F474888

General Info

Members Datasets Scaffolds Average Seq Length
682 378 1364 142

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100490735|Ga0070672_1004907352
Length 159
Sequence MALPKTAADIIARLDLKPHPEGGHYRETFRDESVDADGRARSTAIYFLLARGERSHWHRIDAVETWHYYAGSALTLRIADGTGQRSVKLGADLAAGEAPQAIVPPHAWQAAESNGDWTLVGCTVAPGFEFSKFELAPKDWEPIRRTGGASRYPSIASAR

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
337 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
338 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
339 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
346 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
347 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
348 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
349 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
350 2643221580 Devosia sp. Root635 Isolate Unclassified
351 2643221674 Devosia sp. Root436 Isolate Unclassified
352 2791355199
353 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
354 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
355 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
356 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
357 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
358 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
359 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
360 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
361 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
362 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
363 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
364 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
365 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
366 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
367 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
368 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
369 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
370 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
371 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
372 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
373 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
374 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
375 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
376 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
377 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
378 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 0.15
Isolates 4.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.53
Nodule 2.35
Rhizoplane 5.87
Rhizosphere 73.46
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100490735 3300005543 Bacteria 1061
2 JGI24739J22299_10054485 3300001989 Bacteria 1281
3 JGI24737J22298_10115034 3300001990 Bacteria 795
4 JGI25153J46596_10000591 3300003215 Bacteria 22150
5 JGI25404J52841_10009742 3300003659 Bacteria 2059
6 JGI25404J52841_10059941 3300003659 Bacteria 798
7 Ga0065165_1000588 3300005262 Bacteria 53386
8 Ga0065165_1119228 3300005262 Bacteria 642
9 Ga0070658_10332265 3300005327 Bacteria 1299
10 Ga0070676_10471230 3300005328 Bacteria 887
11 Ga0070676_10525493 3300005328 Bacteria 844
12 Ga0070683_100181332 3300005329 Bacteria 1999
13 Ga0070670_100162537 3300005331 Bacteria 1935
14 Ga0068869_100397407 3300005334 Bacteria 1133
15 Ga0068869_100661108 3300005334 Bacteria 888
16 Ga0070680_100987866 3300005336 Bacteria 727
17 Ga0070680_101070958 3300005336 Bacteria 697
18 Ga0070682_100143251 3300005337 Bacteria 1632
19 Ga0068868_100009478 3300005338 Bacteria 7012
20 Ga0068868_100058016 3300005338 Bacteria 3059
21 Ga0068868_101548044 3300005338 Bacteria 622
22 Ga0070660_100146837 3300005339 Bacteria 1895
23 Ga0070660_100390919 3300005339 Bacteria 1149
24 Ga0070660_101609080 3300005339 Bacteria 553
25 Ga0070689_100934427 3300005340 Bacteria 769
26 Ga0070691_10113830 3300005341 Unclassified 1355
27 Ga0070661_100065283 3300005344 Bacteria 2674
28 Ga0070661_100475975 3300005344 Bacteria 997
29 Ga0070668_100043455 3300005347 Bacteria 3446
30 Ga0070668_100064166 3300005347 Bacteria 2847
31 Ga0070668_100076165 3300005347 Bacteria 2620
32 Ga0070668_100341782 3300005347 Bacteria 1264
33 Ga0070668_100477002 3300005347 Bacteria 1077
34 Ga0070668_100788466 3300005347 Bacteria 843
35 Ga0070669_100066417 3300005353 Bacteria 2659
36 Ga0070675_100227291 3300005354 Bacteria 1627
37 Ga0070671_100827461 3300005355 Bacteria 807
38 Ga0070674_100416037 3300005356 Bacteria 1102
39 Ga0070674_100775843 3300005356 Bacteria 826
40 Ga0070673_100211275 3300005364 Bacteria 1676
41 Ga0070688_101202623 3300005365 Bacteria 609
42 Ga0070667_100091805 3300005367 Bacteria 2611
43 Ga0070709_10003001 3300005434 Bacteria 9085
44 Ga0070709_10016931 3300005434 Bacteria 4172
45 Ga0070709_10041916 3300005434 Bacteria 2823
46 Ga0070709_10612283 3300005434 Bacteria 840
47 Ga0070714_100033539 3300005435 Bacteria 4292
48 Ga0070714_100039511 3300005435 Bacteria 3973
49 Ga0070714_100053776 3300005435 Bacteria 3439
50 Ga0070713_100000017 3300005436 Bacteria 120503
51 Ga0070710_10000783 3300005437 Bacteria 15215
52 Ga0070701_10453340 3300005438 Bacteria 824
53 Ga0070711_100014561 3300005439 Bacteria 4955
54 Ga0070711_100017287 3300005439 Bacteria 4590
55 Ga0070705_100039523 3300005440 Bacteria 2677
56 Ga0070663_100011721 3300005455 Bacteria 5515
57 Ga0070663_100081734 3300005455 Bacteria 2376
58 Ga0070663_100155539 3300005455 Bacteria 1756
59 Ga0070663_100470694 3300005455 Bacteria 1039
60 Ga0070663_101001290 3300005455 Bacteria 727
61 Ga0070678_100024087 3300005456 Bacteria 4068
62 Ga0070678_100086309 3300005456 Bacteria 2394
63 Ga0070678_100526296 3300005456 Bacteria 1047
64 Ga0070678_100597790 3300005456 Bacteria 985
65 Ga0070678_101162200 3300005456 Bacteria 714
66 Ga0070678_101650024 3300005456 Bacteria 603
67 Ga0070662_100176688 3300005457 Bacteria 1681
68 Ga0070662_100382365 3300005457 Bacteria 1159
69 Ga0070662_100558542 3300005457 Bacteria 960
70 Ga0068867_101462506 3300005459 Bacteria 635
71 Ga0070699_100201305 3300005518 Bacteria 1771
72 Ga0070699_100454596 3300005518 Bacteria 1161
73 Ga0070684_100057912 3300005535 Bacteria 3384
74 Ga0070684_101612877 3300005535 Bacteria 612
75 Ga0068853_100001661 3300005539 Bacteria 16283
76 Ga0068853_100055701 3300005539 Bacteria 3408
77 Ga0068853_100485881 3300005539 Bacteria 1164
78 Ga0070672_100207312 3300005543 Bacteria 1641
79 Ga0070672_100862267 3300005543 Bacteria 799
80 Ga0070665_100012097 3300005548 Bacteria 8707
81 Ga0070665_100055286 3300005548 Bacteria 3981
