F474709

General Info

Members Datasets Scaffolds Average Seq Length
679 305 1358 283

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10045422|Ga0075370_100454222
Length 340
Sequence VYSVLKYWGARGGFPSPLWWIISVVNIFGTGLFASSCQNPLEGIEFVVILDKFMTQQKIWIGAHTSAAGGAPNALFEGQQIGASAIQLFTSNQKQWKGRQILPEEVALWEKALDETGISQIMSHDSYLINLGSPDPELLQKSRKAFREEIQRCHLLGIPYLNFHPGAATSGTVEECLERIAESLLEMEDLICKGDTRLLLETTAGQGSSVGHRFEHIAAIFDRVHQKIPVGVCIDTCHIFVAGYDVRTKEACKKTLKEFDEIIGLEHLYAFHLNDSQKEFGSRVDRHAPIGQGKIGPDCFHFLMSSPETRLLPKYLETPDGPASWKEEIVLLRKFAQQTQ

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
44 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
45 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
46 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
85 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
86 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
87 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
88 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
89 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
90 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
91 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
92 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
152 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
153 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
154 2506520008 Serratia plymuthica AS12 Isolate Unclassified
155 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
156 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
157 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
158 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
159 2547132181 Kosakonia sacchari SP1 Isolate Stem
160 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
161 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
162 2561511199 Enterobacter sp. R4-368 Isolate Nodule
163 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
164 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
165 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
166 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
167 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
168 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
169 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
170 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
171 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
172 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
173 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
174 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
175 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
176 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
177 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
178 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
179 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
180 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
181 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
182 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
183 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
184 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
185 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
186 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
187 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
188 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
189 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
190 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
191 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
192 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
193 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
194 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
195 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
196 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
197 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
198 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
199 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
200 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
201 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
202 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
203 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
