0373946_0165045 3300035171 Bacteria 1042
239 Ga0373955_0109003 3300035172 Bacteria 1599
240 Ga0373962_0101823 3300035242 Bacteria 897
241 Ga0373931_0286931 3300035691 Bacteria 1012
242 Ga0373935_0052842 3300035692 Bacteria 2584
243 Ga0373935_0161794 3300035692 Bacteria 1526
244 Ga0373935_0455158 3300035692 Bacteria 925
245 Ga0373933_0435006 3300035724 Bacteria 857
246 Ga0373933_0463099 3300035724 Bacteria 830
247 Ga0373933_0671424 3300035724 Bacteria 681
248 Ga0373947_0000730 3300035725 Bacteria 19649
249 Ga0373947_0002451 3300035725 Bacteria 11168
250 Ga0373937_0000962 3300036401 Bacteria 24414
251 Ga0373937_0349021 3300036401 Bacteria 1401
252 Ga0373937_1372237 3300036401 Bacteria 655
253 Ga0373925_0002688 3300037068 Bacteria 14108
254 Ga0373925_0021802 3300037068 Bacteria 4670
255 Ga0395899_0052537 3300037312 Bacteria 3020
256 Ga0395899_0111793 3300037312 Bacteria 1963
257 Ga0395900_0014436 3300037418 Bacteria 8061
258 Ga0395900_0029861 3300037418 Bacteria 5595
259 Ga0395900_0089672 3300037418 Bacteria 3160
260 Ga0395900_0613149 3300037418 Bacteria 1028
261 Ga0395900_0882201 3300037418 Bacteria 819
262 Ga0395898_0046233 3300037466 Bacteria 4275
263 Ga0395898_0170413 3300037466 Bacteria 2081
264 Ga0395898_0240576 3300037466 Bacteria 1726
265 Ga0395898_0623074 3300037466 Bacteria 1021
266 Ga0395898_0699586 3300037466 Bacteria 955
267 Ga0395898_0997431 3300037466 Bacteria 773
268 Ga0395898_1229199 3300037466 Bacteria 680
269 Ga0395898_1279710 3300037466 Bacteria 663
270 Ga0395905_0039984 3300037471 Bacteria 4400
271 Ga0395905_0492842 3300037471 Bacteria 1125
272 Ga0395905_0823736 3300037471 Bacteria 831
273 Ga0395901_0059921 3300038443 Bacteria 3960
274 Ga0395901_0320669 3300038443 Bacteria 1603
275 Ga0395901_1257041 3300038443 Bacteria 704
276 Ga0436360_0819159 3300039438 Bacteria 8805
277 Ga0451807_1817466 3300041486 Bacteria 819
278 Ga0451849_0315474 3300041505 Bacteria 790
279 Ga0439448_0312755 3300042005 Bacteria 558
280 Ga0466969_0024468 3300044656 Bacteria 3106
281 Ga0466969_0031528 3300044656 Bacteria 2697
282 Ga0466969_0093658 3300044656 Bacteria 1421
283 Ga0466969_0102466 3300044656 Bacteria 1346
284 Ga0466972_0027424 3300044658 Bacteria 2818
285 Ga0466965_0016848 3300044683 Bacteria 3485
286 Ga0466965_0030609 3300044683 Bacteria 2623
287 Ga0466965_0073360 3300044683 Bacteria 1723
288 Ga0466966_0036859 3300044684 Bacteria 3156
289 Ga0466966_0099432 3300044684 Bacteria 1800
290 Ga0466966_0119913 3300044684 Bacteria 1616
291 Ga0466966_0288139 3300044684 Bacteria 987
292 Ga0466961_0000475 3300044693 Bacteria 25415
293 Ga0466961_0019463 3300044693 Bacteria 4366
294 Ga0466961_0028462 3300044693 Bacteria 3593
295 Ga0466961_0033941 3300044693 Bacteria 3278
296 Ga0466961_0105512 3300044693 Bacteria 1774
297 Ga0466961_0494233 3300044693 Bacteria 739
298 Ga0466961_0890614 3300044693 Bacteria 530
299 Ga0466963_0001550 3300044694 Bacteria 12463
300 Ga0466963_0002141 3300044694 Bacteria 10920
301 Ga0466963_0002256 3300044694 Bacteria 10710
302 Ga0466963_0002339 3300044694 Bacteria 10572
303 Ga0466963_0002586 3300044694 Bacteria 10156
304 Ga0466963_0003600 3300044694 Bacteria 8907
305 Ga0466963_0016028 3300044694 Bacteria 4653
306 Ga0466963_0029183 3300044694 Bacteria 3548
307 Ga0466963_0032375 3300044694 Bacteria 3385
308 Ga0466963_0046252 3300044694 Bacteria 2868
309 Ga0466963_0055416 3300044694 Bacteria 2636
310 Ga0466963_0061506 3300044694 Bacteria 2510
311 Ga0466963_0079090 3300044694 Bacteria 2224
312 Ga0466963_0130657 3300044694 Bacteria 1734
313 Ga0466963_0150782 3300044694 Bacteria 1614
314 Ga0466963_0206375 3300044694 Bacteria 1374
315 Ga0466963_0243067 3300044694 Bacteria 1262
316 Ga0466963_0342836 3300044694 Bacteria 1052
317 Ga0466963_0470506 3300044694 Bacteria 887
318 Ga0466964_0001854 3300044706 Bacteria 7366
319 Ga0466964_0007772 3300044706 Bacteria 4014
320 Ga0466964_0012768 3300044706 Bacteria 3181
321 Ga0466964_0021271 3300044706 Bacteria 2507
322 Ga0466964_0038985 3300044706 Bacteria 1912
323 Ga0466964_0046041 3300044706 Bacteria 1777
324 Ga0466964_0067961 3300044706 Bacteria 1499
325 Ga0466964_0177274 3300044706 Bacteria 1008
326 Ga0466964_0593587 3300044706 Bacteria 606
327 Ga0453684_1202536 3300044712 Bacteria 796
328 Ga0466971_0010564 3300044719 Bacteria 4036
329 Ga0466971_0073108 3300044719 Bacteria 1558
330 Ga0466971_0082899 3300044719 Bacteria 1464
331 Ga0466971_0102663 3300044719 Bacteria 1315
332 Ga0466971_0132765 3300044719 Bacteria 1157
333 Ga0466971_0157934 3300044719 Bacteria 1060
334 Ga0466971_0188351 3300044719 Bacteria 971
335 Ga0466971_0224500 3300044719 Bacteria 891
336 Ga0466971_0484449 3300044719 Bacteria 609
337 Ga0466968_0014365 3300044735 Bacteria 3129
338 Ga0466968_0033268 3300044735 Bacteria 2148
