F474963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 242 | 1366 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300005545|Ga0070695_100852914|Ga0070695_1008529141 |
| Length | 156 |
| Sequence | MQLRRLGYGSLMTAMEVGAEFGPSSWIDVPQEKIQAFADTTGDHNFIHVDPEMAAQTPFGGTVAHGYLTLSLLPQMSYEVLPHDDPGAGMALNYGLNKVRFPAPVPSGSRVRGSFVVAQVDEQEWGRQVTMTATIEREGGDKPVCVADVVYRYYRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 107 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 108 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 118 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 122 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 125 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 134 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 136 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 141 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 142 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 143 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 146 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 1.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.49 |
| Rhizosphere | 91.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070695_100852914 | 3300005545 | Bacteria | 733 |
| 2 | Ga0070658_10003363 | 3300005327 | Bacteria | 13183 |
| 3 | Ga0070658_10008023 | 3300005327 | Bacteria | 8491 |
| 4 | Ga0070683_100382412 | 3300005329 | Bacteria | 1341 |
| 5 | Ga0070680_100026510 | 3300005336 | Bacteria | 4636 |
| 6 | Ga0070680_100103063 | 3300005336 | Bacteria | 2370 |
| 7 | Ga0070680_100319456 | 3300005336 | Bacteria | 1318 |
| 8 | Ga0070682_100027014 | 3300005337 | Bacteria | 3441 |
| 9 | Ga0068868_100970662 | 3300005338 | Bacteria | 776 |
| 10 | Ga0070660_100011701 | 3300005339 | Bacteria | 6248 |
| 11 | Ga0070660_100073607 | 3300005339 | Bacteria | 2671 |
| 12 | Ga0070660_100542571 | 3300005339 | Bacteria | 970 |
| 13 | Ga0070691_10027113 | 3300005341 | Bacteria | 2673 |
| 14 | Ga0070661_100645965 | 3300005344 | Bacteria | 859 |
| 15 | Ga0070692_10297649 | 3300005345 | Bacteria | 984 |
| 16 | Ga0070675_101844156 | 3300005354 | Bacteria | 558 |
| 17 | Ga0070671_101255142 | 3300005355 | Bacteria | 653 |
| 18 | Ga0070659_100097798 | 3300005366 | Bacteria | 2359 |
| 19 | Ga0070659_100778860 | 3300005366 | Bacteria | 831 |
| 20 | Ga0070703_10040362 | 3300005406 | Bacteria | 1450 |
| 21 | Ga0070709_10021226 | 3300005434 | Bacteria | 3780 |
| 22 | Ga0070709_10038852 | 3300005434 | Bacteria | 2917 |
| 23 | Ga0070709_10496892 | 3300005434 | Bacteria | 926 |
| 24 | Ga0070714_100023743 | 3300005435 | Bacteria | 5042 |
| 25 | Ga0070714_100048058 | 3300005435 | Bacteria | 3628 |
| 26 | Ga0070714_100048513 | 3300005435 | Bacteria | 3612 |
| 27 | Ga0070714_100104642 | 3300005435 | Bacteria | 2498 |
| 28 | Ga0070714_100126871 | 3300005435 | Bacteria | 2276 |
| 29 | Ga0070714_100137256 | 3300005435 | Bacteria | 2191 |
| 30 | Ga0070714_100666706 | 3300005435 | Bacteria | 1002 |
| 31 | Ga0070714_100725686 | 3300005435 | Bacteria | 960 |
| 32 | Ga0070714_101239370 | 3300005435 | Bacteria | 728 |
| 33 | Ga0070713_100038507 | 3300005436 | Bacteria | 3875 |
| 34 | Ga0070713_100104944 | 3300005436 | Bacteria | 2454 |
| 35 | Ga0070713_100191580 | 3300005436 | Bacteria | 1843 |
| 36 | Ga0070710_10020928 | 3300005437 | Bacteria | 3401 |
| 37 | Ga0070710_10079832 | 3300005437 | Bacteria | 1907 |
| 38 | Ga0070710_10313117 | 3300005437 | Bacteria | 1028 |
| 39 | Ga0070711_100050663 | 3300005439 | Bacteria | 2848 |
| 40 | Ga0070711_100146865 | 3300005439 | Bacteria | 1774 |
| 41 | Ga0070711_100150975 | 3300005439 | Bacteria | 1752 |
| 42 | Ga0070705_100205320 | 3300005440 | Bacteria | 1354 |
| 43 | Ga0070681_10250640 | 3300005458 | Bacteria | 1683 |
| 44 | Ga0070681_10591856 | 3300005458 | Bacteria | 1023 |
| 45 | Ga0070681_10713265 | 3300005458 | Bacteria | 919 |
| 46 | Ga0070707_100000749 | 3300005468 | Bacteria | 32054 |
| 47 | Ga0070707_100086626 | 3300005468 | Bacteria | 3029 |
| 48 | Ga0070707_100511585 | 3300005468 | Bacteria | 1162 |
| 49 | Ga0070707_101092348 | 3300005468 | Bacteria | 764 |
| 50 | Ga0070698_101302249 | 3300005471 | Bacteria | 677 |
| 51 | Ga0070698_101687834 | 3300005471 | Bacteria | 586 |
| 52 | Ga0070679_100093954 | 3300005530 | Bacteria | 2986 |
| 53 | Ga0070679_100101331 | 3300005530 | Bacteria | 2866 |
| 54 | Ga0070679_100692531 | 3300005530 | Bacteria | 962 |
| 55 | Ga0070684_100278737 | 3300005535 | Bacteria | 1532 |
| 56 | Ga0070684_100355677 | 3300005535 | Bacteria | 1347 |
| 57 | Ga0070684_100379607 | 3300005535 | Bacteria | 1302 |
| 58 | Ga0070684_101027186 | 3300005535 | Bacteria | 774 |
| 59 | Ga0068853_101411437 | 3300005539 | Bacteria | 674 |
| 60 | Ga0070695_100000583 | 3300005545 | Bacteria | 19245 |
| 61 | Ga0070693_100519144 | 3300005547 | Bacteria | 848 |
| 62 | Ga0070704_101163057 | 3300005549 | Bacteria | 702 |
| 63 | Ga0068855_100079888 | 3300005563 | Bacteria | 3792 |
| 64 | Ga0068855_100470921 | 3300005563 | Bacteria | 1368 |
| 65 | Ga0068855_100792676 | 3300005563 | Bacteria | 1008 |
| 66 | Ga0070664_100247817 | 3300005564 | Bacteria | 1601 |
| 67 | Ga0068856_100140350 | 3300005614 | Bacteria | 2423 |
| 68 | Ga0068856_100357358 | 3300005614 | Bacteria | 1479 |
| 69 | Ga0068852_100032146 | 3300005616 | Bacteria | 4341 |
| 70 | Ga0068852_100398953 | 3300005616 | Bacteria | 1353 |
| 71 | Ga0068851_10061579 | 3300005834 | Bacteria | 1924 |
| 72 | Ga0068863_100415804 | 3300005841 | Bacteria | 1317 |
| 73 | Ga0070717_10026710 | 3300006028 | Bacteria | 4609 |
| 74 | Ga0070717_10040261 | 3300006028 | Bacteria | 3806 |
| 75 | Ga0070717_10092259 | 3300006028 | Bacteria | 2558 |
| 76 | Ga0070717_10299935 | 3300006028 | Bacteria | 1428 |
| 77 | Ga0070717_10392030 | 3300006028 | Bacteria | 1246 |
| 78 | Ga0070717_10582431 | 3300006028 | Bacteria | 1014 |
| 79 | Ga0070717_11143484 | 3300006028 | Bacteria | 709 |
| 80 | Ga0075432_10157634 | 3300006058 | Bacteria | 876 |
| 81 | Ga0070715_10001386 | 3300006163 | Bacteria | 7003 |
| 82 | Ga0070716_100018405 | 3300006173 | Bacteria | 3639 |
| 83 | Ga0070716_101068539 | 3300006173 | Bacteria | 642 |
| 84 | Ga0070712_100013667 | 3300006175 | Bacteria | 5193 |
| 85 | Ga0070712_100309807 | 3300006175 | Bacteria | 1280 |
| 86 | Ga0070712_100732739 | 3300006175 | Bacteria | 845 |
| 87 | Ga0070712_100904444 | 3300006175 | Bacteria | 761 |
| 88 | Ga0070712_101030630 | 3300006175 | Bacteria | 713 |
| 89 | Ga0070712_101289864 | 3300006175 | Unclassified | 636 |
| 90 | Ga0068871_101054439 | 3300006358 | Bacteria | 759 |
| 91 | Ga0075433_10662510 | 3300006852 | Bacteria | 915 |
| 92 | Ga0075434_100006191 | 3300006871 | Bacteria | 10956 |
| 93 | Ga0075434_100937849 | 3300006871 | Bacteria | 880 |
| 94 | Ga0105240_10011956 | 3300009093 | Bacteria | 12032 |
| 95 | Ga0105240_10559799 | 3300009093 | Bacteria | 1264 |
| 96 | Ga0105240_10820321 | 3300009093 | Bacteria | 1006 |
| 97 | Ga0111539_10398492 | 3300009094 | Bacteria | 1603 |
| 98 | Ga0105245_10145412 | 3300009098 | Bacteria | 2237 |
| 99 | Ga0105245_10599181 | 3300009098 | Bacteria | 1128 |
| 100 | Ga0105247_10164523 | 3300009101 | Bacteria | 1471 |
| 101 | Ga0105237_11977640 | 3300009545 | Bacteria | 591 |
| 102 | Ga0105238_10419450 | 3300009551 | Bacteria | 1333 |
| 103 | Ga0105238_10479318 | 3300009551 | Bacteria | 1243 |
| 104 | Ga0105238_11754993 | 3300009551 | Bacteria | 652 |
| 105 | Ga0105239_12040381 | 3300010375 | Bacteria | 666 |
| 106 | Ga0157373_10086945 | 3300013100 | Bacteria | 2203 |
| 107 | Ga0157371_10180699 | 3300013102 | Bacteria | 1509 |
| 108 | Ga0157371_10233848 | 3300013102 | Bacteria | 1321 |
| 109 | Ga0157370_10004057 | 3300013104 | Bacteria | 16986 |
| 110 | Ga0157370_10087012 | 3300013104 | Bacteria | 2935 |
| 111 | Ga0157369_10013539 | 3300013105 | Bacteria | 9218 |
| 112 | Ga0157369_10016140 | 3300013105 | Bacteria | 8406 |
| 113 | Ga0157369_10275348 | 3300013105 | Bacteria | 1753 |
| 114 | Ga0157369_10308401 | 3300013105 | Bacteria | 1646 |
| 115 | Ga0157369_10974694 | 3300013105 | Bacteria | 868 |
| 116 | Ga0157369_11228957 | 3300013105 | Bacteria | 764 |
| 117 | Ga0157369_11698235 | 3300013105 | Bacteria | 642 |
| 118 | Ga0157374_10033432 | 3300013296 | Bacteria | 4692 |