204 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
205 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
206 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
207 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
208 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
209 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
210 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
211 2636415599 Klebsiella variicola DX120E Isolate Unclassified
212 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
213 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
214 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
215 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
216 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
217 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
218 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
219 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
220 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
221 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
222 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
223 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
224 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
225 2751185917 Enterobacter sp. HK169 Isolate Unclassified
226 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
227 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
228 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
229 2775507074 Klebsiella sp. D5A Isolate Unclassified
230 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
231 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
232 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
233 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
234 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
235 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
236 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
237 2821118458 Enterobacter asburiae 609 Isolate Unclassified
238 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
239 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
240 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
241 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
242 2847085930 Erwinia persicina B64 Isolate Bulb
243 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
244 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
245 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
246 2865014394 Pantoea sp. R-71966 Isolate Unclassified
247 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
248 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
249 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
250 2876601092 Pantoea endophytica 596 Isolate Unclassified
251 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
252 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
253 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
254 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
255 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
256 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
257 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
258 2904504865 Serratia marcescens 1822 Isolate Unclassified
259 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
260 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
261 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
262 2919150387 Rahnella aceris 1817 Isolate Unclassified
263 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
264 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
265 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
266 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
267 2927143783 Rahnella sp. 2050 Isolate Unclassified
268 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
269 2932406140 Serratia sp. 2723 Isolate Rhizosphere
270 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
271 2937539931 Pantoea sp. LS15 Isolate Unclassified
272 2937967321 Serratia sp. YC16 Isolate Unclassified
273 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
274 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
275 2939577877 Serratia sp. 509 Isolate Rhizosphere
276 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