82 Ga0070665_100083608 3300005548 Bacteria 3197
83 Ga0070665_100149133 3300005548 Bacteria 2342
84 Ga0070665_100239167 3300005548 Bacteria 1816
85 Ga0070665_100264473 3300005548 Bacteria 1721
86 Ga0070665_100406617 3300005548 Bacteria 1369
87 Ga0070665_100412886 3300005548 Bacteria 1358
88 Ga0070665_101616362 3300005548 Bacteria 656
89 Ga0068855_100006072 3300005563 Bacteria 14725
90 Ga0068855_100079092 3300005563 Bacteria 3814
91 Ga0068855_100358935 3300005563 Bacteria 1604
92 Ga0068855_101001733 3300005563 Bacteria 878
93 Ga0070664_100047197 3300005564 Bacteria 3638
94 Ga0070664_100117829 3300005564 Bacteria 2323
95 Ga0068857_100020321 3300005577 Bacteria 5839
96 Ga0068856_100001998 3300005614 Bacteria 21263
97 Ga0068856_100060860 3300005614 Bacteria 3729
98 Ga0068856_100327537 3300005614 Archaea 1549
99 Ga0070702_100522936 3300005615 Unclassified 875
100 Ga0070702_100783626 3300005615 Bacteria 735
101 Ga0068852_100012795 3300005616 Bacteria 6392
102 Ga0068852_100025585 3300005616 Bacteria 4785
103 Ga0068852_100947609 3300005616 Bacteria 879
104 Ga0068859_100973863 3300005617 Bacteria 931
105 Ga0068864_100009734 3300005618 Bacteria 7929
106 Ga0068864_101303971 3300005618 Unclassified 726
107 Ga0068866_10069567 3300005718 Bacteria 1855
108 Ga0068861_100142529 3300005719 Bacteria 1957
109 Ga0068861_100579841 3300005719 Bacteria 1026
110 Ga0068851_10179928 3300005834 Bacteria 1171
111 Ga0068851_10293403 3300005834 Bacteria 933
112 Ga0068870_10166286 3300005840 Bacteria 1313
113 Ga0068870_10477557 3300005840 Bacteria 827
114 Ga0068870_10689271 3300005840 Bacteria 704
115 Ga0068863_100239958 3300005841 Bacteria 1749
116 Ga0068858_100018713 3300005842 Bacteria 6482
117 Ga0068858_100094932 3300005842 Bacteria 2778
118 Ga0068858_100266851 3300005842 Archaea 1628
119 Ga0068860_100998286 3300005843 Bacteria 855
120 Ga0068860_101200938 3300005843 Bacteria 779
121 Ga0068860_101294695 3300005843 Bacteria 750
122 Ga0068862_100110481 3300005844 Bacteria 2412
123 Ga0068862_100565515 3300005844 Bacteria 1087
124 Ga0068862_101037181 3300005844 Bacteria 812
125 Ga0081455_10018523 3300005937 Bacteria 6628
126 Ga0081455_10554652 3300005937 Bacteria 759
127 Ga0081455_11011922 3300005937 Bacteria 514
128 Ga0081538_10046006 3300005981 Bacteria 2698
129 Ga0081538_10127221 3300005981 Bacteria 1207
130 Ga0081540_1017362 3300005983 Bacteria 4459
131 Ga0081540_1044462 3300005983 Bacteria 2266
132 Ga0081540_1048588 3300005983 Bacteria 2124
133 Ga0081540_1090003 3300005983 Bacteria 1352
134 Ga0081540_1124928 3300005983 Bacteria 1061
135 Ga0075365_10017062 3300006038 Bacteria 4432
136 Ga0075365_10186131 3300006038 Bacteria 1452
137 Ga0075365_10397702 3300006038 Bacteria 972
138 Ga0075368_10021775 3300006042 Bacteria 2436
139 Ga0075368_10055477 3300006042 Bacteria 1579
140 Ga0075363_100024761 3300006048 Bacteria 3054
141 Ga0075363_100130956 3300006048 Bacteria 1407
142 Ga0075363_100419747 3300006048 Bacteria 787
143 Ga0075364_10037593 3300006051 Bacteria 3135
144 Ga0075432_10219608 3300006058 Bacteria 760
145 Ga0070716_100053489 3300006173 Bacteria 2302
146 Ga0070716_100144687 3300006173 Bacteria 1521
147 Ga0070712_100000247 3300006175 Bacteria 30472
148 Ga0070712_100046641 3300006175 Bacteria 2996
149 Ga0075367_10038187 3300006178 Bacteria 2794
150 Ga0075367_10059241 3300006178 Bacteria 2279
151 Ga0075369_10182549 3300006186 Bacteria 965
152 Ga0097621_100295766 3300006237 Bacteria 1429
153 Ga0075370_10055832 3300006353 Bacteria 2244
154 Ga0075370_10100719 3300006353 Bacteria 1671
155 Ga0068871_100308960 3300006358 Bacteria 1390
156 Ga0075428_100113324 3300006844 Bacteria 2954
157 Ga0075434_100141714 3300006871 Bacteria 2424
158 Ga0075429_100567081 3300006880 Bacteria 995
159 Ga0068865_100402253 3300006881 Bacteria 1122
160 Ga0075436_100000098 3300006914 Bacteria 51153
161 Ga0075436_100006403 3300006914 Bacteria 8068
162 Ga0097620_100973987 3300006931 Bacteria 931
163 Ga0105244_10287040 3300009036 Bacteria 763
164 Ga0105240_10004953 3300009093 Bacteria 20027
165 Ga0111539_10191497 3300009094 Bacteria 2386
166 Ga0111539_10900797 3300009094 Bacteria 1029
167 Ga0105245_10162553 3300009098 Bacteria 2120
168 Ga0105247_10208500 3300009101 Bacteria 1317
169 Ga0114129_10304702 3300009147 Bacteria 2122
170 Ga0114129_10408551 3300009147 Bacteria 1788
171 Ga0105243_10145425 3300009148 Bacteria 2028
172 Ga0105241_10003012 3300009174 Bacteria 12594
173 Ga0105241_10022183 3300009174 Bacteria 4700
174 Ga0105242_10703360 3300009176 Bacteria 989
175 Ga0105242_11071561 3300009176 Bacteria 818
176 Ga0105248_10037613 3300009177 Bacteria 5414
177 Ga0105248_10292987 3300009177 Bacteria 1832
178 Ga0105237_10430054 3300009545 Bacteria 1326
179 Ga0105237_10891037 3300009545 Bacteria 897
180 Ga0105237_11108681 3300009545 Bacteria 798
181 Ga0105237_11125277 3300009545 Bacteria 792
182 Ga0105237_12150733 3300009545 Bacteria 567
183 Ga0105238_10000620 3300009551 Bacteria 37357
184 Ga0105238_10259009 3300009551 Bacteria 1719
185 Ga0105238_10707555 3300009551 Bacteria 1020
186 Ga0105238_10837515 3300009551 Bacteria 937
187 Ga0105238_11542820 3300009551 Bacteria 693
188 Ga0105249_10115073 3300009553 Bacteria 2547
189 Ga0105249_10645375 3300009553 Bacteria 1116
190 Ga0105239_10047760 3300010375 Bacteria 4692
191 Ga0105239_10061988 3300010375 Bacteria 4105
192 Ga0105239_10194047 3300010375 Bacteria 2274
193 Ga0105239_11053387 3300010375 Bacteria 936
194 Ga0105239_11367573 3300010375 Bacteria 817
195 Ga0105246_10142445 3300011119 Bacteria 1804
196 Ga0157373_10008713 3300013100 Bacteria 7522
197 Ga0157370_10186517 3300013104 Bacteria 1925
198 Ga0157370_10697293 3300013104 Bacteria 927
199 Ga0157369_10047307 3300013105 Bacteria 4672
200 Ga0157369_12457759 3300013105 Bacteria 527
201 Ga0157374_10047446 3300013296 Bacteria 3983
202 Ga0157374_10091867 3300013296 Bacteria 2895
203 Ga0157374_11414413 3300013296 Bacteria 718
204 Ga0157378_10318356 3300013297 Bacteria 1511
205 Ga0157378_10348734 3300013297 Bacteria 1445
206 Ga0157378_10589855 3300013297 Bacteria 1121
207 Ga0157378_11587157 3300013297 Bacteria 700
208 Ga0163162_10023466 3300013306 Bacteria 6088
209 Ga0163162_10609465 3300013306 Bacteria 1217
210 Ga0157372_10311096 3300013307 Bacteria 1833
211 Ga0157375_10052325 3300013308 Bacteria 4014
212 Ga0157375_11379799 3300013308 Bacteria 830
213 Ga0163163_10143826 3300014325 Archaea 2428
214 Ga0163163_10184637 3300014325 Bacteria 2133
215 Ga0163163_10301588 3300014325 Bacteria 1654
216 Ga0163163_12037028 3300014325 Bacteria 634