| 119 | Ga0163162_11279437 | 3300013306 | Bacteria | 833 |
| 120 | Ga0157372_10135898 | 3300013307 | Bacteria | 2831 |
| 121 | Ga0157372_10222731 | 3300013307 | Bacteria | 2187 |
| 122 | Ga0157372_10379178 | 3300013307 | Bacteria | 1648 |
| 123 | Ga0157372_10518432 | 3300013307 | Bacteria | 1390 |
| 124 | Ga0157375_11371696 | 3300013308 | Bacteria | 832 |
| 125 | Ga0163163_11063372 | 3300014325 | Bacteria | 872 |
| 126 | Ga0157380_12274680 | 3300014326 | Bacteria | 606 |
| 127 | Ga0182008_10083895 | 3300014497 | Bacteria | 1569 |
| 128 | Ga0182008_10199046 | 3300014497 | Bacteria | 1019 |
| 129 | Ga0182008_10613042 | 3300014497 | Bacteria | 612 |
| 130 | Ga0157377_10985693 | 3300014745 | Bacteria | 637 |
| 131 | Ga0157379_11963806 | 3300014968 | Bacteria | 578 |
| 132 | Ga0197907_10430093 | 3300020069 | Bacteria | 632 |
| 133 | Ga0197907_10848793 | 3300020069 | Bacteria | 2545 |
| 134 | Ga0206356_10342049 | 3300020070 | Bacteria | 2972 |
| 135 | Ga0206356_11555266 | 3300020070 | Bacteria | 1693 |
| 136 | Ga0206354_11058585 | 3300020081 | Bacteria | 782 |
| 137 | Ga0206354_11270280 | 3300020081 | Bacteria | 4861 |
| 138 | Ga0206353_11956207 | 3300020082 | Bacteria | 2444 |
| 139 | Ga0206353_12060517 | 3300020082 | Bacteria | 1581 |
| 140 | Ga0213871_10004517 | 3300021441 | Bacteria | 2792 |
| 141 | Ga0224712_10092199 | 3300022467 | Bacteria | 1271 |
| 142 | Ga0207692_10066978 | 3300025898 | Bacteria | 1878 |
| 143 | Ga0207692_10132714 | 3300025898 | Bacteria | 1408 |
| 144 | Ga0207692_10457883 | 3300025898 | Bacteria | 804 |
| 145 | Ga0207710_10257880 | 3300025900 | Bacteria | 873 |
| 146 | Ga0207647_10332571 | 3300025904 | Bacteria | 862 |
| 147 | Ga0207685_10003909 | 3300025905 | Bacteria | 3699 |
| 148 | Ga0207699_10001178 | 3300025906 | Bacteria | 12378 |
| 149 | Ga0207699_10176688 | 3300025906 | Bacteria | 1432 |
| 150 | Ga0207699_10319261 | 3300025906 | Bacteria | 1089 |
| 151 | Ga0207705_10050549 | 3300025909 | Bacteria | 2993 |
| 152 | Ga0207705_10100246 | 3300025909 | Bacteria | 2130 |
| 153 | Ga0207705_10152249 | 3300025909 | Bacteria | 1733 |
| 154 | Ga0207707_10412695 | 3300025912 | Bacteria | 1158 |
| 155 | Ga0207695_10016796 | 3300025913 | Bacteria | 8546 |
| 156 | Ga0207695_10111124 | 3300025913 | Bacteria | 2720 |
| 157 | Ga0207695_10980474 | 3300025913 | Bacteria | 725 |
| 158 | Ga0207671_10137187 | 3300025914 | Bacteria | 1882 |
| 159 | Ga0207693_10035582 | 3300025915 | Bacteria | 3925 |
| 160 | Ga0207693_10046723 | 3300025915 | Bacteria | 3401 |
| 161 | Ga0207693_10137432 | 3300025915 | Bacteria | 1922 |
| 162 | Ga0207693_10394479 | 3300025915 | Bacteria | 1082 |
| 163 | Ga0207663_10003256 | 3300025916 | Bacteria | 7917 |
| 164 | Ga0207663_10223873 | 3300025916 | Bacteria | 1370 |
| 165 | Ga0207660_10067530 | 3300025917 | Bacteria | 2590 |
| 166 | Ga0207660_10192540 | 3300025917 | Bacteria | 1589 |
| 167 | Ga0207660_10352530 | 3300025917 | Bacteria | 1179 |
| 168 | Ga0207660_10669003 | 3300025917 | Bacteria | 847 |
| 169 | Ga0207657_10005594 | 3300025919 | Bacteria | 13124 |
| 170 | Ga0207657_10005928 | 3300025919 | Bacteria | 12720 |
| 171 | Ga0207657_10081884 | 3300025919 | Bacteria | 2710 |
| 172 | Ga0207652_10334067 | 3300025921 | Bacteria | 1368 |
| 173 | Ga0207652_10447758 | 3300025921 | Bacteria | 1164 |
| 174 | Ga0207652_10669678 | 3300025921 | Bacteria | 927 |
| 175 | Ga0207652_10686484 | 3300025921 | Bacteria | 914 |
| 176 | Ga0207646_10002360 | 3300025922 | Bacteria | 22302 |
| 177 | Ga0207646_10089722 | 3300025922 | Bacteria | 2752 |
| 178 | Ga0207694_10633381 | 3300025924 | Bacteria | 900 |
| 179 | Ga0207694_10677579 | 3300025924 | Bacteria | 869 |
| 180 | Ga0207687_10718664 | 3300025927 | Bacteria | 849 |
| 181 | Ga0207700_10466675 | 3300025928 | Bacteria | 1114 |
| 182 | Ga0207700_10631261 | 3300025928 | Bacteria | 954 |
| 183 | Ga0207700_11120762 | 3300025928 | Bacteria | 703 |
| 184 | Ga0207700_11232749 | 3300025928 | Bacteria | 667 |
| 185 | Ga0207664_10002396 | 3300025929 | Bacteria | 12399 |
| 186 | Ga0207664_10023655 | 3300025929 | Bacteria | 4606 |
| 187 | Ga0207664_10033561 | 3300025929 | Bacteria | 3944 |
| 188 | Ga0207664_10129154 | 3300025929 | Bacteria | 2125 |
| 189 | Ga0207664_10142408 | 3300025929 | Bacteria | 2030 |
| 190 | Ga0207664_10339451 | 3300025929 | Bacteria | 1328 |
| 191 | Ga0207664_10547300 | 3300025929 | Bacteria | 1038 |
| 192 | Ga0207664_10890868 | 3300025929 | Bacteria | 799 |
| 193 | Ga0207664_11014252 | 3300025929 | Bacteria | 744 |
| 194 | Ga0207644_10483455 | 3300025931 | Bacteria | 1020 |
| 195 | Ga0207644_10693430 | 3300025931 | Bacteria | 849 |
| 196 | Ga0207690_10141861 | 3300025932 | Bacteria | 1771 |
| 197 | Ga0207690_10257311 | 3300025932 | Bacteria | 1351 |
| 198 | Ga0207665_10019245 | 3300025939 | Bacteria | 4487 |
| 199 | Ga0207665_10750082 | 3300025939 | Bacteria | 769 |
| 200 | Ga0207661_10214394 | 3300025944 | Bacteria | 1698 |
| 201 | Ga0207667_10044140 | 3300025949 | Bacteria | 4726 |
| 202 | Ga0207667_10326948 | 3300025949 | Bacteria | 1566 |
| 203 | Ga0207667_10333116 | 3300025949 | Bacteria | 1549 |
| 204 | Ga0207667_10700956 | 3300025949 | Bacteria | 1015 |
| 205 | Ga0207712_10730651 | 3300025961 | Bacteria | 866 |
| 206 | Ga0207677_11377871 | 3300026023 | Bacteria | 649 |
| 207 | Ga0207639_10843467 | 3300026041 | Bacteria | 855 |
| 208 | Ga0207702_10695189 | 3300026078 | Bacteria | 1002 |
| 209 | Ga0207674_10240051 | 3300026116 | Bacteria | 1759 |
| 210 | Ga0207698_10193985 | 3300026142 | Bacteria | 1812 |
| 211 | Ga0207428_10453862 | 3300027907 | Bacteria | 934 |
| 212 | Ga0265319_1021723 | 3300028563 | Bacteria | 2351 |
| 213 | Ga0265319_1067336 | 3300028563 | Bacteria | 1152 |
| 214 | Ga0265319_1130111 | 3300028563 | Bacteria | 783 |
| 215 | Ga0265318_10118973 | 3300028577 | Bacteria | 971 |
| 216 | Ga0265336_10002075 | 3300028666 | Bacteria | 8524 |
| 217 | Ga0265338_10092584 | 3300028800 | Bacteria | 2492 |
| 218 | Ga0265338_10594984 | 3300028800 | Bacteria | 771 |
| 219 | Ga0265340_10084026 | 3300031247 | Bacteria | 1495 |
| 220 | Ga0265339_10460582 | 3300031249 | Bacteria | 590 |
| 221 | Ga0316583_10080480 | 3300032133 | Bacteria | 1138 |
| 222 | Ga0373926_0069841 | 3300035083 | Bacteria | 1289 |
| 223 | Ga0373928_0042498 | 3300035084 | Bacteria | 1048 |
| 224 | Ga0373940_0058721 | 3300035088 | Bacteria | 1096 |
| 225 | Ga0373944_0148974 | 3300035089 | Bacteria | 824 |
| 226 | Ga0373923_0114126 | 3300035111 | Bacteria | 1202 |
| 227 | Ga0373923_0457119 | 3300035111 | Bacteria | 619 |
| 228 | Ga0373932_0089980 | 3300035112 | Bacteria | 983 |
| 229 | Ga0373936_0115645 | 3300035113 | Bacteria | 1142 |
| 230 | Ga0373945_0274479 | 3300035116 | Bacteria | 717 |
| 231 | Ga0373953_0084094 | 3300035117 | Bacteria | 1326 |
| 232 | Ga0373956_0137336 | 3300035119 | Bacteria | 1147 |
| 233 | Ga0373957_0087415 | 3300035120 | Bacteria | 1235 |
| 234 | Ga0373957_0260631 | 3300035120 | Bacteria | 731 |
| 235 | Ga0373943_0000738 | 3300035170 | Bacteria | 14264 |
| 236 | Ga0373943_0006212 | 3300035170 | Bacteria | 5363 |
| 237 | Ga0373946_0015992 | 3300035171 | Bacteria | 2854 |
| 238 | Ga0373946_0165045 | 3300035171 | Bacteria | 1042 |
| 239 | Ga0373955_0109003 | 3300035172 | Bacteria | 1599 |
| 240 | Ga0373962_0101823 | 3300035242 | Bacteria | 897 |
| 241 | Ga0373931_0286931 | 3300035691 | Bacteria | 1012 |
| 242 | Ga0373935_0052842 | 3300035692 | Bacteria | 2584 |
| 243 | Ga0373935_0161794 | 3300035692 | Bacteria | 1526 |
| 244 | Ga0373935_0455158 | 3300035692 | Bacteria | 925 |
| 245 | Ga0373933_0435006 | 3300035724 | Bacteria | 857 |
| 246 | Ga0373933_0463099 | 3300035724 | Bacteria | 830 |
| 247 | Ga0373933_0671424 | 3300035724 | Bacteria | 681 |
| 248 | Ga0373947_0000730 | 3300035725 | Bacteria | 19649 |
| 249 | Ga0373947_0002451 | 3300035725 | Bacteria | 11168 |
| 250 | Ga0373937_0000962 | 3300036401 | Bacteria | 24414 |
| 251 | Ga0373937_0349021 | 3300036401 | Bacteria | 1401 |
| 252 | Ga0373937_1372237 | 3300036401 | Bacteria | 655 |
| 253 | Ga0373925_0002688 | 3300037068 | Bacteria | 14108 |
| 254 | Ga0373925_0021802 | 3300037068 | Bacteria | 4670 |
| 255 | Ga0395899_0052537 | 3300037312 | Bacteria | 3020 |
| 256 | Ga0395899_0111793 | 3300037312 | Bacteria | 1963 |