277 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
278 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
279 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
280 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
281 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
282 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
283 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
284 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
285 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
286 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
287 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
288 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
289 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
290 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
291 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
292 640753048 Serratia proteamaculans 568 Isolate Endosphere
293 8004592986 Serratia sp. S119 Isolate Unclassified
294 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
295 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
296 8018221730 Enterobacter sp. CM29 Isolate Unclassified
297 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
298 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
299 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
300 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
301 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
302 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
303 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
304 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
305 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.03
Metatranscriptomes 0.44
Isolates 22.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0.15
Endosphere 5.45
Nodule 3.24
Rhizoplane 9.43
Rhizosphere 50.07
Stem 0.15
Stem Tuber 0.59
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10045422 3300006353 Bacteria 2484
2 SwRhRL2b_contig_1568905 2162886007 Bacteria 5834
3 SwRhRL2b_contig_1593964 2162886007 Bacteria 1594
4 SwRhRL2b_contig_704064 2162886007 Bacteria 3738
5 JGI24739J22299_10000367 3300001989 Bacteria 15471
6 JGI25162J39368_1003285 3300002737 Bacteria 4878
7 JGI25163J39215_1000388 3300002771 Bacteria 14078
8 JGI25164J39214_1000098 3300002772 Bacteria 86651
9 JGI25152J39213_1005840 3300002773 Bacteria 3487
10 rootH2_10009953 3300003320 Bacteria 34387
11 Ga0055538_1000003 3300003751 Bacteria 663004
12 Ga0055539_1000003 3300003752 Bacteria 663004
13 Ga0055533_1000005 3300003756 Bacteria 663004
14 Ga0055525_1000005 3300003759 Bacteria 663004
15 Ga0055541_1000003 3300003841 Bacteria 663004
16 Ga0058692_1000106 3300003856 Bacteria 55531
17 Ga0058692_1000371 3300003856 Bacteria 21594
18 Ga0058692_1001037 3300003856 Bacteria 10908
19 Ga0058692_1002070 3300003856 Bacteria 6917
20 Ga0058692_1003079 3300003856 Bacteria 5303
21 Ga0058692_1004680 3300003856 Bacteria 4021
22 Ga0058692_1005659 3300003856 Bacteria 3536
23 Ga0058692_1005661 3300003856 Bacteria 3536
24 Ga0058692_1005725 3300003856 Bacteria 3507
25 Ga0058692_1006199 3300003856 Bacteria 3311
26 Ga0058692_1020730 3300003856 Bacteria 1375
27 Ga0065704_10000547 3300005289 Bacteria 16797
28 Ga0065704_10004903 3300005289 Bacteria 4444
29 Ga0065704_10012519 3300005289 Bacteria 3064
30 Ga0065704_10077492 3300005289 Bacteria 4717
31 Ga0065704_10104675 3300005289 Bacteria 2125
32 Ga0070668_100059577 3300005347 Bacteria 2955
33 Ga0070662_100109476 3300005457 Bacteria 2102
34 Ga0070679_100114375 3300005530 Bacteria 2684
35 Ga0070665_100000683 3300005548 Bacteria 45467
36 Ga0070665_100061741 3300005548 Bacteria 3757
37 Ga0068851_10160216 3300005834 Bacteria 1236
38 Ga0075363_100000436 3300006048 Bacteria 13026
39 Ga0075364_10000277 3300006051 Bacteria 25091
40 Ga0075364_10006861 3300006051 Bacteria 6721
41 Ga0075364_10033302 3300006051 Bacteria 3317
42 Ga0075364_10050040 3300006051 Bacteria 2727
43 Ga0075364_10060238 3300006051 Bacteria 2489
44 Ga0075362_10000200 3300006177 Bacteria 16631
45 Ga0079104_1000018 3300006946 Bacteria 271088
46 Ga0079104_1000182 3300006946 Bacteria 89724
47 Ga0079104_1000293 3300006946 Bacteria 63236
48 Ga0079104_1000407 3300006946 Bacteria 49595