217 Ga0157380_10437353 3300014326 Bacteria 1252
218 Ga0157379_10037389 3300014968 Bacteria 4328
219 Ga0157379_10079454 3300014968 Bacteria 2937
220 Ga0157379_10214658 3300014968 Unclassified 1742
221 Ga0157379_10377017 3300014968 Bacteria 1301
222 Ga0157379_10471862 3300014968 Bacteria 1160
223 Ga0157376_10087532 3300014969 Bacteria 2688
224 Ga0163161_10267462 3300017792 Bacteria 1337
225 Ga0206353_10099430 3300020082 Unclassified 683
226 Ga0213873_10002479 3300021358 Bacteria 3196
227 Ga0213874_10182446 3300021377 Bacteria 747
228 Ga0213876_10002421 3300021384 Bacteria 10972
229 Ga0213876_10008883 3300021384 Bacteria 5419
230 Ga0213876_10091322 3300021384 Bacteria 1613
231 Ga0213876_10268810 3300021384 Bacteria 906
232 Ga0213875_10000036 3300021388 Bacteria 166707
233 Ga0213875_10007887 3300021388 Bacteria 5473
234 Ga0209758_1021361 3300025297 Bacteria 3019
235 Ga0207426_1001191 3300025302 Bacteria 23117
236 Ga0207692_10006519 3300025898 Bacteria 4737
237 Ga0207642_10198107 3300025899 Bacteria 1107
238 Ga0207710_10027806 3300025900 Bacteria 2452
239 Ga0207688_10295603 3300025901 Bacteria 989
240 Ga0207647_10124917 3300025904 Bacteria 1515
241 Ga0207647_10234865 3300025904 Bacteria 1054
242 Ga0207647_10427963 3300025904 Bacteria 743
243 Ga0207699_10000360 3300025906 Bacteria 24053
244 Ga0207699_10006039 3300025906 Bacteria 5830
245 Ga0207699_10035876 3300025906 Bacteria 2824
246 Ga0207699_10830382 3300025906 Bacteria 680
247 Ga0207645_10210746 3300025907 Bacteria 1280
248 Ga0207643_10089973 3300025908 Bacteria 1788
249 Ga0207643_10273010 3300025908 Bacteria 1047
250 Ga0207705_10314487 3300025909 Bacteria 1202
251 Ga0207654_10015430 3300025911 Bacteria 3965
252 Ga0207654_10120072 3300025911 Bacteria 1649
253 Ga0207707_10723705 3300025912 Bacteria 834
254 Ga0207671_10175636 3300025914 Bacteria 1665
255 Ga0207671_10612170 3300025914 Bacteria 868
256 Ga0207693_10000035 3300025915 Bacteria 110713
257 Ga0207693_10015453 3300025915 Bacteria 6123
258 Ga0207693_10059907 3300025915 Bacteria 2982
259 Ga0207663_10012680 3300025916 Bacteria 4563
260 Ga0207663_10387205 3300025916 Bacteria 1066
261 Ga0207663_10832792 3300025916 Bacteria 736
262 Ga0207657_10053834 3300025919 Bacteria 3483
263 Ga0207657_10309886 3300025919 Bacteria 1250
264 Ga0207694_10061421 3300025924 Bacteria 2924
265 Ga0207694_10762235 3300025924 Bacteria 817
266 Ga0207694_11250120 3300025924 Unclassified 628
267 Ga0207650_10596616 3300025925 Bacteria 928
268 Ga0207659_10157965 3300025926 Bacteria 1777
269 Ga0207659_10423156 3300025926 Bacteria 1117
270 Ga0207659_10680403 3300025926 Bacteria 880
271 Ga0207659_11031419 3300025926 Bacteria 708
272 Ga0207687_10046084 3300025927 Bacteria 3017
273 Ga0207687_10412775 3300025927 Bacteria 1113
274 Ga0207700_10000034 3300025928 Bacteria 120519
275 Ga0207664_10009377 3300025929 Bacteria 6866
276 Ga0207664_10047084 3300025929 Bacteria 3386
277 Ga0207664_10797428 3300025929 Bacteria 849
278 Ga0207644_10238467 3300025931 Bacteria 1447
279 Ga0207644_10291602 3300025931 Bacteria 1312
280 Ga0207690_10258202 3300025932 Bacteria 1349
281 Ga0207690_10389000 3300025932 Bacteria 1110
282 Ga0207706_10129501 3300025933 Bacteria 2219
283 Ga0207706_10456623 3300025933 Bacteria 1105
284 Ga0207706_11429414 3300025933 Bacteria 567
285 Ga0207686_10665279 3300025934 Bacteria 825
286 Ga0207686_10860085 3300025934 Bacteria 730
287 Ga0207709_10224821 3300025935 Bacteria 1356
288 Ga0207709_10321096 3300025935 Bacteria 1159
289 Ga0207670_10794649 3300025936 Bacteria 788
290 Ga0207669_10208888 3300025937 Bacteria 1423
291 Ga0207669_10567548 3300025937 Bacteria 918
292 Ga0207704_10500527 3300025938 Bacteria 979
293 Ga0207665_10173998 3300025939 Bacteria 1556
294 Ga0207665_10969956 3300025939 Bacteria 676
295 Ga0207691_10816636 3300025940 Bacteria 783
296 Ga0207711_10742283 3300025941 Bacteria 915
297 Ga0207711_11175951 3300025941 Bacteria 708
298 Ga0207689_10087476 3300025942 Bacteria 2560
299 Ga0207689_10189630 3300025942 Bacteria 1696
300 Ga0207689_10394233 3300025942 Bacteria 1154
301 Ga0207689_10607691 3300025942 Bacteria 920
302 Ga0207661_10394735 3300025944 Bacteria 1254
303 Ga0207679_10066042 3300025945 Bacteria 2709
304 Ga0207679_10218510 3300025945 Bacteria 1602
305 Ga0207667_10184174 3300025949 Bacteria 2144
306 Ga0207667_10441961 3300025949 Unclassified 1322
307 Ga0207667_10930940 3300025949 Bacteria 859
308 Ga0207712_10244739 3300025961 Bacteria 1446
309 Ga0207712_10375818 3300025961 Bacteria 1188
310 Ga0207668_10011093 3300025972 Bacteria 5465
311 Ga0207668_10182324 3300025972 Bacteria 1657
312 Ga0207668_10538924 3300025972 Bacteria 1009
313 Ga0207640_10162117 3300025981 Bacteria 1656
314 Ga0207640_10287391 3300025981 Bacteria 1295
315 Ga0207677_10043134 3300026023 Bacteria 2996
316 Ga0207677_10044782 3300026023 Bacteria 2950
317 Ga0207677_11718955 3300026023 Bacteria 582
318 Ga0207703_10136058 3300026035 Bacteria 2127
319 Ga0207703_10512039 3300026035 Bacteria 1128
320 Ga0207639_10098752 3300026041 Bacteria 2354
321 Ga0207678_10083112 3300026067 Bacteria 2739
322 Ga0207678_10169412 3300026067 Bacteria 1864
323 Ga0207678_10411085 3300026067 Bacteria 1172
324 Ga0207678_10435596 3300026067 Bacteria 1138
325 Ga0207678_10462181 3300026067 Bacteria 1104
326 Ga0207702_10000007 3300026078 Bacteria 332551
327 Ga0207702_10000012 3300026078 Bacteria 269770
328 Ga0207702_10019840 3300026078 Bacteria 5567
329 Ga0207648_11245042 3300026089 Bacteria 699
330 Ga0207648_11302929 3300026089 Bacteria 682
331 Ga0207676_10206797 3300026095 Bacteria 1738
332 Ga0207676_10798797 3300026095 Bacteria 920
333 Ga0207676_10834647 3300026095 Bacteria 901
334 Ga0207674_10000107 3300026116 Bacteria 95635
335 Ga0207674_10768020 3300026116 Bacteria 930
336 Ga0207675_100157044 3300026118 Bacteria 2168
337 Ga0207675_100196998 3300026118 Bacteria 1934
338 Ga0207675_100576887 3300026118 Bacteria 1126
339 Ga0207675_101102127 3300026118 Bacteria 814
340 Ga0207675_101603491 3300026118 Bacteria 671
341 Ga0207683_10031362 3300026121 Bacteria 4612
342 Ga0207683_10041954 3300026121 Bacteria 3996
343 Ga0207683_10066027 3300026121 Bacteria 3190
344 Ga0207683_10156849 3300026121 Bacteria 2056
345 Ga0207683_10505522 3300026121 Bacteria 1116
346 Ga0207683_10565094 3300026121 Bacteria 1052
347 Ga0207683_11025659 3300026121 Bacteria 766
348 Ga0207698_11819620 3300026142 Bacteria 624
349 Ga0209813_10032092 3300027866 Bacteria 1554
350 Ga0209813_10150214 3300027866 Bacteria 834
351 Ga0268266_10001416 3300028379 Bacteria 28634
352 Ga0268266_10004957 3300028379 Bacteria 12595