| 257 | Ga0395900_0014436 | 3300037418 | Bacteria | 8061 |
| 258 | Ga0395900_0029861 | 3300037418 | Bacteria | 5595 |
| 259 | Ga0395900_0089672 | 3300037418 | Bacteria | 3160 |
| 260 | Ga0395900_0613149 | 3300037418 | Bacteria | 1028 |
| 261 | Ga0395900_0882201 | 3300037418 | Bacteria | 819 |
| 262 | Ga0395898_0046233 | 3300037466 | Bacteria | 4275 |
| 263 | Ga0395898_0170413 | 3300037466 | Bacteria | 2081 |
| 264 | Ga0395898_0240576 | 3300037466 | Bacteria | 1726 |
| 265 | Ga0395898_0623074 | 3300037466 | Bacteria | 1021 |
| 266 | Ga0395898_0699586 | 3300037466 | Bacteria | 955 |
| 267 | Ga0395898_0997431 | 3300037466 | Bacteria | 773 |
| 268 | Ga0395898_1229199 | 3300037466 | Bacteria | 680 |
| 269 | Ga0395898_1279710 | 3300037466 | Bacteria | 663 |
| 270 | Ga0395905_0039984 | 3300037471 | Bacteria | 4400 |
| 271 | Ga0395905_0492842 | 3300037471 | Bacteria | 1125 |
| 272 | Ga0395905_0823736 | 3300037471 | Bacteria | 831 |
| 273 | Ga0395901_0059921 | 3300038443 | Bacteria | 3960 |
| 274 | Ga0395901_0320669 | 3300038443 | Bacteria | 1603 |
| 275 | Ga0395901_1257041 | 3300038443 | Bacteria | 704 |
| 276 | Ga0436360_0819159 | 3300039438 | Bacteria | 8805 |
| 277 | Ga0451807_1817466 | 3300041486 | Bacteria | 819 |
| 278 | Ga0451849_0315474 | 3300041505 | Bacteria | 790 |
| 279 | Ga0439448_0312755 | 3300042005 | Bacteria | 558 |
| 280 | Ga0466969_0024468 | 3300044656 | Bacteria | 3106 |
| 281 | Ga0466969_0031528 | 3300044656 | Bacteria | 2697 |
| 282 | Ga0466969_0093658 | 3300044656 | Bacteria | 1421 |
| 283 | Ga0466969_0102466 | 3300044656 | Bacteria | 1346 |
| 284 | Ga0466972_0027424 | 3300044658 | Bacteria | 2818 |
| 285 | Ga0466965_0016848 | 3300044683 | Bacteria | 3485 |
| 286 | Ga0466965_0030609 | 3300044683 | Bacteria | 2623 |
| 287 | Ga0466965_0073360 | 3300044683 | Bacteria | 1723 |
| 288 | Ga0466966_0036859 | 3300044684 | Bacteria | 3156 |
| 289 | Ga0466966_0099432 | 3300044684 | Bacteria | 1800 |
| 290 | Ga0466966_0119913 | 3300044684 | Bacteria | 1616 |
| 291 | Ga0466966_0288139 | 3300044684 | Bacteria | 987 |
| 292 | Ga0466961_0000475 | 3300044693 | Bacteria | 25415 |
| 293 | Ga0466961_0019463 | 3300044693 | Bacteria | 4366 |
| 294 | Ga0466961_0028462 | 3300044693 | Bacteria | 3593 |
| 295 | Ga0466961_0033941 | 3300044693 | Bacteria | 3278 |
| 296 | Ga0466961_0105512 | 3300044693 | Bacteria | 1774 |
| 297 | Ga0466961_0494233 | 3300044693 | Bacteria | 739 |
| 298 | Ga0466961_0890614 | 3300044693 | Bacteria | 530 |
| 299 | Ga0466963_0001550 | 3300044694 | Bacteria | 12463 |
| 300 | Ga0466963_0002141 | 3300044694 | Bacteria | 10920 |
| 301 | Ga0466963_0002256 | 3300044694 | Bacteria | 10710 |
| 302 | Ga0466963_0002339 | 3300044694 | Bacteria | 10572 |
| 303 | Ga0466963_0002586 | 3300044694 | Bacteria | 10156 |
| 304 | Ga0466963_0003600 | 3300044694 | Bacteria | 8907 |
| 305 | Ga0466963_0016028 | 3300044694 | Bacteria | 4653 |
| 306 | Ga0466963_0029183 | 3300044694 | Bacteria | 3548 |
| 307 | Ga0466963_0032375 | 3300044694 | Bacteria | 3385 |
| 308 | Ga0466963_0046252 | 3300044694 | Bacteria | 2868 |
| 309 | Ga0466963_0055416 | 3300044694 | Bacteria | 2636 |
| 310 | Ga0466963_0061506 | 3300044694 | Bacteria | 2510 |
| 311 | Ga0466963_0079090 | 3300044694 | Bacteria | 2224 |
| 312 | Ga0466963_0130657 | 3300044694 | Bacteria | 1734 |
| 313 | Ga0466963_0150782 | 3300044694 | Bacteria | 1614 |
| 314 | Ga0466963_0206375 | 3300044694 | Bacteria | 1374 |
| 315 | Ga0466963_0243067 | 3300044694 | Bacteria | 1262 |
| 316 | Ga0466963_0342836 | 3300044694 | Bacteria | 1052 |
| 317 | Ga0466963_0470506 | 3300044694 | Bacteria | 887 |
| 318 | Ga0466964_0001854 | 3300044706 | Bacteria | 7366 |
| 319 | Ga0466964_0007772 | 3300044706 | Bacteria | 4014 |
| 320 | Ga0466964_0012768 | 3300044706 | Bacteria | 3181 |
| 321 | Ga0466964_0021271 | 3300044706 | Bacteria | 2507 |
| 322 | Ga0466964_0038985 | 3300044706 | Bacteria | 1912 |
| 323 | Ga0466964_0046041 | 3300044706 | Bacteria | 1777 |
| 324 | Ga0466964_0067961 | 3300044706 | Bacteria | 1499 |
| 325 | Ga0466964_0177274 | 3300044706 | Bacteria | 1008 |
| 326 | Ga0466964_0593587 | 3300044706 | Bacteria | 606 |
| 327 | Ga0453684_1202536 | 3300044712 | Bacteria | 796 |
| 328 | Ga0466971_0010564 | 3300044719 | Bacteria | 4036 |
| 329 | Ga0466971_0073108 | 3300044719 | Bacteria | 1558 |
| 330 | Ga0466971_0082899 | 3300044719 | Bacteria | 1464 |
| 331 | Ga0466971_0102663 | 3300044719 | Bacteria | 1315 |
| 332 | Ga0466971_0132765 | 3300044719 | Bacteria | 1157 |
| 333 | Ga0466971_0157934 | 3300044719 | Bacteria | 1060 |
| 334 | Ga0466971_0188351 | 3300044719 | Bacteria | 971 |
| 335 | Ga0466971_0224500 | 3300044719 | Bacteria | 891 |
| 336 | Ga0466971_0484449 | 3300044719 | Bacteria | 609 |
| 337 | Ga0466968_0014365 | 3300044735 | Bacteria | 3129 |
| 338 | Ga0466968_0033268 | 3300044735 | Bacteria | 2148 |
| 339 | Ga0466968_0043358 | 3300044735 | Bacteria | 1904 |
| 340 | Ga0466968_0209058 | 3300044735 | Bacteria | 916 |
| 341 | Ga0466968_0431785 | 3300044735 | Bacteria | 649 |
| 342 | Ga0466970_0025207 | 3300044765 | Bacteria | 3114 |
| 343 | Ga0466970_0058484 | 3300044765 | Bacteria | 2063 |
| 344 | Ga0466970_0179755 | 3300044765 | Bacteria | 1174 |
| 345 | Ga0466957_0013103 | 3300044842 | Bacteria | 4805 |
| 346 | Ga0466957_0013483 | 3300044842 | Bacteria | 4741 |
| 347 | Ga0466957_0020518 | 3300044842 | Bacteria | 3888 |
| 348 | Ga0466957_0022584 | 3300044842 | Bacteria | 3714 |
| 349 | Ga0466957_0078527 | 3300044842 | Bacteria | 2052 |
| 350 | Ga0466957_0112550 | 3300044842 | Bacteria | 1727 |
| 351 | Ga0466957_0171765 | 3300044842 | Bacteria | 1412 |
| 352 | Ga0466957_0196151 | 3300044842 | Bacteria | 1324 |
| 353 | Ga0466957_0236242 | 3300044842 | Bacteria | 1211 |
| 354 | Ga0466957_0270065 | 3300044842 | Bacteria | 1135 |
| 355 | Ga0466957_0361522 | 3300044842 | Bacteria | 986 |
| 356 | Ga0466960_0021505 | 3300044901 | Bacteria | 2873 |
| 357 | Ga0466960_0030365 | 3300044901 | Bacteria | 2486 |
| 358 | Ga0466960_0143809 | 3300044901 | Bacteria | 1269 |
| 359 | Ga0466960_0360611 | 3300044901 | Bacteria | 831 |
| 360 | Ga0466960_0864582 | 3300044901 | Bacteria | 550 |
| 361 | Ga0466959_0000543 | 3300045049 | Bacteria | 21954 |
| 362 | Ga0466959_0017426 | 3300045049 | Bacteria | 5264 |
| 363 | Ga0466959_0048228 | 3300045049 | Bacteria | 3130 |
| 364 | Ga0466959_0059224 | 3300045049 | Bacteria | 2789 |
| 365 | Ga0466959_0139788 | 3300045049 | Bacteria | 1712 |
| 366 | Ga0466959_0241832 | 3300045049 | Bacteria | 1246 |
| 367 | Ga0466959_0318363 | 3300045049 | Bacteria | 1064 |
| 368 | Ga0451576_2040969 | 3300045051 | Bacteria | 590 |
| 369 | Ga0466958_0001935 | 3300045836 | Bacteria | 10155 |
| 370 | Ga0466958_0002986 | 3300045836 | Bacteria | 8663 |
| 371 | Ga0466958_0012611 | 3300045836 | Bacteria | 4790 |
| 372 | Ga0466958_0025441 | 3300045836 | Bacteria | 3491 |
| 373 | Ga0466958_0028119 | 3300045836 | Bacteria | 3331 |
| 374 | Ga0466958_0039251 | 3300045836 | Bacteria | 2844 |
| 375 | Ga0466958_0040067 | 3300045836 | Bacteria | 2815 |
| 376 | Ga0466958_0055667 | 3300045836 | Bacteria | 2400 |
| 377 | Ga0466958_0150957 | 3300045836 | Bacteria | 1465 |
| 378 | Ga0466958_0175968 | 3300045836 | Bacteria | 1357 |
| 379 | Ga0466958_0220443 | 3300045836 | Bacteria | 1210 |
| 380 | Ga0466958_0335841 | 3300045836 | Bacteria | 972 |
| 381 | Ga0466958_0571161 | 3300045836 | Bacteria | 735 |
| 382 | Ga0466958_0887717 | 3300045836 | Bacteria | 581 |
| 383 | Ga0466967_0001167 | 3300045976 | Bacteria | 14737 |
| 384 | Ga0466967_0001868 | 3300045976 | Bacteria | 12700 |
| 385 | Ga0466967_0003238 | 3300045976 | Bacteria | 10532 |
| 386 | Ga0466967_0003931 | 3300045976 | Bacteria | 9871 |
| 387 | Ga0466967_0004634 | 3300045976 | Bacteria | 9321 |
| 388 | Ga0466967_0004962 | 3300045976 | Bacteria | 9107 |
| 389 | Ga0466967_0005147 | 3300045976 | Bacteria | 8996 |
| 390 | Ga0466967_0035758 | 3300045976 | Bacteria | 4232 |
| 391 | Ga0466967_0063003 | 3300045976 | Bacteria | 3293 |
| 392 | Ga0466967_0070262 | 3300045976 | Bacteria | 3132 |
| 393 | Ga0466967_0084626 | 3300045976 | Bacteria | 2870 |
| 394 | Ga0466967_0110359 | 3300045976 | Bacteria | 2526 |
| 395 | Ga0466967_0118810 | 3300045976 | Bacteria | 2439 |