339 Ga0466968_0043358 3300044735 Bacteria 1904
340 Ga0466968_0209058 3300044735 Bacteria 916
341 Ga0466968_0431785 3300044735 Bacteria 649
342 Ga0466970_0025207 3300044765 Bacteria 3114
343 Ga0466970_0058484 3300044765 Bacteria 2063
344 Ga0466970_0179755 3300044765 Bacteria 1174
345 Ga0466957_0013103 3300044842 Bacteria 4805
346 Ga0466957_0013483 3300044842 Bacteria 4741
347 Ga0466957_0020518 3300044842 Bacteria 3888
348 Ga0466957_0022584 3300044842 Bacteria 3714
349 Ga0466957_0078527 3300044842 Bacteria 2052
350 Ga0466957_0112550 3300044842 Bacteria 1727
351 Ga0466957_0171765 3300044842 Bacteria 1412
352 Ga0466957_0196151 3300044842 Bacteria 1324
353 Ga0466957_0236242 3300044842 Bacteria 1211
354 Ga0466957_0270065 3300044842 Bacteria 1135
355 Ga0466957_0361522 3300044842 Bacteria 986
356 Ga0466960_0021505 3300044901 Bacteria 2873
357 Ga0466960_0030365 3300044901 Bacteria 2486
358 Ga0466960_0143809 3300044901 Bacteria 1269
359 Ga0466960_0360611 3300044901 Bacteria 831
360 Ga0466960_0864582 3300044901 Bacteria 550
361 Ga0466959_0000543 3300045049 Bacteria 21954
362 Ga0466959_0017426 3300045049 Bacteria 5264
363 Ga0466959_0048228 3300045049 Bacteria 3130
364 Ga0466959_0059224 3300045049 Bacteria 2789
365 Ga0466959_0139788 3300045049 Bacteria 1712
366 Ga0466959_0241832 3300045049 Bacteria 1246
367 Ga0466959_0318363 3300045049 Bacteria 1064
368 Ga0451576_2040969 3300045051 Bacteria 590
369 Ga0466958_0001935 3300045836 Bacteria 10155
370 Ga0466958_0002986 3300045836 Bacteria 8663
371 Ga0466958_0012611 3300045836 Bacteria 4790
372 Ga0466958_0025441 3300045836 Bacteria 3491
373 Ga0466958_0028119 3300045836 Bacteria 3331
374 Ga0466958_0039251 3300045836 Bacteria 2844
375 Ga0466958_0040067 3300045836 Bacteria 2815
376 Ga0466958_0055667 3300045836 Bacteria 2400
377 Ga0466958_0150957 3300045836 Bacteria 1465
378 Ga0466958_0175968 3300045836 Bacteria 1357
379 Ga0466958_0220443 3300045836 Bacteria 1210
380 Ga0466958_0335841 3300045836 Bacteria 972
381 Ga0466958_0571161 3300045836 Bacteria 735
382 Ga0466958_0887717 3300045836 Bacteria 581
383 Ga0466967_0001167 3300045976 Bacteria 14737
384 Ga0466967_0001868 3300045976 Bacteria 12700
385 Ga0466967_0003238 3300045976 Bacteria 10532
386 Ga0466967_0003931 3300045976 Bacteria 9871
387 Ga0466967_0004634 3300045976 Bacteria 9321
388 Ga0466967_0004962 3300045976 Bacteria 9107
389 Ga0466967_0005147 3300045976 Bacteria 8996
390 Ga0466967_0035758 3300045976 Bacteria 4232
391 Ga0466967_0063003 3300045976 Bacteria 3293
392 Ga0466967_0070262 3300045976 Bacteria 3132
393 Ga0466967_0084626 3300045976 Bacteria 2870
394 Ga0466967_0110359 3300045976 Bacteria 2526
395 Ga0466967_0118810 3300045976 Bacteria 2439
396 Ga0466967_0138324 3300045976 Bacteria 2266
397 Ga0466967_0189614 3300045976 Bacteria 1942
398 Ga0466967_0201925 3300045976 Bacteria 1883
399 Ga0466967_0250938 3300045976 Bacteria 1690
400 Ga0466967_0290177 3300045976 Bacteria 1571
401 Ga0466967_0406427 3300045976 Bacteria 1325
402 Ga0466967_0423987 3300045976 Bacteria 1297
403 Ga0466967_0518132 3300045976 Bacteria 1171
404 Ga0466967_0876146 3300045976 Bacteria 892
405 Ga0466967_0941507 3300045976 Bacteria 859
406 Ga0466967_1019677 3300045976 Bacteria 824
407 Ga0466967_1267862 3300045976 Bacteria 734
408 Ga0495592_0000014 3300046454 Bacteria 148128
409 Ga0495592_0061868 3300046454 Bacteria 2750
410 Ga0495592_0382310 3300046454 Bacteria 895
411 Ga0495603_0009981 3300046455 Bacteria 5746
412 Ga0495603_0081089 3300046455 Bacteria 1901
413 Ga0495603_0381232 3300046455 Bacteria 808
414 Ga0495629_0007288 3300046459 Bacteria 8146
415 Ga0495629_0035913 3300046459 Bacteria 3500
416 Ga0495629_0075290 3300046459 Bacteria 2357
417 Ga0495629_0273936 3300046459 Bacteria 1159
418 Ga0495641_0023088 3300046461 Bacteria 3098
419 Ga0495641_0084935 3300046461 Bacteria 1417
420 Ga0495641_0116847 3300046461 Bacteria 1190
421 Ga0495641_0123245 3300046461 Bacteria 1156
422 Ga0495641_0461723 3300046461 Bacteria 578
423 Ga0495651_0000049 3300046462 Bacteria 88249
424 Ga0495651_0024052 3300046462 Bacteria 4739
425 Ga0495651_0131351 3300046462 Bacteria 1827
426 Ga0495651_0322871 3300046462 Bacteria 1028
427 Ga0495651_0420881 3300046462 Bacteria 868
428 Ga0495653_0007290 3300046463 Bacteria 9059
429 Ga0495653_0022366 3300046463 Bacteria 5117
430 Ga0495653_0023523 3300046463 Bacteria 4975
431 Ga0495653_0028768 3300046463 Bacteria 4442
432 Ga0495653_0062302 3300046463 Bacteria 2818
433 Ga0495653_0178941 3300046463 Bacteria 1457
434 Ga0495653_0295769 3300046463 Bacteria 1057
435 Ga0495580_0215497 3300046472 Bacteria 1320
436 Ga0495580_0517008 3300046472 Bacteria 796
437 Ga0495580_0527310 3300046472 Bacteria 786
438 Ga0495582_0007263 3300046473 Bacteria 6143
439 Ga0495582_0018490 3300046473 Bacteria 3811