353 Ga0268266_10047216 3300028379 Bacteria 3688
354 Ga0268266_10053946 3300028379 Bacteria 3454
355 Ga0268266_10249706 3300028379 Bacteria 1640
356 Ga0268266_10956159 3300028379 Bacteria 829
357 Ga0268266_11518458 3300028379 Bacteria 645
358 Ga0268265_10124476 3300028380 Bacteria 2130
359 Ga0268265_10827246 3300028380 Bacteria 904
360 Ga0268265_10855591 3300028380 Bacteria 890
361 Ga0268265_11355861 3300028380 Bacteria 712
362 Ga0268264_10087292 3300028381 Bacteria 2682
363 Ga0268264_10768922 3300028381 Bacteria 961
364 Ga0268264_11076619 3300028381 Bacteria 812
365 Ga0307517_10001290 3300028786 Bacteria 42017
366 Ga0307511_10031209 3300030521 Bacteria 4765
367 Ga0307512_10209314 3300030522 Bacteria 1040
368 Ga0307509_10081246 3300031507 Bacteria 3348
369 Ga0307408_100230098 3300031548 Bacteria 1518
370 Ga0307408_100932525 3300031548 Bacteria 796
371 Ga0307508_10053365 3300031616 Bacteria 3588
372 Ga0307516_10084774 3300031730 Bacteria 3007
373 Ga0307516_10119292 3300031730 Bacteria 2431
374 Ga0307516_10729500 3300031730 Bacteria 649
375 Ga0307405_10071018 3300031731 Bacteria 2239
376 Ga0307413_10695011 3300031824 Bacteria 844
377 Ga0307413_10961978 3300031824 Bacteria 729
378 Ga0307410_10417723 3300031852 Bacteria 1087
379 Ga0307406_10520947 3300031901 Bacteria 967
380 Ga0307407_10316876 3300031903 Bacteria 1093
381 Ga0307407_10659610 3300031903 Bacteria 784
382 Ga0307412_10670691 3300031911 Bacteria 887
383 Ga0307409_100060937 3300031995 Bacteria 2945
384 Ga0307409_100191486 3300031995 Bacteria 1821
385 Ga0307416_100695386 3300032002 Bacteria 1105
386 Ga0307416_101099961 3300032002 Bacteria 899
387 Ga0307416_101624466 3300032002 Bacteria 751
388 Ga0307414_10770471 3300032004 Bacteria 876
389 Ga0307411_10219708 3300032005 Bacteria 1473
390 Ga0307411_11925767 3300032005 Bacteria 551
391 Ga0307415_100059959 3300032126 Bacteria 2627
392 Ga0307415_100306344 3300032126 Bacteria 1318
393 Ga0307507_10028790 3300033179 Bacteria 5909
394 Ga0307510_10026894 3300033180 Bacteria 6602
395 Ga0307510_10220253 3300033180 Bacteria 1410
396 Ga0373934_0064365 3300035086 Unclassified 1463
397 Ga0373940_0189513 3300035088 Bacteria 672
398 Ga0373936_0213858 3300035113 Bacteria 854
399 Ga0373936_0368193 3300035113 Bacteria 656
400 Ga0373953_0200880 3300035117 Unclassified 862
401 Ga0373955_0008572 3300035172 Bacteria 4754
402 Ga0373931_0211506 3300035691 Bacteria 1163
403 Ga0373935_0055279 3300035692 Bacteria 2529
404 Ga0373927_0028187 3300035695 Bacteria 3664
405 Ga0373927_0032103 3300035695 Bacteria 3420
406 Ga0373933_0008446 3300035724 Bacteria 5618
407 Ga0373947_0038272 3300035725 Bacteria 2849
408 Ga0373947_0968079 3300035725 Bacteria 581
409 Ga0373937_0592578 3300036401 Unclassified 1052
410 Ga0373925_0012334 3300037068 Bacteria 6186
411 Ga0373925_0072289 3300037068 Bacteria 2610
412 Ga0395900_0120609 3300037418 Bacteria 2691
413 Ga0395898_0171476 3300037466 Bacteria 2074
414 Ga0395905_0107221 3300037471 Bacteria 2623
415 Ga0436364_0245439 3300037853 Bacteria 33775
416 Ga0436364_1155091 3300037853 Bacteria 4953
417 Ga0395901_0025191 3300038443 Bacteria 6107
418 Ga0395901_0128970 3300038443 Bacteria 2658
419 Ga0395901_1930380 3300038443 Bacteria 537
420 Ga0436365_0118086 3300039437 Bacteria 30402
421 Ga0436365_0750117 3300039437 Bacteria 543
422 Ga0436365_0869898 3300039437 Bacteria 537
423 Ga0436365_1422151 3300039437 Bacteria 2009
424 Ga0436365_1639838 3300039437 Bacteria 14264
425 Ga0436363_0144005 3300039450 Bacteria 20089
426 Ga0436363_0147419 3300039450 Bacteria 843
427 Ga0436362_0167044 3300039453 Bacteria 1594
428 Ga0436362_0363695 3300039453 Bacteria 2326
429 Ga0451797_1466181 3300041453 Bacteria 621
430 Ga0451802_2147350 3300041460 Bacteria 613
431 Ga0451807_2608175 3300041486 Bacteria 697
432 Ga0451835_0235553 3300041492 Bacteria 633
433 Ga0466969_0586411 3300044656 Bacteria 511
434 Ga0466972_0000237 3300044658 Bacteria 38144
435 Ga0466965_0032561 3300044683 Bacteria 2546
436 Ga0466966_0100370 3300044684 Bacteria 1790
437 Ga0466968_0094871 3300044735 Bacteria 1326
438 Ga0466970_0448796 3300044765 Bacteria 739
439 Ga0466960_0185234 3300044901 Bacteria 1130
440 Ga0495617_263283 3300046452 Bacteria 530
441 Ga0495617_273575 3300046452 Bacteria 518
442 Ga0495627_051324 3300046453 Bacteria 1240
443 Ga0495629_0491263 3300046459 Bacteria 828
444 Ga0495629_0930645 3300046459 Bacteria 568
445 Ga0495638_0350798 3300046460 Bacteria 779
446 Ga0495638_0645340 3300046460 Bacteria 515
447 Ga0495651_0021140 3300046462 Bacteria 5055
448 Ga0495650_0161479 3300046471 Bacteria 799
449 Ga0495580_0637495 3300046472 Bacteria 702
450 Ga0495639_0559882 3300046475 Bacteria 586
451 Ga0495585_0087535 3300046492 Bacteria 1681
452 Ga0495585_0391281 3300046492 Bacteria 670
453 Ga0495596_0321621 3300046500 Bacteria 602
454 Ga0495583_0198859 3300046506 Bacteria 815
455 Ga0495583_0270833 3300046506 Bacteria 678
456 Ga0495620_0142077 3300046515 Bacteria 938
457 Ga0495644_0027197 3300046523 Bacteria 2168
458 Ga0495644_0035039 3300046523 Bacteria 1895
459 Ga0495652_0191385 3300046529 Bacteria 1561
460 Ga0495652_0199258 3300046529 Bacteria 1521
461 Ga0495640_0515253 3300046533 Bacteria 727
462 Ga0495598_0197446 3300046537 Bacteria 725
463 Ga0495609_0035901 3300046538 Bacteria 2241
464 Ga0495621_0077009 3300046539 Bacteria 1238
465 Ga0495645_0438465 3300046543 Bacteria 826
466 Ga0495622_0071488 3300046557 Bacteria 1601
467 Ga0495633_0173134 3300046558 Bacteria 994
468 Ga0495633_0199526 3300046558 Bacteria 919
469 Ga0495656_0078147 3300046615 Bacteria 1486
470 Ga0495656_0536993 3300046615 Bacteria 622
471 Ga0495668_0319448 3300046616 Bacteria 852
472 Ga0495668_0577660 3300046616 Bacteria 621
473 Ga0495668_0638376 3300046616 Bacteria 588
474 Ga0495668_0661119 3300046616 Bacteria 578
475 Ga0495611_0039307 3300046648 Bacteria 2106
476 Ga0495625_0052354 3300046660 Bacteria 2924
477 Ga0495625_0056012 3300046660 Bacteria 2808
478 Ga0495625_0450574 3300046660 Bacteria 795
479 Ga0495659_0499058 3300046664 Bacteria 533
480 Ga0495588_0174233 3300046674 Bacteria 1137
481 Ga0495657_0258722 3300046675 Unclassified 1046
482 Ga0495623_0078038 3300046679 Unclassified 2053
483 Ga0495623_0310595 3300046679 Bacteria 869
484 Ga0495647_0132795 3300046681 Bacteria 1056
485 Ga0495669_0261733 3300046684 Bacteria 831
486 Ga0495669_0425878 3300046684 Bacteria 644
487 Ga0495669_0627020 3300046684 Bacteria 523
488 Ga0495613_0001199 3300046689 Bacteria 19784
489 Ga0495670_0135462 3300046691 Bacteria 1286
490 Ga0495670_0184990 3300046691 Bacteria 1101