| 396 | Ga0466967_0138324 | 3300045976 | Bacteria | 2266 |
| 397 | Ga0466967_0189614 | 3300045976 | Bacteria | 1942 |
| 398 | Ga0466967_0201925 | 3300045976 | Bacteria | 1883 |
| 399 | Ga0466967_0250938 | 3300045976 | Bacteria | 1690 |
| 400 | Ga0466967_0290177 | 3300045976 | Bacteria | 1571 |
| 401 | Ga0466967_0406427 | 3300045976 | Bacteria | 1325 |
| 402 | Ga0466967_0423987 | 3300045976 | Bacteria | 1297 |
| 403 | Ga0466967_0518132 | 3300045976 | Bacteria | 1171 |
| 404 | Ga0466967_0876146 | 3300045976 | Bacteria | 892 |
| 405 | Ga0466967_0941507 | 3300045976 | Bacteria | 859 |
| 406 | Ga0466967_1019677 | 3300045976 | Bacteria | 824 |
| 407 | Ga0466967_1267862 | 3300045976 | Bacteria | 734 |
| 408 | Ga0495592_0000014 | 3300046454 | Bacteria | 148128 |
| 409 | Ga0495592_0061868 | 3300046454 | Bacteria | 2750 |
| 410 | Ga0495592_0382310 | 3300046454 | Bacteria | 895 |
| 411 | Ga0495603_0009981 | 3300046455 | Bacteria | 5746 |
| 412 | Ga0495603_0081089 | 3300046455 | Bacteria | 1901 |
| 413 | Ga0495603_0381232 | 3300046455 | Bacteria | 808 |
| 414 | Ga0495629_0007288 | 3300046459 | Bacteria | 8146 |
| 415 | Ga0495629_0035913 | 3300046459 | Bacteria | 3500 |
| 416 | Ga0495629_0075290 | 3300046459 | Bacteria | 2357 |
| 417 | Ga0495629_0273936 | 3300046459 | Bacteria | 1159 |
| 418 | Ga0495641_0023088 | 3300046461 | Bacteria | 3098 |
| 419 | Ga0495641_0084935 | 3300046461 | Bacteria | 1417 |
| 420 | Ga0495641_0116847 | 3300046461 | Bacteria | 1190 |
| 421 | Ga0495641_0123245 | 3300046461 | Bacteria | 1156 |
| 422 | Ga0495641_0461723 | 3300046461 | Bacteria | 578 |
| 423 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 424 | Ga0495651_0024052 | 3300046462 | Bacteria | 4739 |
| 425 | Ga0495651_0131351 | 3300046462 | Bacteria | 1827 |
| 426 | Ga0495651_0322871 | 3300046462 | Bacteria | 1028 |
| 427 | Ga0495651_0420881 | 3300046462 | Bacteria | 868 |
| 428 | Ga0495653_0007290 | 3300046463 | Bacteria | 9059 |
| 429 | Ga0495653_0022366 | 3300046463 | Bacteria | 5117 |
| 430 | Ga0495653_0023523 | 3300046463 | Bacteria | 4975 |
| 431 | Ga0495653_0028768 | 3300046463 | Bacteria | 4442 |
| 432 | Ga0495653_0062302 | 3300046463 | Bacteria | 2818 |
| 433 | Ga0495653_0178941 | 3300046463 | Bacteria | 1457 |
| 434 | Ga0495653_0295769 | 3300046463 | Bacteria | 1057 |
| 435 | Ga0495580_0215497 | 3300046472 | Bacteria | 1320 |
| 436 | Ga0495580_0517008 | 3300046472 | Bacteria | 796 |
| 437 | Ga0495580_0527310 | 3300046472 | Bacteria | 786 |
| 438 | Ga0495582_0007263 | 3300046473 | Bacteria | 6143 |
| 439 | Ga0495582_0018490 | 3300046473 | Bacteria | 3811 |
| 440 | Ga0495582_0062622 | 3300046473 | Bacteria | 2055 |
| 441 | Ga0495582_0112157 | 3300046473 | Bacteria | 1532 |
| 442 | Ga0495582_0668951 | 3300046473 | Bacteria | 601 |
| 443 | Ga0495639_0002118 | 3300046475 | Bacteria | 8753 |
| 444 | Ga0495639_0024578 | 3300046475 | Bacteria | 2653 |
| 445 | Ga0495639_0205273 | 3300046475 | Bacteria | 966 |
| 446 | Ga0495662_0010474 | 3300046476 | Bacteria | 4539 |
| 447 | Ga0495662_0100918 | 3300046476 | Bacteria | 1412 |
| 448 | Ga0495664_0161791 | 3300046477 | Bacteria | 1358 |
| 449 | Ga0495664_0174407 | 3300046477 | Bacteria | 1304 |
| 450 | Ga0495664_0397173 | 3300046477 | Bacteria | 828 |
| 451 | Ga0495584_0238676 | 3300046491 | Bacteria | 924 |
| 452 | Ga0495607_0253560 | 3300046501 | Bacteria | 846 |
| 453 | Ga0495608_0002528 | 3300046511 | Bacteria | 13111 |
| 454 | Ga0495608_0062568 | 3300046511 | Bacteria | 2445 |
| 455 | Ga0495608_0309067 | 3300046511 | Bacteria | 978 |
| 456 | Ga0495608_0779373 | 3300046511 | Bacteria | 565 |
| 457 | Ga0495618_0001249 | 3300046514 | Bacteria | 17187 |
| 458 | Ga0495618_0038969 | 3300046514 | Bacteria | 2987 |
| 459 | Ga0495618_0239667 | 3300046514 | Bacteria | 1140 |
| 460 | Ga0495618_0247712 | 3300046514 | Bacteria | 1118 |
| 461 | Ga0495628_0000021 | 3300046516 | Bacteria | 148194 |
| 462 | Ga0495628_0016946 | 3300046516 | Bacteria | 6070 |
| 463 | Ga0495628_0114197 | 3300046516 | Bacteria | 2075 |
| 464 | Ga0495628_0621474 | 3300046516 | Bacteria | 770 |
| 465 | Ga0495630_0002579 | 3300046517 | Bacteria | 12554 |
| 466 | Ga0495630_0399129 | 3300046517 | Bacteria | 1053 |
| 467 | Ga0495630_0740303 | 3300046517 | Bacteria | 752 |
| 468 | Ga0495631_0256022 | 3300046518 | Bacteria | 746 |
| 469 | Ga0495637_0039080 | 3300046520 | Bacteria | 2051 |
| 470 | Ga0495644_0008724 | 3300046523 | Bacteria | 3900 |
| 471 | Ga0495663_0037060 | 3300046525 | Bacteria | 1470 |
| 472 | Ga0495666_0000479 | 3300046526 | Bacteria | 17815 |
| 473 | Ga0495642_0285394 | 3300046528 | Bacteria | 723 |
| 474 | Ga0495652_0008390 | 3300046529 | Bacteria | 9432 |
| 475 | Ga0495652_0010968 | 3300046529 | Bacteria | 8210 |
| 476 | Ga0495652_0020003 | 3300046529 | Bacteria | 5954 |
| 477 | Ga0495652_0026907 | 3300046529 | Bacteria | 5073 |
| 478 | Ga0495652_0047912 | 3300046529 | Bacteria | 3664 |
| 479 | Ga0495652_0409440 | 3300046529 | Bacteria | 958 |
| 480 | Ga0495652_0476501 | 3300046529 | Bacteria | 869 |
| 481 | Ga0495652_0492575 | 3300046529 | Bacteria | 851 |
| 482 | Ga0495665_0008077 | 3300046531 | Bacteria | 5706 |
| 483 | Ga0495665_0246767 | 3300046531 | Bacteria | 920 |
| 484 | Ga0495640_0029833 | 3300046533 | Bacteria | 3909 |
| 485 | Ga0495640_0031909 | 3300046533 | Bacteria | 3756 |
| 486 | Ga0495640_0392055 | 3300046533 | Bacteria | 853 |
| 487 | Ga0495586_0005629 | 3300046535 | Bacteria | 6701 |
| 488 | Ga0495586_0593281 | 3300046535 | Bacteria | 640 |
| 489 | Ga0495587_0000124 | 3300046536 | Bacteria | 59025 |
| 490 | Ga0495587_0039125 | 3300046536 | Bacteria | 2840 |
| 491 | Ga0495587_0303568 | 3300046536 | Bacteria | 892 |
| 492 | Ga0495645_0000019 | 3300046543 | Bacteria | 147666 |
| 493 | Ga0495645_0046927 | 3300046543 | Bacteria | 3148 |
| 494 | Ga0495645_0047077 | 3300046543 | Bacteria | 3142 |
| 495 | Ga0495645_0144916 | 3300046543 | Bacteria | 1654 |
| 496 | Ga0495645_0193158 | 3300046543 | Bacteria | 1386 |
| 497 | Ga0495645_0668685 | 3300046543 | Bacteria | 633 |
| 498 | Ga0495667_0021554 | 3300046559 | Bacteria | 4348 |
| 499 | Ga0495667_0039758 | 3300046559 | Bacteria | 3125 |
| 500 | Ga0495667_0069691 | 3300046559 | Bacteria | 2295 |
| 501 | Ga0495634_0006230 | 3300046642 | Bacteria | 9087 |
| 502 | Ga0495634_0172976 | 3300046642 | Bacteria | 1356 |
| 503 | Ga0495611_0285450 | 3300046648 | Bacteria | 762 |
| 504 | Ga0495635_0032353 | 3300046663 | Bacteria | 3628 |
| 505 | Ga0495635_0033587 | 3300046663 | Bacteria | 3559 |
| 506 | Ga0495635_0044832 | 3300046663 | Bacteria | 3050 |
| 507 | Ga0495635_0069933 | 3300046663 | Bacteria | 2406 |
| 508 | Ga0495588_0097782 | 3300046674 | Bacteria | 1541 |
| 509 | Ga0495657_0007055 | 3300046675 | Bacteria | 8716 |
| 510 | Ga0495657_0102791 | 3300046675 | Bacteria | 1818 |
| 511 | Ga0495657_0172249 | 3300046675 | Bacteria | 1332 |
| 512 | Ga0495599_0001901 | 3300046678 | Bacteria | 12092 |
| 513 | Ga0495599_0020437 | 3300046678 | Bacteria | 4123 |
| 514 | Ga0495599_0170454 | 3300046678 | Bacteria | 1343 |
| 515 | Ga0495599_0207758 | 3300046678 | Bacteria | 1201 |
| 516 | Ga0495599_0595664 | 3300046678 | Bacteria | 644 |
| 517 | Ga0495623_0000978 | 3300046679 | Bacteria | 19262 |
| 518 | Ga0495623_0026570 | 3300046679 | Bacteria | 3725 |
| 519 | Ga0495646_0030143 | 3300046680 | Bacteria | 3388 |
| 520 | Ga0495646_0068871 | 3300046680 | Bacteria | 2088 |
| 521 | Ga0495646_0073311 | 3300046680 | Bacteria | 2011 |
| 522 | Ga0495646_0154551 | 3300046680 | Bacteria | 1274 |
| 523 | Ga0495647_0000238 | 3300046681 | Bacteria | 15019 |
| 524 | Ga0495647_0121383 | 3300046681 | Bacteria | 1099 |
| 525 | Ga0495658_0157530 | 3300046683 | Bacteria | 1398 |
| 526 | Ga0495658_0184129 | 3300046683 | Bacteria | 1296 |
| 527 | Ga0495658_0450433 | 3300046683 | Bacteria | 822 |
| 528 | Ga0495613_0010957 | 3300046689 | Bacteria | 6729 |
| 529 | Ga0495613_0015477 | 3300046689 | Bacteria | 5672 |
| 530 | Ga0495624_0003569 | 3300046690 | Bacteria | 11520 |
| 531 | Ga0495624_0025342 | 3300046690 | Bacteria | 3895 |
| 532 | Ga0495624_0363097 | 3300046690 | Bacteria | 871 |
| 533 | Ga0495624_0390436 | 3300046690 | Bacteria | 836 |
| 534 | Ga0495670_0106125 | 3300046691 | Bacteria | 1451 |