49 Ga0079104_1001234 3300006946 Bacteria 17981
50 Ga0079104_1001474 3300006946 Bacteria 15688
51 Ga0079104_1001679 3300006946 Bacteria 14173
52 Ga0079104_1001840 3300006946 Bacteria 12950
53 Ga0079104_1004358 3300006946 Bacteria 6102
54 Ga0079104_1006774 3300006946 Bacteria 4260
55 Ga0105251_10000258 3300009011 Bacteria 53140
56 Ga0105251_10000458 3300009011 Bacteria 39099
57 Ga0105251_10000961 3300009011 Bacteria 25652
58 Ga0105251_10001422 3300009011 Bacteria 20620
59 Ga0105251_10001458 3300009011 Bacteria 20336
60 Ga0105251_10001701 3300009011 Bacteria 18431
61 Ga0105251_10005108 3300009011 Bacteria 8687
62 Ga0105251_10006050 3300009011 Bacteria 7797
63 Ga0105251_10012176 3300009011 Bacteria 4880
64 Ga0105251_10062302 3300009011 Bacteria 1752
65 Ga0105251_10136010 3300009011 Bacteria 1113
66 Ga0105244_10000009 3300009036 Bacteria 286143
67 Ga0105244_10000040 3300009036 Bacteria 157237
68 Ga0105244_10000238 3300009036 Bacteria 56566
69 Ga0105244_10000419 3300009036 Bacteria 39526
70 Ga0105244_10000941 3300009036 Bacteria 24482
71 Ga0105244_10002390 3300009036 Bacteria 14212
72 Ga0105244_10005583 3300009036 Bacteria 8324
73 Ga0105244_10006898 3300009036 Bacteria 7284
74 Ga0105244_10032424 3300009036 Bacteria 2765
75 Ga0105244_10035096 3300009036 Bacteria 2636
76 Ga0105244_10106316 3300009036 Bacteria 1369
77 Ga0105244_10151908 3300009036 Bacteria 1109
78 Ga0105250_10000007 3300009092 Bacteria 355249
79 Ga0105250_10000018 3300009092 Bacteria 246692
80 Ga0105250_10000054 3300009092 Bacteria 114370
81 Ga0105250_10001789 3300009092 Bacteria 11261
82 Ga0105250_10003129 3300009092 Bacteria 7963
83 Ga0105250_10003485 3300009092 Bacteria 7444
84 Ga0105250_10058569 3300009092 Bacteria 1546
85 Ga0105250_10066879 3300009092 Bacteria 1450
86 Ga0105240_10417836 3300009093 Bacteria 1507
87 Ga0105247_10000100 3300009101 Bacteria 93272
88 Ga0105243_10022378 3300009148 Bacteria 4804
89 Ga0105243_10037282 3300009148 Bacteria 3777
90 Ga0105241_10000001 3300009174 Bacteria 879793
91 Ga0105237_10406255 3300009545 Bacteria 1367
92 Ga0105238_10790563 3300009551 Unclassified 964
93 Ga0105239_10536875 3300010375 Unclassified 1331
94 Ga0105239_10679832 3300010375 Bacteria 1176
95 Ga0105246_10406087 3300011119 Bacteria 1132
96 Ga0157373_10000314 3300013100 Bacteria 39019
97 Ga0157373_10001635 3300013100 Bacteria 17113
98 Ga0157373_10025332 3300013100 Bacteria 4292
99 Ga0157373_10061554 3300013100 Bacteria 2658
100 Ga0157373_10073222 3300013100 Bacteria 2418
101 Ga0157371_10000254 3300013102 Bacteria 74505
102 Ga0157371_10000859 3300013102 Bacteria 34664
103 Ga0157371_10006941 3300013102 Bacteria 9231
104 Ga0157371_10007312 3300013102 Bacteria 8968
105 Ga0157370_10000123 3300013104 Bacteria 91425
106 Ga0157370_10006736 3300013104 Bacteria 12605
107 Ga0157370_10007311 3300013104 Bacteria 12048
108 Ga0157370_10700070 3300013104 Bacteria 925
109 Ga0157369_10011177 3300013105 Bacteria 10202
110 Ga0157372_10003751 3300013307 Bacteria 16312
111 Ga0157372_10022326 3300013307 Bacteria 6846
112 Ga0157372_10023042 3300013307 Bacteria 6747
113 Ga0157372_10026795 3300013307 Bacteria 6275
114 Ga0182008_10000656 3300014497 Bacteria 25187
115 Ga0182008_10026761 3300014497 Bacteria 2924
116 Ga0182006_1000018 3300015261 Bacteria 299376
117 Ga0182006_1011932 3300015261 Bacteria 3804
118 Ga0183366_1001 3300015679 Bacteria 2743932
119 Ga0183370_1001 3300015680 Bacteria 2743932
120 Ga0183369_1001 3300015685 Bacteria 2743932
121 Ga0183368_1001 3300015687 Bacteria 2743932
122 Ga0163161_10000003 3300017792 Bacteria 339847
123 Ga0163161_10272636 3300017792 Bacteria 1324
124 Ga0213876_10000023 3300021384 Bacteria 255370
125 Ga0209760_100002 3300025207 Bacteria 274743
126 Ga0209784_100001 3300025224 Bacteria 3600592
127 Ga0209566_100001 3300025225 Bacteria 3600765
128 Ga0209674_100002 3300025226 Bacteria 3600592
129 Ga0209563_100002 3300025230 Bacteria 2045675
130 Ga0207427_100009 3300025231 Bacteria 663036
131 Ga0209437_100001 3300025233 Bacteria 2045675
132 Ga0209437_100103 3300025233 Bacteria 221904
133 Ga0209677_100002 3300025253 Bacteria 2045675
134 Ga0209129_1000037 3300025258 Bacteria 326534
135 Ga0209233_1006582 3300025261 Bacteria 3735
136 Ga0207696_1000001 3300025711 Bacteria 2579611