491 Ga0495649_0119557 3300046694 Bacteria 1394
492 Ga0495581_0328494 3300047315 Bacteria 893
493 Ga0495581_0666984 3300047315 Bacteria 601
494 Ga0495604_0339661 3300047317 Bacteria 1000
495 Ga0495672_0044321 3300047320 Bacteria 2669
496 Ga0495676_0377665 3300047321 Bacteria 943
497 Ga0495675_0791943 3300047444 Bacteria 525
498 Ga0495677_0128128 3300047445 Bacteria 971
499 Ga0495685_124630 3300047447 Bacteria 845
500 Ga0495673_0029353 3300047469 Bacteria 2596
501 Ga0495673_0073172 3300047469 Bacteria 1437
502 Ga0495673_0077198 3300047469 Bacteria 1388
503 Ga0495686_0137940 3300047472 Bacteria 1441
504 Ga0495686_0534035 3300047472 Bacteria 614
505 Ga0495686_0682597 3300047472 Bacteria 525
506 Ga0495593_0217472 3300047673 Bacteria 959
507 Ga0495602_0758344 3300048088 Bacteria 654
508 Ga0495615_0037951 3300048090 Bacteria 1189
509 Ga0496100_0024662 3300048903 Bacteria 3670
510 Ga0496100_1142225 3300048903 Bacteria 614
511 Ga0496101_0002190 3300048904 Bacteria 11933
512 Ga0496101_0182306 3300048904 Bacteria 1617
513 Ga0496102_0010012 3300048905 Bacteria 8152
514 Ga0496102_0217882 3300048905 Bacteria 1799
515 Ga0496102_0327401 3300048905 Bacteria 1443
516 Ga0496102_0404478 3300048905 Bacteria 1283
517 Ga0496103_0014895 3300048906 Bacteria 4622
518 Ga0496103_0315761 3300048906 Bacteria 1005
519 Ga0496103_0645936 3300048906 Bacteria 672
520 Ga0496104_0096170 3300048907 Bacteria 2833
521 Ga0496104_0156493 3300048907 Bacteria 2187
522 Ga0496105_0721448 3300048908 Bacteria 764
523 Ga0496106_0012440 3300048909 Bacteria 6284
524 Ga0496106_0056692 3300048909 Bacteria 2962
525 Ga0496106_0106830 3300048909 Bacteria 2176
526 Ga0496106_0666840 3300048909 Bacteria 830
527 Ga0496107_0006405 3300048910 Bacteria 8090
528 Ga0496107_0339287 3300048910 Bacteria 1118
529 Ga0496107_0652393 3300048910 Bacteria 776
530 Ga0496108_0004626 3300048911 Bacteria 11091
531 Ga0496108_0128884 3300048911 Bacteria 2174
532 Ga0496108_0193059 3300048911 Bacteria 1765
533 Ga0496108_0601565 3300048911 Bacteria 958
534 Ga0496109_0045430 3300048912 Bacteria 3986
535 Ga0496110_0652118 3300048913 Bacteria 952
536 Ga0496111_0345131 3300048914 Bacteria 1102
537 Ga0496111_0397780 3300048914 Bacteria 1018
538 Ga0496111_1301731 3300048914 Bacteria 512
539 Ga0496112_0058823 3300048915 Bacteria 3786
540 Ga0496113_0006107 3300048916 Bacteria 7600
541 Ga0496113_0067162 3300048916 Bacteria 2718
542 Ga0496114_0007664 3300048917 Bacteria 8536
543 Ga0496115_0003865 3300048918 Bacteria 10798
544 Ga0496115_0207183 3300048918 Bacteria 1620
545 Ga0496115_0215252 3300048918 Bacteria 1586
546 Ga0496117_0003382 3300048920 Bacteria 18582
547 Ga0496117_0075113 3300048920 Bacteria 2247
548 Ga0496118_0001355 3300048921 Bacteria 36910
549 Ga0496118_0185554 3300048921 Bacteria 1251
550 Ga0496119_0127768 3300048922 Bacteria 1389
551 Ga0496121_0000453 3300048924 Bacteria 80749
552 Ga0496121_0058573 3300048924 Bacteria 3183
553 Ga0496121_0236425 3300048924 Bacteria 1276
554 Ga0496121_0273273 3300048924 Bacteria 1160
555 Ga0496121_0635306 3300048924 Bacteria 653
556 Ga0496124_0000750 3300048927 Bacteria 53262
557 Ga0496125_0071977 3300048928 Bacteria 2697
558 Ga0496126_0023489 3300048929 Bacteria 5974
559 Ga0496126_0025331 3300048929 Bacteria 5709
560 Ga0496126_0079033 3300048929 Bacteria 2913
561 Ga0501031_0213255 3300049568 Bacteria 1258
562 Ga0501032_0116845 3300049569 Bacteria 1764
563 Ga0501032_0913660 3300049569 Bacteria 552
564 Ga0501033_0028106 3300049570 Bacteria 4227
565 Ga0501033_0046730 3300049570 Bacteria 3219
566 Ga0501033_0073585 3300049570 Bacteria 2509
567 Ga0501034_0002509 3300049571 Bacteria 22038
568 Ga0501034_0593281 3300049571 Bacteria 1014
569 Ga0501034_1052579 3300049571 Bacteria 696
570 Ga0501036_0093643 3300049572 Bacteria 2538
571 Ga0501036_1528160 3300049572 Bacteria 540
572 Ga0501037_0309522 3300049573 Bacteria 1095
573 Ga0501038_0342531 3300049574 Bacteria 1165
574 Ga0501038_0638490 3300049574 Bacteria 802
575 Ga0501038_0676013 3300049574 Bacteria 775
576 Ga0501039_0131546 3300049575 Bacteria 1964
577 Ga0501039_0814850 3300049575 Bacteria 728
578 Ga0501042_0173994 3300049578 Bacteria 1553
579 Ga0501043_1204751 3300049579 Bacteria 531
580 Ga0501047_0166299 3300049581 Bacteria 2076
581 Ga0501047_0340027 3300049581 Bacteria 1338
582 Ga0501048_0966863 3300049582 Bacteria 613
583 Ga0501067_0331127 3300049583 Bacteria 848
584 Ga0501070_1198081 3300049586 Bacteria 583
585 Ga0501074_0755464 3300049590 Bacteria 686
586 Ga0501076_0723519 3300049592 Bacteria 821
587 Ga0501079_0199495 3300049741 Bacteria 1563
588 Ga0501035_0033714 3300049822 Bacteria 4654
589 Ga0501035_0174928 3300049822 Bacteria 1852
590 Ga0501044_0002525 3300049823 Bacteria 20828
591 Ga0501044_0168423 3300049823 Bacteria 2163
592 Ga0501045_0197344 3300049824 Bacteria 1500
593 Ga0501045_0636452 3300049824 Bacteria 789
594 nmdc:mga03683_379730_c1 3300050489 Bacteria 672
595 nmdc:mga03n38_5614_c1 3300050490 Bacteria 4288
596 nmdc:mga00v17_173713_c1 3300050491 Bacteria 1390
597 nmdc:mga0yw44_116004_c1 3300050492 Bacteria 1721
598 nmdc:mga0yw44_305538_c1 3300050492 Bacteria 1066
599 nmdc:mga0yw44_676296_c1 3300050492 Bacteria 701
600 nmdc:mga0yw44_72093_c1 3300050492 Bacteria 2146
601 nmdc:mga0k408_315252_c1 3300050493 Bacteria 933
602 nmdc:mga0k408_558296_c1 3300050493 Bacteria 676
603 nmdc:mga06z11_30703_c1 3300050494 Bacteria 2603
604 nmdc:mga06z11_43137_c1 3300050494 Bacteria 2267
605 nmdc:mga04h51_166381_c1 3300050495 Bacteria 851
606 nmdc:mga04h51_53959_c1 3300050495 Bacteria 1357
607 nmdc:mga07m45_10336_c1 3300050496 Bacteria 4871
608 nmdc:mga07m45_728600_c1 3300050496 Bacteria 570
609 nmdc:mga05p37_351113_c1 3300050507 Bacteria 1736
610 nmdc:mga09592_504140_c1 3300050508 Bacteria 1042
611 nmdc:mga08y16_389751_c1 3300050511 Bacteria 1427
612 nmdc:mga0n895_137676_c1 3300050512 Bacteria 2469
613 nmdc:mga0n895_23504_c1 3300050512 Bacteria 5794
614 nmdc:mga0rr50_22849_c1 3300050513 Bacteria 4300
615 nmdc:mga08x19_271270_c1 3300050514 Bacteria 1174
616 nmdc:mga08x19_7082_c1 3300050514 Bacteria 6655
617 nmdc:mga08x19_99_c1 3300050514 Bacteria 76277
618 Ga0495655_0037632 3300053083 Bacteria 1216
619 Ga0495655_0097045 3300053083 Bacteria 867
620 Ga0495619_0576167 3300053085 Bacteria 771
621 Ga0500643_001217 3300053087 Bacteria 15364
622 Ga0500643_039956 3300053087 Bacteria 1383
623 Ga0500583_0007864 3300053092 Bacteria 3785
624 Ga0500583_0083250 3300053092 Bacteria 1548
625 Ga0500641_0008352 3300053096 Bacteria 3692
626 Ga0500641_0014121 3300053096 Bacteria 2943