| 535 | Ga0495600_0044794 | 3300046809 | Bacteria | 2886 |
| 536 | Ga0495600_0117278 | 3300046809 | Bacteria | 1732 |
| 537 | Ga0495600_0495263 | 3300046809 | Bacteria | 751 |
| 538 | Ga0495581_0006455 | 3300047315 | Bacteria | 6805 |
| 539 | Ga0495581_0440340 | 3300047315 | Bacteria | 759 |
| 540 | Ga0495581_0715733 | 3300047315 | Bacteria | 577 |
| 541 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 542 | Ga0495604_0016095 | 3300047317 | Bacteria | 5973 |
| 543 | Ga0495604_0065387 | 3300047317 | Bacteria | 2769 |
| 544 | Ga0495604_0176143 | 3300047317 | Bacteria | 1499 |
| 545 | Ga0495604_0238778 | 3300047317 | Bacteria | 1244 |
| 546 | Ga0495674_0107457 | 3300047319 | Bacteria | 2368 |
| 547 | Ga0495674_0145400 | 3300047319 | Bacteria | 1990 |
| 548 | Ga0495674_0148486 | 3300047319 | Bacteria | 1967 |
| 549 | Ga0495674_0303994 | 3300047319 | Bacteria | 1302 |
| 550 | Ga0495674_0325802 | 3300047319 | Bacteria | 1250 |
| 551 | Ga0495674_0552405 | 3300047319 | Bacteria | 916 |
| 552 | Ga0495674_0685492 | 3300047319 | Bacteria | 805 |
| 553 | Ga0495674_0772422 | 3300047319 | Bacteria | 749 |
| 554 | Ga0495674_0899881 | 3300047319 | Bacteria | 683 |
| 555 | Ga0495676_0032564 | 3300047321 | Bacteria | 4398 |
| 556 | Ga0495676_0077633 | 3300047321 | Bacteria | 2532 |
| 557 | Ga0495676_0087845 | 3300047321 | Bacteria | 2334 |
| 558 | Ga0495676_0185056 | 3300047321 | Bacteria | 1457 |
| 559 | Ga0495676_0216423 | 3300047321 | Bacteria | 1322 |
| 560 | Ga0495680_0002085 | 3300047322 | Bacteria | 20797 |
| 561 | Ga0495680_0018277 | 3300047322 | Bacteria | 5957 |
| 562 | Ga0495680_0036510 | 3300047322 | Bacteria | 3944 |
| 563 | Ga0495680_0078550 | 3300047322 | Bacteria | 2497 |
| 564 | Ga0495680_0118620 | 3300047322 | Bacteria | 1955 |
| 565 | Ga0495680_0475889 | 3300047322 | Bacteria | 851 |
| 566 | Ga0495675_0000079 | 3300047444 | Bacteria | 68947 |
| 567 | Ga0495675_0610038 | 3300047444 | Bacteria | 618 |
| 568 | Ga0495684_0009805 | 3300047471 | Bacteria | 7392 |
| 569 | Ga0495684_0030715 | 3300047471 | Bacteria | 4125 |
| 570 | Ga0495684_0032228 | 3300047471 | Bacteria | 4022 |
| 571 | Ga0495684_0209681 | 3300047471 | Bacteria | 1433 |
| 572 | Ga0495684_0288765 | 3300047471 | Bacteria | 1181 |
| 573 | Ga0495684_0634470 | 3300047471 | Bacteria | 716 |
| 574 | Ga0495593_0001046 | 3300047673 | Bacteria | 16226 |
| 575 | Ga0495593_0046714 | 3300047673 | Bacteria | 2306 |
| 576 | Ga0495602_0000351 | 3300048088 | Bacteria | 42756 |
| 577 | Ga0495602_0067495 | 3300048088 | Bacteria | 3077 |
| 578 | Ga0495614_0001947 | 3300048089 | Bacteria | 9066 |
| 579 | Ga0496100_0455392 | 3300048903 | Bacteria | 981 |
| 580 | Ga0496100_0536295 | 3300048903 | Bacteria | 904 |
| 581 | Ga0496101_0063472 | 3300048904 | Bacteria | 2689 |
| 582 | Ga0496101_0310768 | 3300048904 | Bacteria | 1235 |
| 583 | Ga0496101_0942486 | 3300048904 | Bacteria | 679 |
| 584 | Ga0496102_0003999 | 3300048905 | Bacteria | 12483 |
| 585 | Ga0496102_0015570 | 3300048905 | Bacteria | 6625 |
| 586 | Ga0496103_0022161 | 3300048906 | Bacteria | 3824 |
| 587 | Ga0496104_0160252 | 3300048907 | Bacteria | 2158 |
| 588 | Ga0496104_1286458 | 3300048907 | Bacteria | 634 |
| 589 | Ga0496105_0011731 | 3300048908 | Bacteria | 6934 |
| 590 | Ga0496105_0091474 | 3300048908 | Bacteria | 2512 |
| 591 | Ga0496106_0003413 | 3300048909 | Bacteria | 11840 |
| 592 | Ga0496106_0305923 | 3300048909 | Bacteria | 1275 |
| 593 | Ga0496106_0732177 | 3300048909 | Bacteria | 787 |
| 594 | Ga0496107_0001364 | 3300048910 | Bacteria | 15012 |
| 595 | Ga0496107_0102878 | 3300048910 | Bacteria | 2095 |
| 596 | Ga0496107_0122465 | 3300048910 | Bacteria | 1916 |
| 597 | Ga0496107_0137863 | 3300048910 | Bacteria | 1803 |
| 598 | Ga0496107_0397612 | 3300048910 | Bacteria | 1025 |
| 599 | Ga0496107_0435292 | 3300048910 | Bacteria | 975 |
| 600 | Ga0496108_0037589 | 3300048911 | Bacteria | 4033 |
| 601 | Ga0496108_0136049 | 3300048911 | Bacteria | 2114 |
| 602 | Ga0496108_0938697 | 3300048911 | Bacteria | 741 |
| 603 | Ga0496109_0203790 | 3300048912 | Bacteria | 1860 |
| 604 | Ga0496109_0240620 | 3300048912 | Bacteria | 1703 |
| 605 | Ga0496109_0286883 | 3300048912 | Bacteria | 1551 |
| 606 | Ga0496109_0412458 | 3300048912 | Bacteria | 1276 |
| 607 | Ga0496109_1254524 | 3300048912 | Bacteria | 677 |
| 608 | Ga0496110_0206608 | 3300048913 | Bacteria | 1785 |
| 609 | Ga0496110_0257468 | 3300048913 | Bacteria | 1588 |
| 610 | Ga0496110_0697261 | 3300048913 | Bacteria | 917 |
| 611 | Ga0496110_1376401 | 3300048913 | Bacteria | 615 |
| 612 | Ga0496111_0067587 | 3300048914 | Bacteria | 2596 |
| 613 | Ga0496111_0211736 | 3300048914 | Bacteria | 1440 |
| 614 | Ga0496111_0245162 | 3300048914 | Bacteria | 1330 |
| 615 | Ga0496112_0112506 | 3300048915 | Bacteria | 2693 |
| 616 | Ga0496112_0133554 | 3300048915 | Bacteria | 2452 |
| 617 | Ga0496112_0188591 | 3300048915 | Bacteria | 2024 |
| 618 | Ga0496112_0313828 | 3300048915 | Bacteria | 1513 |
| 619 | Ga0496112_0507720 | 3300048915 | Bacteria | 1141 |
| 620 | Ga0496112_0516943 | 3300048915 | Bacteria | 1129 |
| 621 | Ga0496113_0118731 | 3300048916 | Bacteria | 2065 |
| 622 | Ga0496113_0390746 | 3300048916 | Bacteria | 1117 |
| 623 | Ga0496113_0416110 | 3300048916 | Bacteria | 1079 |
| 624 | Ga0496114_0028338 | 3300048917 | Bacteria | 4595 |
| 625 | Ga0496114_0080992 | 3300048917 | Bacteria | 2742 |
| 626 | Ga0496114_0110557 | 3300048917 | Bacteria | 2354 |
| 627 | Ga0496114_0286651 | 3300048917 | Bacteria | 1452 |
| 628 | Ga0496114_0301643 | 3300048917 | Bacteria | 1414 |
| 629 | Ga0496115_0005198 | 3300048918 | Bacteria | 9464 |
| 630 | Ga0496115_0039513 | 3300048918 | Bacteria | 3747 |
| 631 | Ga0496115_0048533 | 3300048918 | Bacteria | 3396 |
| 632 | Ga0496115_0140104 | 3300048918 | Bacteria | 1995 |
| 633 | Ga0496115_0158454 | 3300048918 | Bacteria | 1870 |
| 634 | Ga0496115_0173375 | 3300048918 | Bacteria | 1783 |
| 635 | Ga0496115_0319923 | 3300048918 | Bacteria | 1269 |
| 636 | Ga0501047_0164559 | 3300049581 | Bacteria | 2089 |
| 637 | Ga0501047_0813426 | 3300049581 | Bacteria | 749 |
| 638 | Ga0501067_0043485 | 3300049583 | Bacteria | 2495 |
| 639 | Ga0501067_0105887 | 3300049583 | Bacteria | 1563 |
| 640 | Ga0501067_0432892 | 3300049583 | Bacteria | 734 |
| 641 | Ga0501069_0066269 | 3300049585 | Bacteria | 2019 |
| 642 | Ga0501070_0007826 | 3300049586 | Bacteria | 9058 |
| 643 | Ga0501072_0019524 | 3300049588 | Bacteria | 5241 |
| 644 | Ga0501073_0546790 | 3300049589 | Bacteria | 800 |
| 645 | Ga0501074_0037721 | 3300049590 | Bacteria | 3502 |
| 646 | Ga0501079_0119825 | 3300049741 | Bacteria | 2046 |
| 647 | Ga0501080_0340990 | 3300049742 | Bacteria | 1354 |
| 648 | Ga0501080_0607355 | 3300049742 | Bacteria | 970 |
| 649 | Ga0501080_0759876 | 3300049742 | Bacteria | 852 |
| 650 | Ga0501083_0046861 | 3300049744 | Bacteria | 2922 |
| 651 | nmdc:mga08y16_660141_c1 | 3300050511 | Bacteria | 1049 |
| 652 | nmdc:mga0n895_1236363_c1 | 3300050512 | Bacteria | 720 |
| 653 | nmdc:mga0n895_20054_c1 | 3300050512 | Bacteria | 6226 |
| 654 | nmdc:mga0rr50_144402_c1 | 3300050513 | Bacteria | 1917 |
| 655 | nmdc:mga0a205_424067_c1 | 3300050515 | Bacteria | 1192 |
| 656 | Ga0495601_0000215 | 3300053077 | Bacteria | 31042 |
| 657 | Ga0495601_0006394 | 3300053077 | Bacteria | 6888 |
| 658 | Ga0495601_0010126 | 3300053077 | Bacteria | 5600 |
| 659 | Ga0495601_0063685 | 3300053077 | Bacteria | 2344 |
| 660 | Ga0495601_0110381 | 3300053077 | Bacteria | 1781 |
| 661 | Ga0495601_0271744 | 3300053077 | Bacteria | 1106 |
| 662 | Ga0495601_0348251 | 3300053077 | Bacteria | 963 |
| 663 | Ga0495601_0755420 | 3300053077 | Bacteria | 618 |
| 664 | Ga0495612_0004654 | 3300053078 | Bacteria | 5682 |
| 665 | Ga0495612_0028532 | 3300053078 | Bacteria | 2247 |
| 666 | Ga0495612_0055344 | 3300053078 | Bacteria | 1635 |
| 667 | Ga0495612_0084780 | 3300053078 | Bacteria | 1335 |
| 668 | Ga0495595_0006619 | 3300053084 | Bacteria | 4730 |
| 669 | Ga0495595_0022717 | 3300053084 | Bacteria | 2755 |
| 670 | Ga0495595_0050136 | 3300053084 | Bacteria | 1932 |
| 671 | Ga0495595_0226930 | 3300053084 | Bacteria | 932 |
| 672 | Ga0495619_0000199 | 3300053085 | Bacteria | 43846 |
| 673 | Ga0495619_0005873 | 3300053085 | Bacteria | 7777 |