440 Ga0495582_0062622 3300046473 Bacteria 2055
441 Ga0495582_0112157 3300046473 Bacteria 1532
442 Ga0495582_0668951 3300046473 Bacteria 601
443 Ga0495639_0002118 3300046475 Bacteria 8753
444 Ga0495639_0024578 3300046475 Bacteria 2653
445 Ga0495639_0205273 3300046475 Bacteria 966
446 Ga0495662_0010474 3300046476 Bacteria 4539
447 Ga0495662_0100918 3300046476 Bacteria 1412
448 Ga0495664_0161791 3300046477 Bacteria 1358
449 Ga0495664_0174407 3300046477 Bacteria 1304
450 Ga0495664_0397173 3300046477 Bacteria 828
451 Ga0495584_0238676 3300046491 Bacteria 924
452 Ga0495607_0253560 3300046501 Bacteria 846
453 Ga0495608_0002528 3300046511 Bacteria 13111
454 Ga0495608_0062568 3300046511 Bacteria 2445
455 Ga0495608_0309067 3300046511 Bacteria 978
456 Ga0495608_0779373 3300046511 Bacteria 565
457 Ga0495618_0001249 3300046514 Bacteria 17187
458 Ga0495618_0038969 3300046514 Bacteria 2987
459 Ga0495618_0239667 3300046514 Bacteria 1140
460 Ga0495618_0247712 3300046514 Bacteria 1118
461 Ga0495628_0000021 3300046516 Bacteria 148194
462 Ga0495628_0016946 3300046516 Bacteria 6070
463 Ga0495628_0114197 3300046516 Bacteria 2075
464 Ga0495628_0621474 3300046516 Bacteria 770
465 Ga0495630_0002579 3300046517 Bacteria 12554
466 Ga0495630_0399129 3300046517 Bacteria 1053
467 Ga0495630_0740303 3300046517 Bacteria 752
468 Ga0495631_0256022 3300046518 Bacteria 746
469 Ga0495637_0039080 3300046520 Bacteria 2051
470 Ga0495644_0008724 3300046523 Bacteria 3900
471 Ga0495663_0037060 3300046525 Bacteria 1470
472 Ga0495666_0000479 3300046526 Bacteria 17815
473 Ga0495642_0285394 3300046528 Bacteria 723
474 Ga0495652_0008390 3300046529 Bacteria 9432
475 Ga0495652_0010968 3300046529 Bacteria 8210
476 Ga0495652_0020003 3300046529 Bacteria 5954
477 Ga0495652_0026907 3300046529 Bacteria 5073
478 Ga0495652_0047912 3300046529 Bacteria 3664
479 Ga0495652_0409440 3300046529 Bacteria 958
480 Ga0495652_0476501 3300046529 Bacteria 869
481 Ga0495652_0492575 3300046529 Bacteria 851
482 Ga0495665_0008077 3300046531 Bacteria 5706
483 Ga0495665_0246767 3300046531 Bacteria 920
484 Ga0495640_0029833 3300046533 Bacteria 3909
485 Ga0495640_0031909 3300046533 Bacteria 3756
486 Ga0495640_0392055 3300046533 Bacteria 853
487 Ga0495586_0005629 3300046535 Bacteria 6701
488 Ga0495586_0593281 3300046535 Bacteria 640
489 Ga0495587_0000124 3300046536 Bacteria 59025
490 Ga0495587_0039125 3300046536 Bacteria 2840
491 Ga0495587_0303568 3300046536 Bacteria 892
492 Ga0495645_0000019 3300046543 Bacteria 147666
493 Ga0495645_0046927 3300046543 Bacteria 3148
494 Ga0495645_0047077 3300046543 Bacteria 3142
495 Ga0495645_0144916 3300046543 Bacteria 1654
496 Ga0495645_0193158 3300046543 Bacteria 1386
497 Ga0495645_0668685 3300046543 Bacteria 633
498 Ga0495667_0021554 3300046559 Bacteria 4348
499 Ga0495667_0039758 3300046559 Bacteria 3125
500 Ga0495667_0069691 3300046559 Bacteria 2295
501 Ga0495634_0006230 3300046642 Bacteria 9087
502 Ga0495634_0172976 3300046642 Bacteria 1356
503 Ga0495611_0285450 3300046648 Bacteria 762
504 Ga0495635_0032353 3300046663 Bacteria 3628
505 Ga0495635_0033587 3300046663 Bacteria 3559
506 Ga0495635_0044832 3300046663 Bacteria 3050
507 Ga0495635_0069933 3300046663 Bacteria 2406
508 Ga0495588_0097782 3300046674 Bacteria 1541
509 Ga0495657_0007055 3300046675 Bacteria 8716
510 Ga0495657_0102791 3300046675 Bacteria 1818
511 Ga0495657_0172249 3300046675 Bacteria 1332
512 Ga0495599_0001901 3300046678 Bacteria 12092
513 Ga0495599_0020437 3300046678 Bacteria 4123
514 Ga0495599_0170454 3300046678 Bacteria 1343
515 Ga0495599_0207758 3300046678 Bacteria 1201
516 Ga0495599_0595664 3300046678 Bacteria 644
517 Ga0495623_0000978 3300046679 Bacteria 19262
518 Ga0495623_0026570 3300046679 Bacteria 3725
519 Ga0495646_0030143 3300046680 Bacteria 3388
520 Ga0495646_0068871 3300046680 Bacteria 2088
521 Ga0495646_0073311 3300046680 Bacteria 2011
522 Ga0495646_0154551 3300046680 Bacteria 1274
523 Ga0495647_0000238 3300046681 Bacteria 15019
524 Ga0495647_0121383 3300046681 Bacteria 1099
525 Ga0495658_0157530 3300046683 Bacteria 1398
526 Ga0495658_0184129 3300046683 Bacteria 1296
527 Ga0495658_0450433 3300046683 Bacteria 822
528 Ga0495613_0010957 3300046689 Bacteria 6729
529 Ga0495613_0015477 3300046689 Bacteria 5672
530 Ga0495624_0003569 3300046690 Bacteria 11520
531 Ga0495624_0025342 3300046690 Bacteria 3895
532 Ga0495624_0363097 3300046690 Bacteria 871
533 Ga0495624_0390436 3300046690 Bacteria 836
534 Ga0495670_0106125 3300046691 Bacteria 1451
535 Ga0495600_0044794 3300046809 Bacteria 2886
536 Ga0495600_0117278 3300046809 Bacteria 1732
537 Ga0495600_0495263 3300046809 Bacteria 751
538 Ga0495581_0006455 3300047315 Bacteria 6805
539 Ga0495581_0440340 3300047315 Bacteria 759
540 Ga0495581_0715733 3300047315 Bacteria 577