627 Ga0500555_002571 3300053103 Bacteria 5226
628 Ga0500556_0010705 3300053104 Bacteria 2698
629 Ga0500592_010253 3300053116 Bacteria 1491
630 Ga0500595_187377 3300053119 Bacteria 573
631 Ga0500595_216043 3300053119 Bacteria 527
632 Ga0500597_151564 3300053120 Bacteria 995
633 Ga0500642_0003024 3300053130 Bacteria 5018
634 Ga0500642_0320684 3300053130 Bacteria 695
635 Ga0500652_107850 3300053131 Bacteria 1164
636 Ga0500658_0091485 3300053134 Bacteria 1316
637 Ga0500568_0035953 3300053139 Bacteria 2018
638 Ga0500577_0314142 3300053142 Bacteria 684
639 Ga0500589_026005 3300053147 Bacteria 2715
640 Ga0500603_025076 3300053150 Bacteria 1497
641 Ga0500604_0046787 3300053151 Bacteria 1324
642 Ga0500604_0050857 3300053151 Bacteria 1279
643 Ga0500616_0045773 3300053153 Bacteria 2329
644 Ga0500622_0036449 3300053156 Bacteria 2570
645 Ga0500634_0083810 3300053161 Bacteria 1636
646 Ga0500634_0149283 3300053161 Bacteria 1095
647 Ga0500636_0083707 3300053177 Bacteria 1835
648 Ga0500645_044751 3300053730 Bacteria 1301
649 Ga0500552_000654 3300053733 Bacteria 3246
650 2513876975 2513237139 Bacteria 8737671
651 2514016049 2513237161 Bacteria 8871253
652 2524535221 2524023228 Bacteria 10118060
653 2617353207 2617270735 Bacteria 9163226
654 2643910209 2643221580 Bacteria 3816678
655 2644410973 2643221674 Bacteria 3919126
656 2793077081
657 2805921230 2802429603 Bacteria 8777136
658 2824609059 2824600985 Bacteria 8488197
659 2824615649 2824609381 Bacteria 8672835
660 2824657456 2824653114 Bacteria 8493680
661 2824678164 2824671348 Bacteria 8369588
662 2824694554 2824687955 Bacteria 8360029
663 2824703075 2824696289 Bacteria 8335049
664 2824777480 2824773399 Bacteria 8360218
665 2838125714 2838122688 Bacteria 8803140
666 2841947925 2841941048 Bacteria 8688029
667 2841957022 2841949485 Bacteria 8680857
668 2841972753 2841966195 Bacteria 8673214
669 2841984912 2841983080 Bacteria 8395090
670 2847942631 2847939898 Bacteria 8606328
671 2874608412 2874604998 Bacteria 7834745
672 2876764024 2876761206 Bacteria 10111113
673 2876815936 2876808645 Bacteria 8824342
674 2879112820 2879110137 Bacteria 8907982
675 2888419915 2888419890 Bacteria 7857137
676 2889035854 2889033259 Bacteria 9099371
677 2922364333 2922361189 Bacteria 7436256
678 3005506251 3005506211 Bacteria 6943378
679 8006936689 8006933436 Bacteria 10410654
680 8006976659 8006973647 Bacteria 10679141
681 8006992432 8006984368 Bacteria 9651211
682 8056676314 8056673599 Bacteria 7871253
683 Ga0070672_100490735
684 JGI24739J22299_10054485
685 JGI24737J22298_10115034
686 JGI25153J46596_10000591
687 JGI25404J52841_10009742
688 JGI25404J52841_10059941
689 Ga0065165_1000588
690 Ga0065165_1119228
691 Ga0070658_10332265
692 Ga0070676_10471230
693 Ga0070676_10525493
694 Ga0070683_100181332
695 Ga0070670_100162537
696 Ga0068869_100397407
697 Ga0068869_100661108
698 Ga0070680_100987866
699 Ga0070680_101070958
700 Ga0070682_100143251
701 Ga0068868_100009478
702 Ga0068868_100058016
703 Ga0068868_101548044
704 Ga0070660_100146837
705 Ga0070660_100390919
706 Ga0070660_101609080
707 Ga0070689_100934427
708 Ga0070691_10113830
709 Ga0070661_100065283
710 Ga0070661_100475975
711 Ga0070668_100043455
712 Ga0070668_100064166
713 Ga0070668_100076165
714 Ga0070668_100341782
715 Ga0070668_100477002
716 Ga0070668_100788466
717 Ga0070669_100066417
718 Ga0070675_100227291
719 Ga0070671_100827461
720 Ga0070674_100416037
721 Ga0070674_100775843
722 Ga0070673_100211275
723 Ga0070688_101202623
724 Ga0070667_100091805
725 Ga0070709_10003001
726 Ga0070709_10016931
727 Ga0070709_10041916
728 Ga0070709_10612283
729 Ga0070714_100033539
730 Ga0070714_100039511
731 Ga0070714_100053776
732 Ga0070713_100000017
733 Ga0070710_10000783
734 Ga0070701_10453340
735 Ga0070711_100014561
736 Ga0070711_100017287
737 Ga0070705_100039523
738 Ga0070663_100011721
739 Ga0070663_100081734
740 Ga0070663_100155539
741 Ga0070663_100470694
742 Ga0070663_101001290
743 Ga0070678_100024087
744 Ga0070678_100086309
745 Ga0070678_100526296
746 Ga0070678_100597790
747 Ga0070678_101162200
748 Ga0070678_101650024
749 Ga0070662_100176688
750 Ga0070662_100382365
751 Ga0070662_100558542
752 Ga0068867_101462506
753 Ga0070699_100201305
754 Ga0070699_100454596
755 Ga0070684_100057912
756 Ga0070684_101612877
757 Ga0068853_100001661
758 Ga0068853_100055701
759 Ga0068853_100485881
760 Ga0070672_100207312
761 Ga0070672_100862267
762 Ga0070665_100012097
763 Ga0070665_100055286
764 Ga0070665_100083608
765 Ga0070665_100149133
766 Ga0070665_100239167
767 Ga0070665_100264473
768 Ga0070665_100406617
769 Ga0070665_100412886
770 Ga0070665_101616362
771 Ga0068855_100006072
772 Ga0068855_100079092
773 Ga0068855_100358935
774 Ga0068855_101001733
775 Ga0070664_100047197
776 Ga0070664_100117829
777 Ga0068857_100020321
778 Ga0068856_100001998
779 Ga0068856_100060860
780 Ga0068856_100327537
781 Ga0070702_100522936
782 Ga0070702_100783626
783 Ga0068852_100012795
784 Ga0068852_100025585
785 Ga0068852_100947609
786 Ga0068859_100973863
787 Ga0068864_100009734
788 Ga0068864_101303971
789 Ga0068866_10069567
790 Ga0068861_100142529
791 Ga0068861_100579841
792 Ga0068851_10179928
793 Ga0068851_10293403
794 Ga0068870_10166286
795 Ga0068870_10477557
796 Ga0068870_10689271
797 Ga0068863_100239958
798 Ga0068858_100018713
799 Ga0068858_100094932
800 Ga0068858_100266851
801 Ga0068860_100998286
802 Ga0068860_101200938
803 Ga0068860_101294695
804 Ga0068862_100110481
805 Ga0068862_100565515
806 Ga0068862_101037181
807 Ga0081455_10018523
808 Ga0081455_10554652
809 Ga0081455_11011922
810 Ga0081538_10046006
811 Ga0081538_10127221
812 Ga0081540_1017362
813 Ga0081540_1044462
814 Ga0081540_1048588
815 Ga0081540_1090003
816 Ga0081540_1124928
817 Ga0075365_10017062
818 Ga0075365_10186131
819 Ga0075365_10397702
820 Ga0075368_10021775
821 Ga0075368_10055477
822 Ga0075363_100024761
823 Ga0075363_100130956
824 Ga0075363_100419747
825 Ga0075364_10037593
826 Ga0075432_10219608
827 Ga0070716_100053489
828 Ga0070716_100144687
829 Ga0070712_100000247
830 Ga0070712_100046641
831 Ga0075367_10038187
832 Ga0075367_10059241
833 Ga0075369_10182549
834 Ga0097621_100295766
835 Ga0075370_10055832
836 Ga0075370_10100719
837 Ga0068871_100308960
838 Ga0075428_100113324
839 Ga0075434_100141714
840 Ga0075429_100567081
841 Ga0068865_100402253
842 Ga0075436_100000098
843 Ga0075436_100006403
844 Ga0097620_100973987
845 Ga0105244_10287040
846 Ga0105240_10004953
847 Ga0111539_10191497
848 Ga0111539_10900797
849 Ga0105245_10162553
850 Ga0105247_10208500
851 Ga0114129_10304702