| 674 | Ga0495619_0097727 | 3300053085 | Bacteria | 1995 |
| 675 | Ga0495619_0123780 | 3300053085 | Bacteria | 1774 |
| 676 | Ga0495619_0133080 | 3300053085 | Bacteria | 1709 |
| 677 | Ga0495619_0189472 | 3300053085 | Bacteria | 1423 |
| 678 | Ga0466962_0021393 | 3300061719 | Bacteria | 3106 |
| 679 | Ga0466962_0029963 | 3300061719 | Bacteria | 2605 |
| 680 | Ga0466962_0061969 | 3300061719 | Bacteria | 1785 |
| 681 | Ga0466962_0091737 | 3300061719 | Bacteria | 1456 |
| 682 | Ga0466962_0092311 | 3300061719 | Bacteria | 1451 |
| 683 | Ga0466962_0248421 | 3300061719 | Bacteria | 874 |
| 684 | Ga0070695_100852914 | |||
| 685 | Ga0070658_10003363 | |||
| 686 | Ga0070658_10008023 | |||
| 687 | Ga0070683_100382412 | |||
| 688 | Ga0070680_100026510 | |||
| 689 | Ga0070680_100103063 | |||
| 690 | Ga0070680_100319456 | |||
| 691 | Ga0070682_100027014 | |||
| 692 | Ga0068868_100970662 | |||
| 693 | Ga0070660_100011701 | |||
| 694 | Ga0070660_100073607 | |||
| 695 | Ga0070660_100542571 | |||
| 696 | Ga0070691_10027113 | |||
| 697 | Ga0070661_100645965 | |||
| 698 | Ga0070692_10297649 | |||
| 699 | Ga0070675_101844156 | |||
| 700 | Ga0070671_101255142 | |||
| 701 | Ga0070659_100097798 | |||
| 702 | Ga0070659_100778860 | |||
| 703 | Ga0070703_10040362 | |||
| 704 | Ga0070709_10021226 | |||
| 705 | Ga0070709_10038852 | |||
| 706 | Ga0070709_10496892 | |||
| 707 | Ga0070714_100023743 | |||
| 708 | Ga0070714_100048058 | |||
| 709 | Ga0070714_100048513 | |||
| 710 | Ga0070714_100104642 | |||
| 711 | Ga0070714_100126871 | |||
| 712 | Ga0070714_100137256 | |||
| 713 | Ga0070714_100666706 | |||
| 714 | Ga0070714_100725686 | |||
| 715 | Ga0070714_101239370 | |||
| 716 | Ga0070713_100038507 | |||
| 717 | Ga0070713_100104944 | |||
| 718 | Ga0070713_100191580 | |||
| 719 | Ga0070710_10020928 | |||
| 720 | Ga0070710_10079832 | |||
| 721 | Ga0070710_10313117 | |||
| 722 | Ga0070711_100050663 | |||
| 723 | Ga0070711_100146865 | |||
| 724 | Ga0070711_100150975 | |||
| 725 | Ga0070705_100205320 | |||
| 726 | Ga0070681_10250640 | |||
| 727 | Ga0070681_10591856 | |||
| 728 | Ga0070681_10713265 | |||
| 729 | Ga0070707_100000749 | |||
| 730 | Ga0070707_100086626 | |||
| 731 | Ga0070707_100511585 | |||
| 732 | Ga0070707_101092348 | |||
| 733 | Ga0070698_101302249 | |||
| 734 | Ga0070698_101687834 | |||
| 735 | Ga0070679_100093954 | |||
| 736 | Ga0070679_100101331 | |||
| 737 | Ga0070679_100692531 | |||
| 738 | Ga0070684_100278737 | |||
| 739 | Ga0070684_100355677 | |||
| 740 | Ga0070684_100379607 | |||
| 741 | Ga0070684_101027186 | |||
| 742 | Ga0068853_101411437 | |||
| 743 | Ga0070695_100000583 | |||
| 744 | Ga0070693_100519144 | |||
| 745 | Ga0070704_101163057 | |||
| 746 | Ga0068855_100079888 | |||
| 747 | Ga0068855_100470921 | |||
| 748 | Ga0068855_100792676 | |||
| 749 | Ga0070664_100247817 | |||
| 750 | Ga0068856_100140350 | |||
| 751 | Ga0068856_100357358 | |||
| 752 | Ga0068852_100032146 | |||
| 753 | Ga0068852_100398953 | |||
| 754 | Ga0068851_10061579 | |||
| 755 | Ga0068863_100415804 | |||
| 756 | Ga0070717_10026710 | |||
| 757 | Ga0070717_10040261 | |||
| 758 | Ga0070717_10092259 | |||
| 759 | Ga0070717_10299935 | |||
| 760 | Ga0070717_10392030 | |||
| 761 | Ga0070717_10582431 | |||
| 762 | Ga0070717_11143484 | |||
| 763 | Ga0075432_10157634 | |||
| 764 | Ga0070715_10001386 | |||
| 765 | Ga0070716_100018405 | |||
| 766 | Ga0070716_101068539 | |||
| 767 | Ga0070712_100013667 | |||
| 768 | Ga0070712_100309807 | |||
| 769 | Ga0070712_100732739 | |||
| 770 | Ga0070712_100904444 | |||
| 771 | Ga0070712_101030630 | |||
| 772 | Ga0070712_101289864 | |||
| 773 | Ga0068871_101054439 | |||
| 774 | Ga0075433_10662510 | |||
| 775 | Ga0075434_100006191 | |||
| 776 | Ga0075434_100937849 | |||
| 777 | Ga0105240_10011956 | |||
| 778 | Ga0105240_10559799 | |||
| 779 | Ga0105240_10820321 | |||
| 780 | Ga0111539_10398492 | |||
| 781 | Ga0105245_10145412 | |||
| 782 | Ga0105245_10599181 | |||
| 783 | Ga0105247_10164523 | |||
| 784 | Ga0105237_11977640 | |||
| 785 | Ga0105238_10419450 | |||
| 786 | Ga0105238_10479318 | |||
| 787 | Ga0105238_11754993 | |||
| 788 | Ga0105239_12040381 | |||
| 789 | Ga0157373_10086945 | |||
| 790 | Ga0157371_10180699 | |||
| 791 | Ga0157371_10233848 | |||
| 792 | Ga0157370_10004057 | |||
| 793 | Ga0157370_10087012 | |||
| 794 | Ga0157369_10013539 | |||
| 795 | Ga0157369_10016140 | |||
| 796 | Ga0157369_10275348 | |||
| 797 | Ga0157369_10308401 | |||
| 798 | Ga0157369_10974694 | |||
| 799 | Ga0157369_11228957 | |||
| 800 | Ga0157369_11698235 | |||
| 801 | Ga0157374_10033432 | |||
| 802 | Ga0163162_11279437 | |||
| 803 | Ga0157372_10135898 | |||
| 804 | Ga0157372_10222731 | |||
| 805 | Ga0157372_10379178 | |||
| 806 | Ga0157372_10518432 | |||
| 807 | Ga0157375_11371696 | |||
| 808 | Ga0163163_11063372 | |||
| 809 | Ga0157380_12274680 | |||
| 810 | Ga0182008_10083895 | |||
| 811 | Ga0182008_10199046 | |||
| 812 | Ga0182008_10613042 | |||
| 813 | Ga0157377_10985693 | |||
| 814 | Ga0157379_11963806 | |||
| 815 | Ga0197907_10430093 | |||
| 816 | Ga0197907_10848793 | |||
| 817 | Ga0206356_10342049 | |||
| 818 | Ga0206356_11555266 | |||
| 819 | Ga0206354_11058585 | |||
| 820 | Ga0206354_11270280 | |||
| 821 | Ga0206353_11956207 | |||
| 822 | Ga0206353_12060517 | |||
| 823 | Ga0213871_10004517 | |||
| 824 | Ga0224712_10092199 | |||
| 825 | Ga0207692_10066978 | |||
| 826 | Ga0207692_10132714 | |||
| 827 | Ga0207692_10457883 | |||
| 828 | Ga0207710_10257880 | |||
| 829 | Ga0207647_10332571 | |||
| 830 | Ga0207685_10003909 | |||
| 831 | Ga0207699_10001178 | |||
| 832 | Ga0207699_10176688 | |||
| 833 | Ga0207699_10319261 | |||
| 834 | Ga0207705_10050549 | |||
| 835 | Ga0207705_10100246 | |||
| 836 | Ga0207705_10152249 | |||
| 837 | Ga0207707_10412695 | |||
| 838 | Ga0207695_10016796 | |||
| 839 | Ga0207695_10111124 | |||
| 840 | Ga0207695_10980474 | |||
| 841 | Ga0207671_10137187 | |||
| 842 | Ga0207693_10035582 | |||
| 843 | Ga0207693_10046723 | |||
| 844 | Ga0207693_10137432 | |||
| 845 | Ga0207693_10394479 | |||
| 846 | Ga0207663_10003256 | |||
| 847 | Ga0207663_10223873 | |||
| 848 | Ga0207660_10067530 | |||
| 849 | Ga0207660_10192540 | |||
| 850 | Ga0207660_10352530 | |||
| 851 | Ga0207660_10669003 | |||
| 852 | Ga0207657_10005594 | |||
| 853 | Ga0207657_10005928 | |||
| 854 | Ga0207657_10081884 | |||
| 855 | Ga0207652_10334067 | |||
| 856 | Ga0207652_10447758 | |||
| 857 | Ga0207652_10669678 | |||
| 858 | Ga0207652_10686484 | |||
| 859 | Ga0207646_10002360 | |||
| 860 | Ga0207646_10089722 | |||
| 861 | Ga0207694_10633381 | |||
| 862 | Ga0207694_10677579 | |||
| 863 | Ga0207687_10718664 | |||
| 864 | Ga0207700_10466675 | |||
| 865 | Ga0207700_10631261 | |||
| 866 | Ga0207700_11120762 | |||
| 867 | Ga0207700_11232749 | |||
| 868 | Ga0207664_10002396 | |||
| 869 | Ga0207664_10023655 | |||
| 870 | Ga0207664_10033561 | |||
| 871 | Ga0207664_10129154 | |||
| 872 | Ga0207664_10142408 | |||
| 873 | Ga0207664_10339451 | |||
| 874 | Ga0207664_10547300 | |||
| 875 | Ga0207664_10890868 | |||
| 876 | Ga0207664_11014252 | |||
| 877 | Ga0207644_10483455 | |||
| 878 | Ga0207644_10693430 | |||
| 879 | Ga0207690_10141861 | |||
| 880 | Ga0207690_10257311 | |||
| 881 | Ga0207665_10019245 | |||
| 882 | Ga0207665_10750082 | |||
| 883 | Ga0207661_10214394 | |||
| 884 | Ga0207667_10044140 | |||
| 885 | Ga0207667_10326948 | |||
| 886 | Ga0207667_10333116 | |||
| 887 | Ga0207667_10700956 | |||
| 888 | Ga0207712_10730651 | |||
| 889 | Ga0207677_11377871 | |||
| 890 | Ga0207639_10843467 | |||
| 891 | Ga0207702_10695189 | |||
| 892 | Ga0207674_10240051 | |||
| 893 | Ga0207698_10193985 | |||
| 894 | Ga0207428_10453862 | |||
| 895 | Ga0265319_1021723 | |||
| 896 | Ga0265319_1067336 | |||
| 897 | Ga0265319_1130111 | |||
| 898 | Ga0265318_10118973 | |||
| 899 | Ga0265336_10002075 | |||
| 900 | Ga0265338_10092584 | |||
| 901 | Ga0265338_10594984 | |||
| 902 | Ga0265340_10084026 | |||
| 903 | Ga0265339_10460582 | |||
| 904 | Ga0316583_10080480 | |||
| 905 | Ga0373926_0069841 | |||
| 906 | Ga0373928_0042498 | |||
| 907 | Ga0373940_0058721 | |||
| 908 | Ga0373944_0148974 | |||
| 909 | Ga0373923_0114126 | |||
| 910 | Ga0373923_0457119 | |||
| 911 | Ga0373932_0089980 | |||
| 912 | Ga0373936_0115645 | |||