137 Ga0207696_1000013 3300025711 Bacteria 524881
138 Ga0207696_1000029 3300025711 Bacteria 398074
139 Ga0207696_1000053 3300025711 Bacteria 268590
140 Ga0207696_1000296 3300025711 Bacteria 58111
141 Ga0207696_1000422 3300025711 Bacteria 38880
142 Ga0207696_1000613 3300025711 Bacteria 26516
143 Ga0207696_1014996 3300025711 Bacteria 2639
144 Ga0207655_1000002 3300025728 Bacteria 1148694
145 Ga0207655_1000004 3300025728 Bacteria 1021221
146 Ga0207655_1000007 3300025728 Bacteria 773492
147 Ga0207655_1000036 3300025728 Bacteria 356747
148 Ga0207655_1000041 3300025728 Bacteria 333962
149 Ga0207655_1000241 3300025728 Bacteria 90061
150 Ga0207655_1000440 3300025728 Bacteria 55198
151 Ga0207655_1000589 3300025728 Bacteria 44851
152 Ga0207655_1000656 3300025728 Bacteria 41155
153 Ga0207655_1004853 3300025728 Bacteria 9341
154 Ga0207655_1007454 3300025728 Bacteria 7095
155 Ga0207655_1007588 3300025728 Bacteria 7018
156 Ga0207655_1008845 3300025728 Bacteria 6330
157 Ga0207655_1026789 3300025728 Bacteria 2760
158 Ga0207713_1000001 3300025735 Bacteria 2295391
159 Ga0207713_1000004 3300025735 Bacteria 702781
160 Ga0207713_1000018 3300025735 Bacteria 362635
161 Ga0207713_1000022 3300025735 Bacteria 351775
162 Ga0207713_1000023 3300025735 Bacteria 346097
163 Ga0207713_1000047 3300025735 Bacteria 229463
164 Ga0207713_1003478 3300025735 Bacteria 10719
165 Ga0207713_1004646 3300025735 Bacteria 8863
166 Ga0207713_1004888 3300025735 Bacteria 8581
167 Ga0207713_1005717 3300025735 Bacteria 7711
168 Ga0207713_1013334 3300025735 Bacteria 4338
169 Ga0207713_1014411 3300025735 Bacteria 4111
170 Ga0207713_1016945 3300025735 Bacteria 3679
171 Ga0207713_1044133 3300025735 Bacteria 1834
172 Ga0207713_1064518 3300025735 Bacteria 1378
173 Ga0207713_1086614 3300025735 Bacteria 1112
174 Ga0207710_10000337 3300025900 Bacteria 34732
175 Ga0207654_10000004 3300025911 Bacteria 902334
176 Ga0207652_10030840 3300025921 Bacteria 4495
177 Ga0207652_10082562 3300025921 Bacteria 2812
178 Ga0207706_10143328 3300025933 Bacteria 2102
179 Ga0207709_10116592 3300025935 Bacteria 1796
180 Ga0209281_1000004 3300027111 Bacteria 1253949
181 Ga0209281_1000006 3300027111 Bacteria 1170244
182 Ga0209281_1000014 3300027111 Bacteria 643021
183 Ga0209281_1000038 3300027111 Bacteria 361154
184 Ga0209281_1000300 3300027111 Bacteria 89506
185 Ga0209281_1000379 3300027111 Bacteria 70495
186 Ga0209281_1000473 3300027111 Bacteria 56260
187 Ga0209281_1000597 3300027111 Bacteria 41134
188 Ga0209281_1000672 3300027111 Bacteria 35791
189 Ga0209281_1001197 3300027111 Bacteria 17673
190 Ga0209281_1002669 3300027111 Bacteria 6763
191 Ga0209371_1000001 3300027312 Bacteria 2771503
192 Ga0209371_1000002 3300027312 Bacteria 1551985
193 Ga0209371_1000005 3300027312 Bacteria 1061740
194 Ga0209371_1000015 3300027312 Bacteria 659640
195 Ga0209371_1000100 3300027312 Bacteria 154467
196 Ga0209371_1000216 3300027312 Bacteria 78017
197 Ga0209371_1000262 3300027312 Bacteria 62261
198 Ga0209371_1000389 3300027312 Bacteria 46271
199 Ga0209371_1000786 3300027312 Bacteria 26206
200 Ga0209371_1001560 3300027312 Bacteria 15096
201 Ga0209371_1001626 3300027312 Bacteria 14537
202 Ga0209371_1003018 3300027312 Bacteria 8693
203 Ga0209371_1003141 3300027312 Bacteria 8393
204 Ga0209371_1003238 3300027312 Bacteria 8121
205 Ga0209371_1004086 3300027312 Bacteria 6572
206 Ga0209371_1010404 3300027312 Bacteria 2864
207 Ga0209371_1010700 3300027312 Bacteria 2792
208 Ga0268266_10003550 3300028379 Bacteria 15483
209 Ga0268256_1000001 3300030500 Bacteria 2771065
210 Ga0268256_1000002 3300030500 Bacteria 1535763
211 Ga0268256_1000006 3300030500 Bacteria 1063991
212 Ga0268256_1000018 3300030500 Bacteria 594572
213 Ga0268256_1000035 3300030500 Bacteria 384794
214 Ga0268256_1000089 3300030500 Bacteria 154491
215 Ga0268256_1000783 3300030500 Bacteria 22961
216 Ga0268256_1000925 3300030500 Bacteria 20272
217 Ga0268256_1001777 3300030500 Bacteria 12168
218 Ga0268256_1002801 3300030500 Bacteria 8453
219 Ga0268256_1002941 3300030500 Bacteria 8121
220 Ga0268256_1003019 3300030500 Bacteria 7942
221 Ga0268256_1004368 3300030500 Bacteria 5891
222 Ga0268256_1009064 3300030500 Bacteria 3345
223 Ga0268256_1011057 3300030500 Bacteria 2887
224 Ga0265327_10075311 3300031251 Bacteria 1679