852 Ga0114129_10408551
853 Ga0105243_10145425
854 Ga0105241_10003012
855 Ga0105241_10022183
856 Ga0105242_10703360
857 Ga0105242_11071561
858 Ga0105248_10037613
859 Ga0105248_10292987
860 Ga0105237_10430054
861 Ga0105237_10891037
862 Ga0105237_11108681
863 Ga0105237_11125277
864 Ga0105237_12150733
865 Ga0105238_10000620
866 Ga0105238_10259009
867 Ga0105238_10707555
868 Ga0105238_10837515
869 Ga0105238_11542820
870 Ga0105249_10115073
871 Ga0105249_10645375
872 Ga0105239_10047760
873 Ga0105239_10061988
874 Ga0105239_10194047
875 Ga0105239_11053387
876 Ga0105239_11367573
877 Ga0105246_10142445
878 Ga0157373_10008713
879 Ga0157370_10186517
880 Ga0157370_10697293
881 Ga0157369_10047307
882 Ga0157369_12457759
883 Ga0157374_10047446
884 Ga0157374_10091867
885 Ga0157374_11414413
886 Ga0157378_10318356
887 Ga0157378_10348734
888 Ga0157378_10589855
889 Ga0157378_11587157
890 Ga0163162_10023466
891 Ga0163162_10609465
892 Ga0157372_10311096
893 Ga0157375_10052325
894 Ga0157375_11379799
895 Ga0163163_10143826
896 Ga0163163_10184637
897 Ga0163163_10301588
898 Ga0163163_12037028
899 Ga0157380_10437353
900 Ga0157379_10037389
901 Ga0157379_10079454
902 Ga0157379_10214658
903 Ga0157379_10377017
904 Ga0157379_10471862
905 Ga0157376_10087532
906 Ga0163161_10267462
907 Ga0206353_10099430
908 Ga0213873_10002479
909 Ga0213874_10182446
910 Ga0213876_10002421
911 Ga0213876_10008883
912 Ga0213876_10091322
913 Ga0213876_10268810
914 Ga0213875_10000036
915 Ga0213875_10007887
916 Ga0209758_1021361
917 Ga0207426_1001191
918 Ga0207692_10006519
919 Ga0207642_10198107
920 Ga0207710_10027806
921 Ga0207688_10295603
922 Ga0207647_10124917
923 Ga0207647_10234865
924 Ga0207647_10427963
925 Ga0207699_10000360
926 Ga0207699_10006039
927 Ga0207699_10035876
928 Ga0207699_10830382
929 Ga0207645_10210746
930 Ga0207643_10089973
931 Ga0207643_10273010
932 Ga0207705_10314487
933 Ga0207654_10015430
934 Ga0207654_10120072
935 Ga0207707_10723705
936 Ga0207671_10175636
937 Ga0207671_10612170
938 Ga0207693_10000035
939 Ga0207693_10015453
940 Ga0207693_10059907
941 Ga0207663_10012680
942 Ga0207663_10387205
943 Ga0207663_10832792
944 Ga0207657_10053834
945 Ga0207657_10309886
946 Ga0207694_10061421
947 Ga0207694_10762235
948 Ga0207694_11250120
949 Ga0207650_10596616
950 Ga0207659_10157965
951 Ga0207659_10423156
952 Ga0207659_10680403
953 Ga0207659_11031419
954 Ga0207687_10046084
955 Ga0207687_10412775
956 Ga0207700_10000034
957 Ga0207664_10009377
958 Ga0207664_10047084
959 Ga0207664_10797428
960 Ga0207644_10238467
961 Ga0207644_10291602
962 Ga0207690_10258202
963 Ga0207690_10389000
964 Ga0207706_10129501
965 Ga0207706_10456623
966 Ga0207706_11429414
967 Ga0207686_10665279
968 Ga0207686_10860085
969 Ga0207709_10224821
970 Ga0207709_10321096
971 Ga0207670_10794649
972 Ga0207669_10208888
973 Ga0207669_10567548
974 Ga0207704_10500527
975 Ga0207665_10173998
976 Ga0207665_10969956
977 Ga0207691_10816636
978 Ga0207711_10742283
979 Ga0207711_11175951
980 Ga0207689_10087476
981 Ga0207689_10189630
982 Ga0207689_10394233
983 Ga0207689_10607691
984 Ga0207661_10394735
985 Ga0207679_10066042
986 Ga0207679_10218510
987 Ga0207667_10184174
988 Ga0207667_10441961
989 Ga0207667_10930940
990 Ga0207712_10244739
991 Ga0207712_10375818
992 Ga0207668_10011093
993 Ga0207668_10182324
994 Ga0207668_10538924
995 Ga0207640_10162117
996 Ga0207640_10287391
997 Ga0207677_10043134
998 Ga0207677_10044782
999 Ga0207677_11718955
1000 Ga0207703_10136058
1001 Ga0207703_10512039
1002 Ga0207639_10098752
1003 Ga0207678_10083112
1004 Ga0207678_10169412
1005 Ga0207678_10411085
1006 Ga0207678_10435596
1007 Ga0207678_10462181
1008 Ga0207702_10000007
1009 Ga0207702_10000012
1010 Ga0207702_10019840
1011 Ga0207648_11245042
1012 Ga0207648_11302929
1013 Ga0207676_10206797
1014 Ga0207676_10798797
1015 Ga0207676_10834647
1016 Ga0207674_10000107
1017 Ga0207674_10768020
1018 Ga0207675_100157044
1019 Ga0207675_100196998
1020 Ga0207675_100576887
1021 Ga0207675_101102127
1022 Ga0207675_101603491
1023 Ga0207683_10031362
1024 Ga0207683_10041954
1025 Ga0207683_10066027
1026 Ga0207683_10156849
1027 Ga0207683_10505522
1028 Ga0207683_10565094
1029 Ga0207683_11025659
1030 Ga0207698_11819620
1031 Ga0209813_10032092
1032 Ga0209813_10150214
1033 Ga0268266_10001416
1034 Ga0268266_10004957
1035 Ga0268266_10047216
1036 Ga0268266_10053946
1037 Ga0268266_10249706
1038 Ga0268266_10956159
1039 Ga0268266_11518458
1040 Ga0268265_10124476
1041 Ga0268265_10827246
1042 Ga0268265_10855591
1043 Ga0268265_11355861
1044 Ga0268264_10087292
1045 Ga0268264_10768922
1046 Ga0268264_11076619
1047 Ga0307517_10001290
1048 Ga0307511_10031209
1049 Ga0307512_10209314
1050 Ga0307509_10081246
1051 Ga0307408_100230098
1052 Ga0307408_100932525
1053 Ga0307508_10053365
1054 Ga0307516_10084774
1055 Ga0307516_10119292
1056 Ga0307516_10729500
1057 Ga0307405_10071018
1058 Ga0307413_10695011
1059 Ga0307413_10961978
1060 Ga0307410_10417723
1061 Ga0307406_10520947
1062 Ga0307407_10316876
1063 Ga0307407_10659610
1064 Ga0307412_10670691
1065 Ga0307409_100060937
1066 Ga0307409_100191486
1067 Ga0307416_100695386
1068 Ga0307416_101099961
1069 Ga0307416_101624466
1070 Ga0307414_10770471
1071 Ga0307411_10219708
1072 Ga0307411_11925767
1073 Ga0307415_100059959
1074 Ga0307415_100306344
1075 Ga0307507_10028790
1076 Ga0307510_10026894
1077 Ga0307510_10220253
1078 Ga0373934_0064365
1079 Ga0373940_0189513
1080 Ga0373936_0213858
1081 Ga0373936_0368193
1082 Ga0373953_0200880
1083 Ga0373955_0008572
1084 Ga0373931_0211506
1085 Ga0373935_0055279
1086 Ga0373927_0028187
1087 Ga0373927_0032103
1088 Ga0373933_0008446
1089 Ga0373947_0038272
1090 Ga0373947_0968079
1091 Ga0373937_0592578
1092 Ga0373925_0012334
1093 Ga0373925_0072289
1094 Ga0395900_0120609
1095 Ga0395898_0171476
1096 Ga0395905_0107221
1097 Ga0436364_0245439
1098 Ga0436364_1155091
1099 Ga0395901_0025191
1100 Ga0395901_0128970
1101 Ga0395901_1930380
1102 Ga0436365_0118086
1103 Ga0436365_0750117
1104 Ga0436365_0869898
1105 Ga0436365_1422151
1106 Ga0436365_1639838
1107 Ga0436363_0144005
1108 Ga0436363_0147419
1109 Ga0436362_0167044
1110 Ga0436362_0363695
1111 Ga0451797_1466181
1112 Ga0451802_2147350
1113 Ga0451807_2608175
1114 Ga0451835_0235553
1115 Ga0466969_0586411
1116 Ga0466972_0000237
1117 Ga0466965_0032561
1118 Ga0466966_0100370
1119 Ga0466968_0094871
1120 Ga0466970_0448796
1121 Ga0466960_0185234
1122 Ga0495617_263283
1123 Ga0495617_273575
1124 Ga0495627_051324
1125 Ga0495629_0491263
1126 Ga0495629_0930645
1127 Ga0495638_0350798
1128 Ga0495638_0645340
1129 Ga0495651_0021140