| 913 | Ga0373945_0274479 | |||
| 914 | Ga0373953_0084094 | |||
| 915 | Ga0373956_0137336 | |||
| 916 | Ga0373957_0087415 | |||
| 917 | Ga0373957_0260631 | |||
| 918 | Ga0373943_0000738 | |||
| 919 | Ga0373943_0006212 | |||
| 920 | Ga0373946_0015992 | |||
| 921 | Ga0373946_0165045 | |||
| 922 | Ga0373955_0109003 | |||
| 923 | Ga0373962_0101823 | |||
| 924 | Ga0373931_0286931 | |||
| 925 | Ga0373935_0052842 | |||
| 926 | Ga0373935_0161794 | |||
| 927 | Ga0373935_0455158 | |||
| 928 | Ga0373933_0435006 | |||
| 929 | Ga0373933_0463099 | |||
| 930 | Ga0373933_0671424 | |||
| 931 | Ga0373947_0000730 | |||
| 932 | Ga0373947_0002451 | |||
| 933 | Ga0373937_0000962 | |||
| 934 | Ga0373937_0349021 | |||
| 935 | Ga0373937_1372237 | |||
| 936 | Ga0373925_0002688 | |||
| 937 | Ga0373925_0021802 | |||
| 938 | Ga0395899_0052537 | |||
| 939 | Ga0395899_0111793 | |||
| 940 | Ga0395900_0014436 | |||
| 941 | Ga0395900_0029861 | |||
| 942 | Ga0395900_0089672 | |||
| 943 | Ga0395900_0613149 | |||
| 944 | Ga0395900_0882201 | |||
| 945 | Ga0395898_0046233 | |||
| 946 | Ga0395898_0170413 | |||
| 947 | Ga0395898_0240576 | |||
| 948 | Ga0395898_0623074 | |||
| 949 | Ga0395898_0699586 | |||
| 950 | Ga0395898_0997431 | |||
| 951 | Ga0395898_1229199 | |||
| 952 | Ga0395898_1279710 | |||
| 953 | Ga0395905_0039984 | |||
| 954 | Ga0395905_0492842 | |||
| 955 | Ga0395905_0823736 | |||
| 956 | Ga0395901_0059921 | |||
| 957 | Ga0395901_0320669 | |||
| 958 | Ga0395901_1257041 | |||
| 959 | Ga0436360_0819159 | |||
| 960 | Ga0451807_1817466 | |||
| 961 | Ga0451849_0315474 | |||
| 962 | Ga0439448_0312755 | |||
| 963 | Ga0466969_0024468 | |||
| 964 | Ga0466969_0031528 | |||
| 965 | Ga0466969_0093658 | |||
| 966 | Ga0466969_0102466 | |||
| 967 | Ga0466972_0027424 | |||
| 968 | Ga0466965_0016848 | |||
| 969 | Ga0466965_0030609 | |||
| 970 | Ga0466965_0073360 | |||
| 971 | Ga0466966_0036859 | |||
| 972 | Ga0466966_0099432 | |||
| 973 | Ga0466966_0119913 | |||
| 974 | Ga0466966_0288139 | |||
| 975 | Ga0466961_0000475 | |||
| 976 | Ga0466961_0019463 | |||
| 977 | Ga0466961_0028462 | |||
| 978 | Ga0466961_0033941 | |||
| 979 | Ga0466961_0105512 | |||
| 980 | Ga0466961_0494233 | |||
| 981 | Ga0466961_0890614 | |||
| 982 | Ga0466963_0001550 | |||
| 983 | Ga0466963_0002141 | |||
| 984 | Ga0466963_0002256 | |||
| 985 | Ga0466963_0002339 | |||
| 986 | Ga0466963_0002586 | |||
| 987 | Ga0466963_0003600 | |||
| 988 | Ga0466963_0016028 | |||
| 989 | Ga0466963_0029183 | |||
| 990 | Ga0466963_0032375 | |||
| 991 | Ga0466963_0046252 | |||
| 992 | Ga0466963_0055416 | |||
| 993 | Ga0466963_0061506 | |||
| 994 | Ga0466963_0079090 | |||
| 995 | Ga0466963_0130657 | |||
| 996 | Ga0466963_0150782 | |||
| 997 | Ga0466963_0206375 | |||
| 998 | Ga0466963_0243067 | |||
| 999 | Ga0466963_0342836 | |||
| 1000 | Ga0466963_0470506 | |||
| 1001 | Ga0466964_0001854 | |||
| 1002 | Ga0466964_0007772 | |||
| 1003 | Ga0466964_0012768 | |||
| 1004 | Ga0466964_0021271 | |||
| 1005 | Ga0466964_0038985 | |||
| 1006 | Ga0466964_0046041 | |||
| 1007 | Ga0466964_0067961 | |||
| 1008 | Ga0466964_0177274 | |||
| 1009 | Ga0466964_0593587 | |||
| 1010 | Ga0453684_1202536 | |||
| 1011 | Ga0466971_0010564 | |||
| 1012 | Ga0466971_0073108 | |||
| 1013 | Ga0466971_0082899 | |||
| 1014 | Ga0466971_0102663 | |||
| 1015 | Ga0466971_0132765 | |||
| 1016 | Ga0466971_0157934 | |||
| 1017 | Ga0466971_0188351 | |||
| 1018 | Ga0466971_0224500 | |||
| 1019 | Ga0466971_0484449 | |||
| 1020 | Ga0466968_0014365 | |||
| 1021 | Ga0466968_0033268 | |||
| 1022 | Ga0466968_0043358 | |||
| 1023 | Ga0466968_0209058 | |||
| 1024 | Ga0466968_0431785 | |||
| 1025 | Ga0466970_0025207 | |||
| 1026 | Ga0466970_0058484 | |||
| 1027 | Ga0466970_0179755 | |||
| 1028 | Ga0466957_0013103 | |||
| 1029 | Ga0466957_0013483 | |||
| 1030 | Ga0466957_0020518 | |||
| 1031 | Ga0466957_0022584 | |||
| 1032 | Ga0466957_0078527 | |||
| 1033 | Ga0466957_0112550 | |||
| 1034 | Ga0466957_0171765 | |||
| 1035 | Ga0466957_0196151 | |||
| 1036 | Ga0466957_0236242 | |||
| 1037 | Ga0466957_0270065 | |||
| 1038 | Ga0466957_0361522 | |||
| 1039 | Ga0466960_0021505 | |||
| 1040 | Ga0466960_0030365 | |||
| 1041 | Ga0466960_0143809 | |||
| 1042 | Ga0466960_0360611 | |||
| 1043 | Ga0466960_0864582 | |||
| 1044 | Ga0466959_0000543 | |||
| 1045 | Ga0466959_0017426 | |||
| 1046 | Ga0466959_0048228 | |||
| 1047 | Ga0466959_0059224 | |||
| 1048 | Ga0466959_0139788 | |||
| 1049 | Ga0466959_0241832 | |||
| 1050 | Ga0466959_0318363 | |||
| 1051 | Ga0451576_2040969 | |||
| 1052 | Ga0466958_0001935 | |||
| 1053 | Ga0466958_0002986 | |||
| 1054 | Ga0466958_0012611 | |||
| 1055 | Ga0466958_0025441 | |||
| 1056 | Ga0466958_0028119 | |||
| 1057 | Ga0466958_0039251 | |||
| 1058 | Ga0466958_0040067 | |||
| 1059 | Ga0466958_0055667 | |||
| 1060 | Ga0466958_0150957 | |||
| 1061 | Ga0466958_0175968 | |||
| 1062 | Ga0466958_0220443 | |||
| 1063 | Ga0466958_0335841 | |||
| 1064 | Ga0466958_0571161 | |||
| 1065 | Ga0466958_0887717 | |||
| 1066 | Ga0466967_0001167 | |||
| 1067 | Ga0466967_0001868 | |||
| 1068 | Ga0466967_0003238 | |||
| 1069 | Ga0466967_0003931 | |||
| 1070 | Ga0466967_0004634 | |||
| 1071 | Ga0466967_0004962 | |||
| 1072 | Ga0466967_0005147 | |||
| 1073 | Ga0466967_0035758 | |||
| 1074 | Ga0466967_0063003 | |||
| 1075 | Ga0466967_0070262 | |||
| 1076 | Ga0466967_0084626 | |||
| 1077 | Ga0466967_0110359 | |||
| 1078 | Ga0466967_0118810 | |||
| 1079 | Ga0466967_0138324 | |||
| 1080 | Ga0466967_0189614 | |||
| 1081 | Ga0466967_0201925 | |||
| 1082 | Ga0466967_0250938 | |||
| 1083 | Ga0466967_0290177 | |||
| 1084 | Ga0466967_0406427 | |||
| 1085 | Ga0466967_0423987 | |||
| 1086 | Ga0466967_0518132 | |||
| 1087 | Ga0466967_0876146 | |||
| 1088 | Ga0466967_0941507 | |||
| 1089 | Ga0466967_1019677 | |||
| 1090 | Ga0466967_1267862 | |||
| 1091 | Ga0495592_0000014 | |||
| 1092 | Ga0495592_0061868 | |||
| 1093 | Ga0495592_0382310 | |||
| 1094 | Ga0495603_0009981 | |||
| 1095 | Ga0495603_0081089 | |||
| 1096 | Ga0495603_0381232 | |||
| 1097 | Ga0495629_0007288 | |||
| 1098 | Ga0495629_0035913 | |||
| 1099 | Ga0495629_0075290 | |||
| 1100 | Ga0495629_0273936 | |||
| 1101 | Ga0495641_0023088 | |||
| 1102 | Ga0495641_0084935 | |||
| 1103 | Ga0495641_0116847 | |||
| 1104 | Ga0495641_0123245 | |||
| 1105 | Ga0495641_0461723 | |||
| 1106 | Ga0495651_0000049 | |||
| 1107 | Ga0495651_0024052 | |||
| 1108 | Ga0495651_0131351 | |||
| 1109 | Ga0495651_0322871 | |||
| 1110 | Ga0495651_0420881 | |||
| 1111 | Ga0495653_0007290 | |||
| 1112 | Ga0495653_0022366 | |||
| 1113 | Ga0495653_0023523 | |||
| 1114 | Ga0495653_0028768 | |||
| 1115 | Ga0495653_0062302 | |||
| 1116 | Ga0495653_0178941 | |||
| 1117 | Ga0495653_0295769 | |||
| 1118 | Ga0495580_0215497 | |||
| 1119 | Ga0495580_0517008 | |||
| 1120 | Ga0495580_0527310 | |||
| 1121 | Ga0495582_0007263 | |||
| 1122 | Ga0495582_0018490 | |||
| 1123 | Ga0495582_0062622 | |||
| 1124 | Ga0495582_0112157 | |||
| 1125 | Ga0495582_0668951 | |||
| 1126 | Ga0495639_0002118 | |||
| 1127 | Ga0495639_0024578 | |||
| 1128 | Ga0495639_0205273 | |||
| 1129 | Ga0495662_0010474 | |||
| 1130 | Ga0495662_0100918 | |||
| 1131 | Ga0495664_0161791 | |||
| 1132 | Ga0495664_0174407 | |||
| 1133 | Ga0495664_0397173 | |||
| 1134 | Ga0495584_0238676 | |||
| 1135 | Ga0495607_0253560 | |||
| 1136 | Ga0495608_0002528 | |||
| 1137 | Ga0495608_0062568 | |||
| 1138 | Ga0495608_0309067 | |||
| 1139 | Ga0495608_0779373 | |||
| 1140 | Ga0495618_0001249 | |||
| 1141 | Ga0495618_0038969 | |||
| 1142 | Ga0495618_0239667 | |||
| 1143 | Ga0495618_0247712 | |||
| 1144 | Ga0495628_0000021 | |||
| 1145 | Ga0495628_0016946 | |||
| 1146 | Ga0495628_0114197 | |||
| 1147 | Ga0495628_0621474 | |||
| 1148 | Ga0495630_0002579 | |||
| 1149 | Ga0495630_0399129 | |||
| 1150 | Ga0495630_0740303 | |||
| 1151 | Ga0495631_0256022 | |||
| 1152 | Ga0495637_0039080 | |||
| 1153 | Ga0495644_0008724 | |||
| 1154 | Ga0495663_0037060 | |||
| 1155 | Ga0495666_0000479 | |||
| 1156 | Ga0495642_0285394 | |||
| 1157 | Ga0495652_0008390 | |||
| 1158 | Ga0495652_0010968 | |||
| 1159 | Ga0495652_0020003 | |||
| 1160 | Ga0495652_0026907 | |||
| 1161 | Ga0495652_0047912 | |||
| 1162 | Ga0495652_0409440 | |||
| 1163 | Ga0495652_0476501 | |||