541 Ga0495604_0000004 3300047317 Bacteria 456385
542 Ga0495604_0016095 3300047317 Bacteria 5973
543 Ga0495604_0065387 3300047317 Bacteria 2769
544 Ga0495604_0176143 3300047317 Bacteria 1499
545 Ga0495604_0238778 3300047317 Bacteria 1244
546 Ga0495674_0107457 3300047319 Bacteria 2368
547 Ga0495674_0145400 3300047319 Bacteria 1990
548 Ga0495674_0148486 3300047319 Bacteria 1967
549 Ga0495674_0303994 3300047319 Bacteria 1302
550 Ga0495674_0325802 3300047319 Bacteria 1250
551 Ga0495674_0552405 3300047319 Bacteria 916
552 Ga0495674_0685492 3300047319 Bacteria 805
553 Ga0495674_0772422 3300047319 Bacteria 749
554 Ga0495674_0899881 3300047319 Bacteria 683
555 Ga0495676_0032564 3300047321 Bacteria 4398
556 Ga0495676_0077633 3300047321 Bacteria 2532
557 Ga0495676_0087845 3300047321 Bacteria 2334
558 Ga0495676_0185056 3300047321 Bacteria 1457
559 Ga0495676_0216423 3300047321 Bacteria 1322
560 Ga0495680_0002085 3300047322 Bacteria 20797
561 Ga0495680_0018277 3300047322 Bacteria 5957
562 Ga0495680_0036510 3300047322 Bacteria 3944
563 Ga0495680_0078550 3300047322 Bacteria 2497
564 Ga0495680_0118620 3300047322 Bacteria 1955
565 Ga0495680_0475889 3300047322 Bacteria 851
566 Ga0495675_0000079 3300047444 Bacteria 68947
567 Ga0495675_0610038 3300047444 Bacteria 618
568 Ga0495684_0009805 3300047471 Bacteria 7392
569 Ga0495684_0030715 3300047471 Bacteria 4125
570 Ga0495684_0032228 3300047471 Bacteria 4022
571 Ga0495684_0209681 3300047471 Bacteria 1433
572 Ga0495684_0288765 3300047471 Bacteria 1181
573 Ga0495684_0634470 3300047471 Bacteria 716
574 Ga0495593_0001046 3300047673 Bacteria 16226
575 Ga0495593_0046714 3300047673 Bacteria 2306
576 Ga0495602_0000351 3300048088 Bacteria 42756
577 Ga0495602_0067495 3300048088 Bacteria 3077
578 Ga0495614_0001947 3300048089 Bacteria 9066
579 Ga0496100_0455392 3300048903 Bacteria 981
580 Ga0496100_0536295 3300048903 Bacteria 904
581 Ga0496101_0063472 3300048904 Bacteria 2689
582 Ga0496101_0310768 3300048904 Bacteria 1235
583 Ga0496101_0942486 3300048904 Bacteria 679
584 Ga0496102_0003999 3300048905 Bacteria 12483
585 Ga0496102_0015570 3300048905 Bacteria 6625
586 Ga0496103_0022161 3300048906 Bacteria 3824
587 Ga0496104_0160252 3300048907 Bacteria 2158
588 Ga0496104_1286458 3300048907 Bacteria 634
589 Ga0496105_0011731 3300048908 Bacteria 6934
590 Ga0496105_0091474 3300048908 Bacteria 2512
591 Ga0496106_0003413 3300048909 Bacteria 11840
592 Ga0496106_0305923 3300048909 Bacteria 1275
593 Ga0496106_0732177 3300048909 Bacteria 787
594 Ga0496107_0001364 3300048910 Bacteria 15012
595 Ga0496107_0102878 3300048910 Bacteria 2095
596 Ga0496107_0122465 3300048910 Bacteria 1916
597 Ga0496107_0137863 3300048910 Bacteria 1803
598 Ga0496107_0397612 3300048910 Bacteria 1025
599 Ga0496107_0435292 3300048910 Bacteria 975
600 Ga0496108_0037589 3300048911 Bacteria 4033
601 Ga0496108_0136049 3300048911 Bacteria 2114
602 Ga0496108_0938697 3300048911 Bacteria 741
603 Ga0496109_0203790 3300048912 Bacteria 1860
604 Ga0496109_0240620 3300048912 Bacteria 1703
605 Ga0496109_0286883 3300048912 Bacteria 1551
606 Ga0496109_0412458 3300048912 Bacteria 1276
607 Ga0496109_1254524 3300048912 Bacteria 677
608 Ga0496110_0206608 3300048913 Bacteria 1785
609 Ga0496110_0257468 3300048913 Bacteria 1588
610 Ga0496110_0697261 3300048913 Bacteria 917
611 Ga0496110_1376401 3300048913 Bacteria 615
612 Ga0496111_0067587 3300048914 Bacteria 2596
613 Ga0496111_0211736 3300048914 Bacteria 1440
614 Ga0496111_0245162 3300048914 Bacteria 1330
615 Ga0496112_0112506 3300048915 Bacteria 2693
616 Ga0496112_0133554 3300048915 Bacteria 2452
617 Ga0496112_0188591 3300048915 Bacteria 2024
618 Ga0496112_0313828 3300048915 Bacteria 1513
619 Ga0496112_0507720 3300048915 Bacteria 1141
620 Ga0496112_0516943 3300048915 Bacteria 1129
621 Ga0496113_0118731 3300048916 Bacteria 2065
622 Ga0496113_0390746 3300048916 Bacteria 1117
623 Ga0496113_0416110 3300048916 Bacteria 1079
624 Ga0496114_0028338 3300048917 Bacteria 4595
625 Ga0496114_0080992 3300048917 Bacteria 2742
626 Ga0496114_0110557 3300048917 Bacteria 2354
627 Ga0496114_0286651 3300048917 Bacteria 1452
628 Ga0496114_0301643 3300048917 Bacteria 1414
629 Ga0496115_0005198 3300048918 Bacteria 9464
630 Ga0496115_0039513 3300048918 Bacteria 3747
631 Ga0496115_0048533 3300048918 Bacteria 3396
632 Ga0496115_0140104 3300048918 Bacteria 1995
633 Ga0496115_0158454 3300048918 Bacteria 1870
634 Ga0496115_0173375 3300048918 Bacteria 1783
635 Ga0496115_0319923 3300048918 Bacteria 1269
636 Ga0501047_0164559 3300049581 Bacteria 2089
637 Ga0501047_0813426 3300049581 Bacteria 749
638 Ga0501067_0043485 3300049583 Bacteria 2495
639 Ga0501067_0105887 3300049583 Bacteria 1563
640 Ga0501067_0432892 3300049583 Bacteria 734