1130 Ga0495650_0161479
1131 Ga0495580_0637495
1132 Ga0495639_0559882
1133 Ga0495585_0087535
1134 Ga0495585_0391281
1135 Ga0495596_0321621
1136 Ga0495583_0198859
1137 Ga0495583_0270833
1138 Ga0495620_0142077
1139 Ga0495644_0027197
1140 Ga0495644_0035039
1141 Ga0495652_0191385
1142 Ga0495652_0199258
1143 Ga0495640_0515253
1144 Ga0495598_0197446
1145 Ga0495609_0035901
1146 Ga0495621_0077009
1147 Ga0495645_0438465
1148 Ga0495622_0071488
1149 Ga0495633_0173134
1150 Ga0495633_0199526
1151 Ga0495656_0078147
1152 Ga0495656_0536993
1153 Ga0495668_0319448
1154 Ga0495668_0577660
1155 Ga0495668_0638376
1156 Ga0495668_0661119
1157 Ga0495611_0039307
1158 Ga0495625_0052354
1159 Ga0495625_0056012
1160 Ga0495625_0450574
1161 Ga0495659_0499058
1162 Ga0495588_0174233
1163 Ga0495657_0258722
1164 Ga0495623_0078038
1165 Ga0495623_0310595
1166 Ga0495647_0132795
1167 Ga0495669_0261733
1168 Ga0495669_0425878
1169 Ga0495669_0627020
1170 Ga0495613_0001199
1171 Ga0495670_0135462
1172 Ga0495670_0184990
1173 Ga0495649_0119557
1174 Ga0495581_0328494
1175 Ga0495581_0666984
1176 Ga0495604_0339661
1177 Ga0495672_0044321
1178 Ga0495676_0377665
1179 Ga0495675_0791943
1180 Ga0495677_0128128
1181 Ga0495685_124630
1182 Ga0495673_0029353
1183 Ga0495673_0073172
1184 Ga0495673_0077198
1185 Ga0495686_0137940
1186 Ga0495686_0534035
1187 Ga0495686_0682597
1188 Ga0495593_0217472
1189 Ga0495602_0758344
1190 Ga0495615_0037951
1191 Ga0496100_0024662
1192 Ga0496100_1142225
1193 Ga0496101_0002190
1194 Ga0496101_0182306
1195 Ga0496102_0010012
1196 Ga0496102_0217882
1197 Ga0496102_0327401
1198 Ga0496102_0404478
1199 Ga0496103_0014895
1200 Ga0496103_0315761
1201 Ga0496103_0645936
1202 Ga0496104_0096170
1203 Ga0496104_0156493
1204 Ga0496105_0721448
1205 Ga0496106_0012440
1206 Ga0496106_0056692
1207 Ga0496106_0106830
1208 Ga0496106_0666840
1209 Ga0496107_0006405
1210 Ga0496107_0339287
1211 Ga0496107_0652393
1212 Ga0496108_0004626
1213 Ga0496108_0128884
1214 Ga0496108_0193059
1215 Ga0496108_0601565
1216 Ga0496109_0045430
1217 Ga0496110_0652118
1218 Ga0496111_0345131
1219 Ga0496111_0397780
1220 Ga0496111_1301731
1221 Ga0496112_0058823
1222 Ga0496113_0006107
1223 Ga0496113_0067162
1224 Ga0496114_0007664
1225 Ga0496115_0003865
1226 Ga0496115_0207183
1227 Ga0496115_0215252
1228 Ga0496117_0003382
1229 Ga0496117_0075113
1230 Ga0496118_0001355
1231 Ga0496118_0185554
1232 Ga0496119_0127768
1233 Ga0496121_0000453
1234 Ga0496121_0058573
1235 Ga0496121_0236425
1236 Ga0496121_0273273
1237 Ga0496121_0635306
1238 Ga0496124_0000750
1239 Ga0496125_0071977
1240 Ga0496126_0023489
1241 Ga0496126_0025331
1242 Ga0496126_0079033
1243 Ga0501031_0213255
1244 Ga0501032_0116845
1245 Ga0501032_0913660
1246 Ga0501033_0028106
1247 Ga0501033_0046730
1248 Ga0501033_0073585
1249 Ga0501034_0002509
1250 Ga0501034_0593281
1251 Ga0501034_1052579
1252 Ga0501036_0093643
1253 Ga0501036_1528160
1254 Ga0501037_0309522
1255 Ga0501038_0342531
1256 Ga0501038_0638490
1257 Ga0501038_0676013
1258 Ga0501039_0131546
1259 Ga0501039_0814850
1260 Ga0501042_0173994
1261 Ga0501043_1204751
1262 Ga0501047_0166299
1263 Ga0501047_0340027
1264 Ga0501048_0966863
1265 Ga0501067_0331127
1266 Ga0501070_1198081
1267 Ga0501074_0755464
1268 Ga0501076_0723519
1269 Ga0501079_0199495
1270 Ga0501035_0033714
1271 Ga0501035_0174928
1272 Ga0501044_0002525
1273 Ga0501044_0168423
1274 Ga0501045_0197344
1275 Ga0501045_0636452
1276 nmdc:mga03683_379730_c1
1277 nmdc:mga03n38_5614_c1
1278 nmdc:mga00v17_173713_c1
1279 nmdc:mga0yw44_116004_c1
1280 nmdc:mga0yw44_305538_c1
1281 nmdc:mga0yw44_676296_c1
1282 nmdc:mga0yw44_72093_c1
1283 nmdc:mga0k408_315252_c1
1284 nmdc:mga0k408_558296_c1
1285 nmdc:mga06z11_30703_c1
1286 nmdc:mga06z11_43137_c1
1287 nmdc:mga04h51_166381_c1
1288 nmdc:mga04h51_53959_c1
1289 nmdc:mga07m45_10336_c1
1290 nmdc:mga07m45_728600_c1
1291 nmdc:mga05p37_351113_c1
1292 nmdc:mga09592_504140_c1
1293 nmdc:mga08y16_389751_c1
1294 nmdc:mga0n895_137676_c1
1295 nmdc:mga0n895_23504_c1
1296 nmdc:mga0rr50_22849_c1
1297 nmdc:mga08x19_271270_c1
1298 nmdc:mga08x19_7082_c1
1299 nmdc:mga08x19_99_c1
1300 Ga0495655_0037632
1301 Ga0495655_0097045
1302 Ga0495619_0576167
1303 Ga0500643_001217
1304 Ga0500643_039956
1305 Ga0500583_0007864
1306 Ga0500583_0083250
1307 Ga0500641_0008352
1308 Ga0500641_0014121
1309 Ga0500555_002571
1310 Ga0500556_0010705
1311 Ga0500592_010253
1312 Ga0500595_187377
1313 Ga0500595_216043
1314 Ga0500597_151564
1315 Ga0500642_0003024
1316 Ga0500642_0320684
1317 Ga0500652_107850
1318 Ga0500658_0091485
1319 Ga0500568_0035953
1320 Ga0500577_0314142
1321 Ga0500589_026005
1322 Ga0500603_025076
1323 Ga0500604_0046787
1324 Ga0500604_0050857
1325 Ga0500616_0045773
1326 Ga0500622_0036449
1327 Ga0500634_0083810
1328 Ga0500634_0149283
1329 Ga0500636_0083707
1330 Ga0500645_044751
1331 Ga0500552_000654
1332 2513876975
1333 2514016049
1334 2524535221
1335 2617353207
1336 2643910209
1337 2644410973
1338 2793077081
1339 2805921230
1340 2824609059
1341 2824615649
1342 2824657456
1343 2824678164
1344 2824694554
1345 2824703075
1346 2824777480
1347 2838125714
1348 2841947925
1349 2841957022
1350 2841972753
1351 2841984912
1352 2847942631
1353 2874608412
1354 2876764024
1355 2876815936
1356 2879112820
1357 2888419915
1358 2889035854
1359 2922364333
1360 3005506251
1361 8006936689
1362 8006976659
1363 8006992432
1364 8056676314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06172

Cupin_5

Cupin superfamily (DUF985)

8

136

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9606 1 134
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.9547 2 140
3m3i-assembly2.cif.gz_B hypothetical protein from leishmania major 0.9246 2 134
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.9182 5 135
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9142 1 134
ID Description Score Start End Superfamily
af_Q8GYZ3_2_189_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9574 1 135 2.60.120.10
1yudF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9567 2 134 2.60.120.10
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9534 3 140 2.60.120.10
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9332 3 140 2.60.120.10
3m3iG01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9235 2 132 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1C3XR98-F1-model_v4 DUF985 domain-containing protein 1 1 140
AF-A0A6G8TV01-F1-model_v4 Cupin domain-containing protein 0.9998 1 140
AF-A0A176YW61-F1-model_v4 Cupin 0.9987 1 140
AF-A0A0A3XIP9-F1-model_v4 Cupin 0.997 1 140
AF-A0A1Q5REH0-F1-model_v4 Cupin 0.9965 1 140

Map