| 1164 | Ga0495652_0492575 | |||
| 1165 | Ga0495665_0008077 | |||
| 1166 | Ga0495665_0246767 | |||
| 1167 | Ga0495640_0029833 | |||
| 1168 | Ga0495640_0031909 | |||
| 1169 | Ga0495640_0392055 | |||
| 1170 | Ga0495586_0005629 | |||
| 1171 | Ga0495586_0593281 | |||
| 1172 | Ga0495587_0000124 | |||
| 1173 | Ga0495587_0039125 | |||
| 1174 | Ga0495587_0303568 | |||
| 1175 | Ga0495645_0000019 | |||
| 1176 | Ga0495645_0046927 | |||
| 1177 | Ga0495645_0047077 | |||
| 1178 | Ga0495645_0144916 | |||
| 1179 | Ga0495645_0193158 | |||
| 1180 | Ga0495645_0668685 | |||
| 1181 | Ga0495667_0021554 | |||
| 1182 | Ga0495667_0039758 | |||
| 1183 | Ga0495667_0069691 | |||
| 1184 | Ga0495634_0006230 | |||
| 1185 | Ga0495634_0172976 | |||
| 1186 | Ga0495611_0285450 | |||
| 1187 | Ga0495635_0032353 | |||
| 1188 | Ga0495635_0033587 | |||
| 1189 | Ga0495635_0044832 | |||
| 1190 | Ga0495635_0069933 | |||
| 1191 | Ga0495588_0097782 | |||
| 1192 | Ga0495657_0007055 | |||
| 1193 | Ga0495657_0102791 | |||
| 1194 | Ga0495657_0172249 | |||
| 1195 | Ga0495599_0001901 | |||
| 1196 | Ga0495599_0020437 | |||
| 1197 | Ga0495599_0170454 | |||
| 1198 | Ga0495599_0207758 | |||
| 1199 | Ga0495599_0595664 | |||
| 1200 | Ga0495623_0000978 | |||
| 1201 | Ga0495623_0026570 | |||
| 1202 | Ga0495646_0030143 | |||
| 1203 | Ga0495646_0068871 | |||
| 1204 | Ga0495646_0073311 | |||
| 1205 | Ga0495646_0154551 | |||
| 1206 | Ga0495647_0000238 | |||
| 1207 | Ga0495647_0121383 | |||
| 1208 | Ga0495658_0157530 | |||
| 1209 | Ga0495658_0184129 | |||
| 1210 | Ga0495658_0450433 | |||
| 1211 | Ga0495613_0010957 | |||
| 1212 | Ga0495613_0015477 | |||
| 1213 | Ga0495624_0003569 | |||
| 1214 | Ga0495624_0025342 | |||
| 1215 | Ga0495624_0363097 | |||
| 1216 | Ga0495624_0390436 | |||
| 1217 | Ga0495670_0106125 | |||
| 1218 | Ga0495600_0044794 | |||
| 1219 | Ga0495600_0117278 | |||
| 1220 | Ga0495600_0495263 | |||
| 1221 | Ga0495581_0006455 | |||
| 1222 | Ga0495581_0440340 | |||
| 1223 | Ga0495581_0715733 | |||
| 1224 | Ga0495604_0000004 | |||
| 1225 | Ga0495604_0016095 | |||
| 1226 | Ga0495604_0065387 | |||
| 1227 | Ga0495604_0176143 | |||
| 1228 | Ga0495604_0238778 | |||
| 1229 | Ga0495674_0107457 | |||
| 1230 | Ga0495674_0145400 | |||
| 1231 | Ga0495674_0148486 | |||
| 1232 | Ga0495674_0303994 | |||
| 1233 | Ga0495674_0325802 | |||
| 1234 | Ga0495674_0552405 | |||
| 1235 | Ga0495674_0685492 | |||
| 1236 | Ga0495674_0772422 | |||
| 1237 | Ga0495674_0899881 | |||
| 1238 | Ga0495676_0032564 | |||
| 1239 | Ga0495676_0077633 | |||
| 1240 | Ga0495676_0087845 | |||
| 1241 | Ga0495676_0185056 | |||
| 1242 | Ga0495676_0216423 | |||
| 1243 | Ga0495680_0002085 | |||
| 1244 | Ga0495680_0018277 | |||
| 1245 | Ga0495680_0036510 | |||
| 1246 | Ga0495680_0078550 | |||
| 1247 | Ga0495680_0118620 | |||
| 1248 | Ga0495680_0475889 | |||
| 1249 | Ga0495675_0000079 | |||
| 1250 | Ga0495675_0610038 | |||
| 1251 | Ga0495684_0009805 | |||
| 1252 | Ga0495684_0030715 | |||
| 1253 | Ga0495684_0032228 | |||
| 1254 | Ga0495684_0209681 | |||
| 1255 | Ga0495684_0288765 | |||
| 1256 | Ga0495684_0634470 | |||
| 1257 | Ga0495593_0001046 | |||
| 1258 | Ga0495593_0046714 | |||
| 1259 | Ga0495602_0000351 | |||
| 1260 | Ga0495602_0067495 | |||
| 1261 | Ga0495614_0001947 | |||
| 1262 | Ga0496100_0455392 | |||
| 1263 | Ga0496100_0536295 | |||
| 1264 | Ga0496101_0063472 | |||
| 1265 | Ga0496101_0310768 | |||
| 1266 | Ga0496101_0942486 | |||
| 1267 | Ga0496102_0003999 | |||
| 1268 | Ga0496102_0015570 | |||
| 1269 | Ga0496103_0022161 | |||
| 1270 | Ga0496104_0160252 | |||
| 1271 | Ga0496104_1286458 | |||
| 1272 | Ga0496105_0011731 | |||
| 1273 | Ga0496105_0091474 | |||
| 1274 | Ga0496106_0003413 | |||
| 1275 | Ga0496106_0305923 | |||
| 1276 | Ga0496106_0732177 | |||
| 1277 | Ga0496107_0001364 | |||
| 1278 | Ga0496107_0102878 | |||
| 1279 | Ga0496107_0122465 | |||
| 1280 | Ga0496107_0137863 | |||
| 1281 | Ga0496107_0397612 | |||
| 1282 | Ga0496107_0435292 | |||
| 1283 | Ga0496108_0037589 | |||
| 1284 | Ga0496108_0136049 | |||
| 1285 | Ga0496108_0938697 | |||
| 1286 | Ga0496109_0203790 | |||
| 1287 | Ga0496109_0240620 | |||
| 1288 | Ga0496109_0286883 | |||
| 1289 | Ga0496109_0412458 | |||
| 1290 | Ga0496109_1254524 | |||
| 1291 | Ga0496110_0206608 | |||
| 1292 | Ga0496110_0257468 | |||
| 1293 | Ga0496110_0697261 | |||
| 1294 | Ga0496110_1376401 | |||
| 1295 | Ga0496111_0067587 | |||
| 1296 | Ga0496111_0211736 | |||
| 1297 | Ga0496111_0245162 | |||
| 1298 | Ga0496112_0112506 | |||
| 1299 | Ga0496112_0133554 | |||
| 1300 | Ga0496112_0188591 | |||
| 1301 | Ga0496112_0313828 | |||
| 1302 | Ga0496112_0507720 | |||
| 1303 | Ga0496112_0516943 | |||
| 1304 | Ga0496113_0118731 | |||
| 1305 | Ga0496113_0390746 | |||
| 1306 | Ga0496113_0416110 | |||
| 1307 | Ga0496114_0028338 | |||
| 1308 | Ga0496114_0080992 | |||
| 1309 | Ga0496114_0110557 | |||
| 1310 | Ga0496114_0286651 | |||
| 1311 | Ga0496114_0301643 | |||
| 1312 | Ga0496115_0005198 | |||
| 1313 | Ga0496115_0039513 | |||
| 1314 | Ga0496115_0048533 | |||
| 1315 | Ga0496115_0140104 | |||
| 1316 | Ga0496115_0158454 | |||
| 1317 | Ga0496115_0173375 | |||
| 1318 | Ga0496115_0319923 | |||
| 1319 | Ga0501047_0164559 | |||
| 1320 | Ga0501047_0813426 | |||
| 1321 | Ga0501067_0043485 | |||
| 1322 | Ga0501067_0105887 | |||
| 1323 | Ga0501067_0432892 | |||
| 1324 | Ga0501069_0066269 | |||
| 1325 | Ga0501070_0007826 | |||
| 1326 | Ga0501072_0019524 | |||
| 1327 | Ga0501073_0546790 | |||
| 1328 | Ga0501074_0037721 | |||
| 1329 | Ga0501079_0119825 | |||
| 1330 | Ga0501080_0340990 | |||
| 1331 | Ga0501080_0607355 | |||
| 1332 | Ga0501080_0759876 | |||
| 1333 | Ga0501083_0046861 | |||
| 1334 | nmdc:mga08y16_660141_c1 | |||
| 1335 | nmdc:mga0n895_1236363_c1 | |||
| 1336 | nmdc:mga0n895_20054_c1 | |||
| 1337 | nmdc:mga0rr50_144402_c1 | |||
| 1338 | nmdc:mga0a205_424067_c1 | |||
| 1339 | Ga0495601_0000215 | |||
| 1340 | Ga0495601_0006394 | |||
| 1341 | Ga0495601_0010126 | |||
| 1342 | Ga0495601_0063685 | |||
| 1343 | Ga0495601_0110381 | |||
| 1344 | Ga0495601_0271744 | |||
| 1345 | Ga0495601_0348251 | |||
| 1346 | Ga0495601_0755420 | |||
| 1347 | Ga0495612_0004654 | |||
| 1348 | Ga0495612_0028532 | |||
| 1349 | Ga0495612_0055344 | |||
| 1350 | Ga0495612_0084780 | |||
| 1351 | Ga0495595_0006619 | |||
| 1352 | Ga0495595_0022717 | |||
| 1353 | Ga0495595_0050136 | |||
| 1354 | Ga0495595_0226930 | |||
| 1355 | Ga0495619_0000199 | |||
| 1356 | Ga0495619_0005873 | |||
| 1357 | Ga0495619_0097727 | |||
| 1358 | Ga0495619_0123780 | |||
| 1359 | Ga0495619_0133080 | |||
| 1360 | Ga0495619_0189472 | |||
| 1361 | Ga0466962_0021393 | |||
| 1362 | Ga0466962_0029963 | |||
| 1363 | Ga0466962_0061969 | |||
| 1364 | Ga0466962_0091737 | |||
| 1365 | Ga0466962_0092311 | |||
| 1366 | Ga0466962_0248421 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c2i-assembly1.cif.gz_B | structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis | 0.9166 | 3 | 139 |
| 3k67-assembly1.cif.gz_A | crystal structure of protein af1124 from archaeoglobus fulgidus | 0.9101 | 1 | 136 |
| 2c2i-assembly1.cif.gz_B | structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis | 0.898 | 3 | 139 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.8787 | 1 | 135 |
| 1iq6-assembly1.cif.gz_A | (r)-hydratase from a. caviae involved in pha biosynthesis | 0.8746 | 1 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B0G197_51_201_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9644 | 3 | 138 | 3.10.129.10 |
| af_B0G197_51_201_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9376 | 3 | 138 | 3.10.129.10 |
| 2c2iB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9183 | 3 | 139 | 3.10.129.10 |
| 3k67A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9101 | 1 | 136 | 3.10.129.10 |
| 2c2iB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8872 | 3 | 139 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059XDJ9-F1-model_v4 | MaoC like domain protein | 0.9785 | 3 | 138 |
|
| AF-A0A4Q4ZH97-F1-model_v4 | MaoC family dehydratase | 0.9768 | 3 | 138 |
|
| AF-A0A1G7E6P7-F1-model_v4 | Acyl dehydratase | 0.9767 | 3 | 139 |
|
| AF-A0A7Y9GM06-F1-model_v4 | Acyl dehydratase | 0.9746 | 3 | 139 |
|
| AF-A0A7Y1YRM2-F1-model_v4 | MaoC family dehydratase | 0.9726 | 10 | 138 |
|