641 Ga0501069_0066269 3300049585 Bacteria 2019
642 Ga0501070_0007826 3300049586 Bacteria 9058
643 Ga0501072_0019524 3300049588 Bacteria 5241
644 Ga0501073_0546790 3300049589 Bacteria 800
645 Ga0501074_0037721 3300049590 Bacteria 3502
646 Ga0501079_0119825 3300049741 Bacteria 2046
647 Ga0501080_0340990 3300049742 Bacteria 1354
648 Ga0501080_0607355 3300049742 Bacteria 970
649 Ga0501080_0759876 3300049742 Bacteria 852
650 Ga0501083_0046861 3300049744 Bacteria 2922
651 nmdc:mga08y16_660141_c1 3300050511 Bacteria 1049
652 nmdc:mga0n895_1236363_c1 3300050512 Bacteria 720
653 nmdc:mga0n895_20054_c1 3300050512 Bacteria 6226
654 nmdc:mga0rr50_144402_c1 3300050513 Bacteria 1917
655 nmdc:mga0a205_424067_c1 3300050515 Bacteria 1192
656 Ga0495601_0000215 3300053077 Bacteria 31042
657 Ga0495601_0006394 3300053077 Bacteria 6888
658 Ga0495601_0010126 3300053077 Bacteria 5600
659 Ga0495601_0063685 3300053077 Bacteria 2344
660 Ga0495601_0110381 3300053077 Bacteria 1781
661 Ga0495601_0271744 3300053077 Bacteria 1106
662 Ga0495601_0348251 3300053077 Bacteria 963
663 Ga0495601_0755420 3300053077 Bacteria 618
664 Ga0495612_0004654 3300053078 Bacteria 5682
665 Ga0495612_0028532 3300053078 Bacteria 2247
666 Ga0495612_0055344 3300053078 Bacteria 1635
667 Ga0495612_0084780 3300053078 Bacteria 1335
668 Ga0495595_0006619 3300053084 Bacteria 4730
669 Ga0495595_0022717 3300053084 Bacteria 2755
670 Ga0495595_0050136 3300053084 Bacteria 1932
671 Ga0495595_0226930 3300053084 Bacteria 932
672 Ga0495619_0000199 3300053085 Bacteria 43846
673 Ga0495619_0005873 3300053085 Bacteria 7777
674 Ga0495619_0097727 3300053085 Bacteria 1995
675 Ga0495619_0123780 3300053085 Bacteria 1774
676 Ga0495619_0133080 3300053085 Bacteria 1709
677 Ga0495619_0189472 3300053085 Bacteria 1423
678 Ga0466962_0021393 3300061719 Bacteria 3106
679 Ga0466962_0029963 3300061719 Bacteria 2605
680 Ga0466962_0061969 3300061719 Bacteria 1785
681 Ga0466962_0091737 3300061719 Bacteria 1456
682 Ga0466962_0092311 3300061719 Bacteria 1451
683 Ga0466962_0248421 3300061719 Bacteria 874
684 Ga0070695_100852914
685 Ga0070658_10003363
686 Ga0070658_10008023
687 Ga0070683_100382412
688 Ga0070680_100026510
689 Ga0070680_100103063
690 Ga0070680_100319456
691 Ga0070682_100027014
692 Ga0068868_100970662
693 Ga0070660_100011701
694 Ga0070660_100073607
695 Ga0070660_100542571
696 Ga0070691_10027113
697 Ga0070661_100645965
698 Ga0070692_10297649
699 Ga0070675_101844156
700 Ga0070671_101255142
701 Ga0070659_100097798
702 Ga0070659_100778860
703 Ga0070703_10040362
704 Ga0070709_10021226
705 Ga0070709_10038852
706 Ga0070709_10496892
707 Ga0070714_100023743
708 Ga0070714_100048058
709 Ga0070714_100048513
710 Ga0070714_100104642
711 Ga0070714_100126871
712 Ga0070714_100137256
713 Ga0070714_100666706
714 Ga0070714_100725686
715 Ga0070714_101239370
716 Ga0070713_100038507
717 Ga0070713_100104944
718 Ga0070713_100191580
719 Ga0070710_10020928
720 Ga0070710_10079832
721 Ga0070710_10313117
722 Ga0070711_100050663
723 Ga0070711_100146865
724 Ga0070711_100150975
725 Ga0070705_100205320
726 Ga0070681_10250640
727 Ga0070681_10591856
728 Ga0070681_10713265
729 Ga0070707_100000749
730 Ga0070707_100086626
731 Ga0070707_100511585
732 Ga0070707_101092348
733 Ga0070698_101302249
734 Ga0070698_101687834
735 Ga0070679_100093954
736 Ga0070679_100101331
737 Ga0070679_100692531
738 Ga0070684_100278737
739 Ga0070684_100355677
740 Ga0070684_100379607
741 Ga0070684_101027186
742 Ga0068853_101411437
743 Ga0070695_100000583
744 Ga0070693_100519144
745 Ga0070704_101163057
746 Ga0068855_100079888
747 Ga0068855_100470921
748 Ga0068855_100792676
749 Ga0070664_100247817
750 Ga0068856_100140350
751 Ga0068856_100357358
752 Ga0068852_100032146
753 Ga0068852_100398953
754 Ga0068851_10061579
755 Ga0068863_100415804
756 Ga0070717_10026710
757 Ga0070717_10040261
758 Ga0070717_10092259
759 Ga0070717_10299935
760 Ga0070717_10392030
761 Ga0070717_10582431
762 Ga0070717_11143484
763 Ga0075432_10157634
764 Ga0070715_10001386
765 Ga0070716_100018405
766 Ga0070716_101068539
767 Ga0070712_100013667
768 Ga0070712_100309807
769 Ga0070712_100732739
770 Ga0070712_100904444
771 Ga0070712_101030630
772 Ga0070712_101289864
773 Ga0068871_101054439
774 Ga0075433_10662510
775 Ga0075434_100006191
776 Ga0075434_100937849
777 Ga0105240_10011956
778 Ga0105240_10559799
779 Ga0105240_10820321
780 Ga0111539_10398492
781 Ga0105245_10145412
782 Ga0105245_10599181
783 Ga0105247_10164523
784 Ga0105237_11977640
785 Ga0105238_10419450
786 Ga0105238_10479318
787 Ga0105238_11754993
788 Ga0105239_12040381
789 Ga0157373_10086945
790 Ga0157371_10180699
791 Ga0157371_10233848
792 Ga0157370_10004057
793 Ga0157370_10087012
794 Ga0157369_10013539
795 Ga0157369_10016140
796 Ga0157369_10275348
797 Ga0157369_10308401
798 Ga0157369_10974694
799 Ga0157369_11228957
800 Ga0157369_11698235
801 Ga0157374_10033432
802 Ga0163162_11279437
803 Ga0157372_10135898
804 Ga0157372_10222731
805 Ga0157372_10379178
806 Ga0157372_10518432
807 Ga0157375_11371696
808 Ga0163163_11063372
809 Ga0157380_12274680
810 Ga0182008_10083895
811 Ga0182008_10199046
812 Ga0182008_10613042
813 Ga0157377_10985693
814 Ga0157379_11963806
815 Ga0197907_10430093
816 Ga0197907_10848793
817 Ga0206356_10342049
818 Ga0206356_11555266
819 Ga0206354_11058585
820 Ga0206354_11270280
821 Ga0206353_11956207
822 Ga0206353_12060517
823 Ga0213871_10004517
824 Ga0224712_10092199
825 Ga0207692_10066978
826 Ga0207692_10132714
827 Ga0207692_10457883
828 Ga0207710_10257880
829 Ga0207647_10332571
830 Ga0207685_10003909
831 Ga0207699_10001178
832 Ga0207699_10176688
833 Ga0207699_10319261
834 Ga0207705_10050549
835 Ga0207705_10100246
836 Ga0207705_10152249
837 Ga0207707_10412695
838 Ga0207695_10016796
839 Ga0207695_10111124
840 Ga0207695_10980474
841 Ga0207671_10137187
842 Ga0207693_10035582
843 Ga0207693_10046723
844 Ga0207693_10137432
845 Ga0207693_10394479
846 Ga0207663_10003256
847 Ga0207663_10223873
848 Ga0207660_10067530
849 Ga0207660_10192540
850 Ga0207660_10352530
851 Ga0207660_10669003
852 Ga0207657_10005594
853 Ga0207657_10005928
854 Ga0207657_10081884
855 Ga0207652_10334067
856 Ga0207652_10447758
857 Ga0207652_10669678
858 Ga0207652_10686484
859 Ga0207646_10002360
860 Ga0207646_10089722
861 Ga0207694_10633381
862 Ga0207694_10677579
863 Ga0207687_10718664
864 Ga0207700_10466675
865 Ga0207700_10631261
866 Ga0207700_11120762
867 Ga0207700_11232749
868 Ga0207664_10002396
869 Ga0207664_10023655
870 Ga0207664_10033561
871 Ga0207664_10129154
872 Ga0207664_10142408
873 Ga0207664_10339451
874 Ga0207664_10547300
875 Ga0207664_10890868
876 Ga0207664_11014252
877 Ga0207644_10483455
878 Ga0207644_10693430
879 Ga0207690_10141861
880 Ga0207690_10257311
881 Ga0207665_10019245
882 Ga0207665_10750082
883 Ga0207661_10214394
884 Ga0207667_10044140
885 Ga0207667_10326948
886 Ga0207667_10333116
887 Ga0207667_10700956
888 Ga0207712_10730651
889 Ga0207677_11377871
890 Ga0207639_10843467
891 Ga0207702_10695189
892 Ga0207674_10240051
893 Ga0207698_10193985
894 Ga0207428_10453862
895 Ga0265319_1021723
896 Ga0265319_1067336
897 Ga0265319_1130111
898 Ga0265318_10118973
899 Ga0265336_10002075
900 Ga0265338_10092584
901 Ga0265338_10594984
902 Ga0265340_10084026
903 Ga0265339_10460582
904 Ga0316583_10080480
905 Ga0373926_0069841
906 Ga0373928_0042498
907 Ga0373940_0058721
908 Ga0373944_0148974
909 Ga0373923_0114126
910 Ga0373923_0457119
911 Ga0373932_0089980
912 Ga0373936_0115645
913 Ga0373945_0274479
914 Ga0373953_0084094
915 Ga0373956_0137336
916 Ga0373957_0087415
917 Ga0373957_0260631
918 Ga0373943_0000738
919 Ga0373943_0006212
920 Ga0373946_0015992
921 Ga0373946_0165045
922 Ga0373955_0109003
923 Ga0373962_0101823
924 Ga0373931_0286931
925 Ga0373935_0052842
926 Ga0373935_0161794
927 Ga0373935_0455158
928 Ga0373933_0435006
929 Ga0373933_0463099
930 Ga0373933_0671424
931 Ga0373947_0000730
932 Ga0373947_0002451
933 Ga0373937_0000962
934 Ga0373937_0349021
935 Ga0373937_1372237
936 Ga0373925_0002688
937 Ga0373925_0021802
938 Ga0395899_0052537
939 Ga0395899_0111793
940 Ga0395900_0014436
941 Ga0395900_0029861
942 Ga0395900_0089672
943 Ga0395900_0613149
944 Ga0395900_0882201
945 Ga0395898_0046233
946 Ga0395898_0170413
947 Ga0395898_0240576
948 Ga0395898_0623074
949 Ga0395898_0699586
950 Ga0395898_0997431
951 Ga0395898_1229199
952 Ga0395898_1279710
953 Ga0395905_0039984
954 Ga0395905_0492842
955 Ga0395905_0823736
956 Ga0395901_0059921
957 Ga0395901_0320669
958 Ga0395901_1257041
959 Ga0436360_0819159
960 Ga0451807_1817466
961 Ga0451849_0315474
962 Ga0439448_0312755
963 Ga0466969_0024468
964 Ga0466969_0031528
965 Ga0466969_0093658
966 Ga0466969_0102466
967 Ga0466972_0027424
968 Ga0466965_0016848
969 Ga0466965_0030609
970 Ga0466965_0073360
971 Ga0466966_0036859
972 Ga0466966_0099432
973 Ga0466966_0119913
974 Ga0466966_0288139
975 Ga0466961_0000475
976 Ga0466961_0019463
977 Ga0466961_0028462
978 Ga0466961_0033941
979 Ga0466961_0105512
980 Ga0466961_0494233
981 Ga0466961_0890614
982 Ga0466963_0001550
983 Ga0466963_0002141
984 Ga0466963_0002256
985 Ga0466963_0002339
986 Ga0466963_0002586
987 Ga0466963_0003600
988 Ga0466963_0016028
989 Ga0466963_0029183
990 Ga0466963_0032375
991 Ga0466963_0046252
992 Ga0466963_0055416
993 Ga0466963_0061506
994 Ga0466963_0079090
995 Ga0466963_0130657
996 Ga0466963_0150782
997 Ga0466963_0206375
998 Ga0466963_0243067
999 Ga0466963_0342836
1000 Ga0466963_0470506
1001 Ga0466964_0001854
1002 Ga0466964_0007772
1003 Ga0466964_0012768
1004 Ga0466964_0021271
1005 Ga0466964_0038985
1006 Ga0466964_0046041
1007 Ga0466964_0067961
1008 Ga0466964_0177274
1009 Ga0466964_0593587
1010 Ga0453684_1202536
1011 Ga0466971_0010564
1012 Ga0466971_0073108
1013 Ga0466971_0082899
1014 Ga0466971_0102663
1015 Ga0466971_0132765
1016 Ga0466971_0157934
1017 Ga0466971_0188351
1018 Ga0466971_0224500
1019 Ga0466971_0484449
1020 Ga0466968_0014365
1021 Ga0466968_0033268
1022 Ga0466968_0043358
1023 Ga0466968_0209058
1024 Ga0466968_0431785
1025 Ga0466970_0025207
1026 Ga0466970_0058484
1027 Ga0466970_0179755
1028 Ga0466957_0013103
1029 Ga0466957_0013483
1030 Ga0466957_0020518
1031 Ga0466957_0022584
1032 Ga0466957_0078527
1033 Ga0466957_0112550
1034 Ga0466957_0171765
1035 Ga0466957_0196151
1036 Ga0466957_0236242
1037 Ga0466957_0270065
1038 Ga0466957_0361522
1039 Ga0466960_0021505
1040 Ga0466960_0030365
1041 Ga0466960_0143809
1042 Ga0466960_0360611
1043 Ga0466960_0864582
1044 Ga0466959_0000543
1045 Ga0466959_0017426
1046 Ga0466959_0048228
1047 Ga0466959_0059224
1048 Ga0466959_0139788
1049 Ga0466959_0241832
1050 Ga0466959_0318363
1051 Ga0451576_2040969
1052 Ga0466958_0001935
1053 Ga0466958_0002986
1054 Ga0466958_0012611
1055 Ga0466958_0025441
1056 Ga0466958_0028119
1057 Ga0466958_0039251
1058 Ga0466958_0040067
1059 Ga0466958_0055667
1060 Ga0466958_0150957
1061 Ga0466958_0175968
1062 Ga0466958_0220443
1063 Ga0466958_0335841
1064 Ga0466958_0571161
1065 Ga0466958_0887717
1066 Ga0466967_0001167
1067 Ga0466967_0001868
1068 Ga0466967_0003238
1069 Ga0466967_0003931
1070 Ga0466967_0004634
1071 Ga0466967_0004962
1072 Ga0466967_0005147
1073 Ga0466967_0035758
1074 Ga0466967_0063003
1075 Ga0466967_0070262
1076 Ga0466967_0084626
1077 Ga0466967_0110359
1078 Ga0466967_0118810
1079 Ga0466967_0138324
1080 Ga0466967_0189614
1081 Ga0466967_0201925
1082 Ga0466967_0250938
1083 Ga0466967_0290177
1084 Ga0466967_0406427
1085 Ga0466967_0423987
1086 Ga0466967_0518132
1087 Ga0466967_0876146
1088 Ga0466967_0941507
1089 Ga0466967_1019677
1090 Ga0466967_1267862
1091 Ga0495592_0000014
1092 Ga0495592_0061868
1093 Ga0495592_0382310
1094 Ga0495603_0009981
1095 Ga0495603_0081089
1096 Ga0495603_0381232
1097 Ga0495629_0007288
1098 Ga0495629_0035913
1099 Ga0495629_0075290
1100 Ga0495629_0273936
1101 Ga0495641_0023088
1102 Ga0495641_0084935
1103 Ga0495641_0116847
1104 Ga0495641_0123245
1105 Ga0495641_0461723
1106 Ga0495651_0000049
1107 Ga0495651_0024052
1108 Ga0495651_0131351
1109 Ga0495651_0322871
1110 Ga0495651_0420881
1111 Ga0495653_0007290
1112 Ga0495653_0022366
1113 Ga0495653_0023523
1114 Ga0495653_0028768
1115 Ga0495653_0062302
1116 Ga0495653_0178941
1117 Ga0495653_0295769
1118 Ga0495580_0215497
1119 Ga0495580_0517008
1120 Ga0495580_0527310
1121 Ga0495582_0007263
1122 Ga0495582_0018490
1123 Ga0495582_0062622
1124 Ga0495582_0112157
1125 Ga0495582_0668951
1126 Ga0495639_0002118
1127 Ga0495639_0024578
1128 Ga0495639_0205273
1129 Ga0495662_0010474
1130 Ga0495662_0100918
1131 Ga0495664_0161791
1132 Ga0495664_0174407
1133 Ga0495664_0397173
1134 Ga0495584_0238676
1135 Ga0495607_0253560
1136 Ga0495608_0002528
1137 Ga0495608_0062568
1138 Ga0495608_0309067
1139 Ga0495608_0779373
1140 Ga0495618_0001249
1141 Ga0495618_0038969
1142 Ga0495618_0239667
1143 Ga0495618_0247712
1144 Ga0495628_0000021
1145 Ga0495628_0016946
1146 Ga0495628_0114197
1147 Ga0495628_0621474
1148 Ga0495630_0002579
1149 Ga0495630_0399129
1150 Ga0495630_0740303
1151 Ga0495631_0256022
1152 Ga0495637_0039080
1153 Ga0495644_0008724
1154 Ga0495663_0037060
1155 Ga0495666_0000479
1156 Ga0495642_0285394
1157 Ga0495652_0008390
1158 Ga0495652_0010968
1159 Ga0495652_0020003
1160 Ga0495652_0026907
1161 Ga0495652_0047912
1162 Ga0495652_0409440
1163 Ga0495652_0476501
1164 Ga0495652_0492575
1165 Ga0495665_0008077
1166 Ga0495665_0246767
1167 Ga0495640_0029833
1168 Ga0495640_0031909
1169 Ga0495640_0392055
1170 Ga0495586_0005629
1171 Ga0495586_0593281
1172 Ga0495587_0000124
1173 Ga0495587_0039125
1174 Ga0495587_0303568
1175 Ga0495645_0000019
1176 Ga0495645_0046927
1177 Ga0495645_0047077
1178 Ga0495645_0144916
1179 Ga0495645_0193158
1180 Ga0495645_0668685
1181 Ga0495667_0021554
1182 Ga0495667_0039758
1183 Ga0495667_0069691
1184 Ga0495634_0006230
1185 Ga0495634_0172976
1186 Ga0495611_0285450
1187 Ga0495635_0032353
1188 Ga0495635_0033587
1189 Ga0495635_0044832
1190 Ga0495635_0069933
1191 Ga0495588_0097782
1192 Ga0495657_0007055
1193 Ga0495657_0102791
1194 Ga0495657_0172249
1195 Ga0495599_0001901
1196 Ga0495599_0020437
1197 Ga0495599_0170454
1198 Ga0495599_0207758
1199 Ga0495599_0595664
1200 Ga0495623_0000978
1201 Ga0495623_0026570
1202 Ga0495646_0030143
1203 Ga0495646_0068871
1204 Ga0495646_0073311
1205 Ga0495646_0154551
1206 Ga0495647_0000238
1207 Ga0495647_0121383
1208 Ga0495658_0157530
1209 Ga0495658_0184129
1210 Ga0495658_0450433
1211 Ga0495613_0010957
1212 Ga0495613_0015477
1213 Ga0495624_0003569
1214 Ga0495624_0025342
1215 Ga0495624_0363097
1216 Ga0495624_0390436
1217 Ga0495670_0106125
1218 Ga0495600_0044794
1219 Ga0495600_0117278
1220 Ga0495600_0495263
1221 Ga0495581_0006455
1222 Ga0495581_0440340
1223 Ga0495581_0715733
1224 Ga0495604_0000004
1225 Ga0495604_0016095
1226 Ga0495604_0065387
1227 Ga0495604_0176143
1228 Ga0495604_0238778
1229 Ga0495674_0107457
1230 Ga0495674_0145400
1231 Ga0495674_0148486
1232 Ga0495674_0303994
1233 Ga0495674_0325802
1234 Ga0495674_0552405
1235 Ga0495674_0685492
1236 Ga0495674_0772422
1237 Ga0495674_0899881
1238 Ga0495676_0032564
1239 Ga0495676_0077633
1240 Ga0495676_0087845
1241 Ga0495676_0185056
1242 Ga0495676_0216423
1243 Ga0495680_0002085
1244 Ga0495680_0018277
1245 Ga0495680_0036510
1246 Ga0495680_0078550
1247 Ga0495680_0118620
1248 Ga0495680_0475889
1249 Ga0495675_0000079
1250 Ga0495675_0610038
1251 Ga0495684_0009805
1252 Ga0495684_0030715
1253 Ga0495684_0032228
1254 Ga0495684_0209681
1255 Ga0495684_0288765
1256 Ga0495684_0634470
1257 Ga0495593_0001046
1258 Ga0495593_0046714
1259 Ga0495602_0000351
1260 Ga0495602_0067495
1261 Ga0495614_0001947
1262 Ga0496100_0455392
1263 Ga0496100_0536295
1264 Ga0496101_0063472
1265 Ga0496101_0310768
1266 Ga0496101_0942486
1267 Ga0496102_0003999
1268 Ga0496102_0015570
1269 Ga0496103_0022161
1270 Ga0496104_0160252
1271 Ga0496104_1286458
1272 Ga0496105_0011731
1273 Ga0496105_0091474
1274 Ga0496106_0003413
1275 Ga0496106_0305923
1276 Ga0496106_0732177
1277 Ga0496107_0001364
1278 Ga0496107_0102878
1279 Ga0496107_0122465
1280 Ga0496107_0137863
1281 Ga0496107_0397612
1282 Ga0496107_0435292
1283 Ga0496108_0037589
1284 Ga0496108_0136049
1285 Ga0496108_0938697
1286 Ga0496109_0203790
1287 Ga0496109_0240620
1288 Ga0496109_0286883
1289 Ga0496109_0412458
1290 Ga0496109_1254524
1291 Ga0496110_0206608
1292 Ga0496110_0257468
1293 Ga0496110_0697261
1294 Ga0496110_1376401
1295 Ga0496111_0067587
1296 Ga0496111_0211736
1297 Ga0496111_0245162
1298 Ga0496112_0112506
1299 Ga0496112_0133554
1300 Ga0496112_0188591
1301 Ga0496112_0313828
1302 Ga0496112_0507720
1303 Ga0496112_0516943
1304 Ga0496113_0118731
1305 Ga0496113_0390746
1306 Ga0496113_0416110
1307 Ga0496114_0028338
1308 Ga0496114_0080992
1309 Ga0496114_0110557
1310 Ga0496114_0286651
1311 Ga0496114_0301643
1312 Ga0496115_0005198
1313 Ga0496115_0039513
1314 Ga0496115_0048533
1315 Ga0496115_0140104
1316 Ga0496115_0158454
1317 Ga0496115_0173375
1318 Ga0496115_0319923
1319 Ga0501047_0164559
1320 Ga0501047_0813426
1321 Ga0501067_0043485
1322 Ga0501067_0105887
1323 Ga0501067_0432892
1324 Ga0501069_0066269
1325 Ga0501070_0007826
1326 Ga0501072_0019524
1327 Ga0501073_0546790
1328 Ga0501074_0037721
1329 Ga0501079_0119825
1330 Ga0501080_0340990
1331 Ga0501080_0607355
1332 Ga0501080_0759876
1333 Ga0501083_0046861
1334 nmdc:mga08y16_660141_c1
1335 nmdc:mga0n895_1236363_c1
1336 nmdc:mga0n895_20054_c1
1337 nmdc:mga0rr50_144402_c1
1338 nmdc:mga0a205_424067_c1
1339 Ga0495601_0000215
1340 Ga0495601_0006394
1341 Ga0495601_0010126
1342 Ga0495601_0063685
1343 Ga0495601_0110381
1344 Ga0495601_0271744
1345 Ga0495601_0348251
1346 Ga0495601_0755420
1347 Ga0495612_0004654
1348 Ga0495612_0028532
1349 Ga0495612_0055344
1350 Ga0495612_0084780
1351 Ga0495595_0006619
1352 Ga0495595_0022717
1353 Ga0495595_0050136
1354 Ga0495595_0226930
1355 Ga0495619_0000199
1356 Ga0495619_0005873
1357 Ga0495619_0097727
1358 Ga0495619_0123780
1359 Ga0495619_0133080
1360 Ga0495619_0189472
1361 Ga0466962_0021393
1362 Ga0466962_0029963
1363 Ga0466962_0061969
1364 Ga0466962_0091737
1365 Ga0466962_0092311
1366 Ga0466962_0248421

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

13

140

0.9

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

15

147

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9166 3 139
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.9101 1 136
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.898 3 139
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8787 1 135
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.8746 1 135
ID Description Score Start End Superfamily
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9644 3 138 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9376 3 138 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9183 3 139 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9101 1 136 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8872 3 139 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A059XDJ9-F1-model_v4 MaoC like domain protein 0.9785 3 138
AF-A0A4Q4ZH97-F1-model_v4 MaoC family dehydratase 0.9768 3 138
AF-A0A1G7E6P7-F1-model_v4 Acyl dehydratase 0.9767 3 139
AF-A0A7Y9GM06-F1-model_v4 Acyl dehydratase 0.9746 3 139
AF-A0A7Y1YRM2-F1-model_v4 MaoC family dehydratase 0.9726 10 138

Map