225 Ga0265316_10049105 3300031344 Bacteria 3325
226 Ga0265342_10053795 3300031712 Bacteria 2395
227 Ga0316576_10010486 3300031727 Bacteria 6024
228 Ga0316576_10018586 3300031727 Bacteria 4747
229 Ga0316576_10032156 3300031727 Bacteria 3727
230 Ga0316576_10261527 3300031727 Bacteria 1298
231 Ga0316578_10100442 3300031728 Unclassified 1734
232 Ga0316578_10131624 3300031728 Bacteria 1505
233 Ga0316578_10209759 3300031728 Bacteria 1172
234 Ga0316577_10000066 3300031733 Bacteria 25988
235 Ga0316577_10080654 3300031733 Bacteria 1819
236 Ga0316577_10107855 3300031733 Bacteria 1562
237 Ga0316583_10025948 3300032133 Bacteria 2092
238 Ga0316580_10006841 3300032139 Bacteria 3377
239 Ga0316593_10051914 3300032168 Bacteria 1387
240 Ga0316593_10072172 3300032168 Bacteria 1195
241 Ga0316596_1008136 3300033541 Bacteria 2493
242 Ga0316574_0018103 3300035398 Bacteria 4135
243 Ga0316574_0026700 3300035398 Bacteria 3474
244 Ga0316582_0056111 3300036647 Bacteria 2512
245 Ga0316584_0208025 3300036712 Bacteria 1441
246 Ga0316584_0297493 3300036712 Bacteria 1169
247 Ga0316584_0299698 3300036712 Bacteria 1164
248 Ga0400484_00293 3300038725 Bacteria 1988
249 Ga0400484_03662 3300038725 Bacteria 37467
250 Ga0400490_10089 3300038726 Bacteria 16159
251 Ga0400490_24476 3300038726 Bacteria 1838
252 Ga0400490_26859 3300038726 Bacteria 1934
253 Ga0400490_34423 3300038726 Bacteria 25553
254 Ga0400490_35683 3300038726 Bacteria 4424
255 Ga0400490_47969 3300038726 Bacteria 1390
256 Ga0400490_54276 3300038726 Bacteria 12253
257 Ga0400490_59274 3300038726 Bacteria 8409
258 Ga0400491_00707 3300038727 Bacteria 2543
259 Ga0400491_26268 3300038727 Bacteria 3208
260 Ga0400491_26892 3300038727 Unclassified 1190
261 Ga0400485_06984 3300038735 Bacteria 14026
262 Ga0400485_07339 3300038735 Bacteria 141809
263 Ga0400485_07748 3300038735 Bacteria 63267
264 Ga0400485_14019 3300038735 Bacteria 1609
265 Ga0400488_18567 3300038741 Bacteria 3346
266 Ga0400488_28819 3300038741 Bacteria 28601
267 Ga0400488_54045 3300038741 Bacteria 7590
268 Ga0400486_00296 3300038742 Bacteria 1229
269 Ga0400486_00966 3300038742 Bacteria 11287
270 Ga0400486_01623 3300038742 Bacteria 34748
271 Ga0400486_14087 3300038742 Bacteria 21862
272 Ga0400486_14586 3300038742 Bacteria 5171
273 Ga0400486_19415 3300038742 Bacteria 158382
274 Ga0400486_24596 3300038742 Bacteria 1482
275 Ga0400486_29974 3300038742 Bacteria 34927
276 Ga0400483_038188 3300039062 Bacteria 13205
277 Ga0400483_041847 3300039062 Unclassified 4030
278 Ga0400483_084528 3300039062 Bacteria 14039
279 Ga0400483_129672 3300039062 Bacteria 1060
280 Ga0400483_155485 3300039062 Bacteria 6751
281 Ga0400483_163918 3300039062 Bacteria 10902
282 Ga0400483_216040 3300039062 Unclassified 4283
283 Ga0400483_264393 3300039062 Bacteria 2212
284 Ga0400483_269519 3300039062 Bacteria 16980
285 Ga0400489_08878 3300039093 Bacteria 10167
286 Ga0400489_26482 3300039093 Bacteria 15376
287 Ga0400489_44709 3300039093 Bacteria 38757
288 Ga0400489_58669 3300039093 Bacteria 13957
289 Ga0400487_04533 3300039110 Bacteria 51421
290 Ga0400487_21430 3300039110 Bacteria 187786
291 Ga0400487_55774 3300039110 Bacteria 4011
292 Ga0400487_56668 3300039110 Bacteria 1669
293 Ga0400487_59162 3300039110 Unclassified 3276
294 Ga0400487_62693 3300039110 Bacteria 1908
295 Ga0436365_0965775 3300039437 Bacteria 470291
296 Ga0439438_000002 3300041405 Bacteria 618223
297 Ga0439438_003537 3300041405 Bacteria 6291
298 Ga0439438_050800 3300041405 Bacteria 1054
299 Ga0439447_007471 3300041407 Bacteria 3467
300 Ga0439447_009309 3300041407 Bacteria 2987
301 Ga0439447_013379 3300041407 Bacteria 2329
302 Ga0439466_0000001 3300041411 Bacteria 647258
303 Ga0439432_001624 3300042006 Bacteria 8411
304 Ga0439432_015113 3300042006 Bacteria 2608
305 Ga0439432_021944 3300042006 Bacteria 2112
306 Ga0439449_0015235 3300042007 Bacteria 2889
307 Ga0439452_000001 3300042010 Bacteria 1725439
308 Ga0439452_000002 3300042010 Bacteria 1377577
309 Ga0439452_000020 3300042010 Bacteria 309345
310 Ga0439452_000032 3300042010 Bacteria 184797
311 Ga0439452_003837 3300042010 Bacteria 5161
312 Ga0439456_009256 3300042013 Bacteria 2035
313 Ga0439463_023682 3300042016 Bacteria 1537
314 Ga0450907_001577 3300042146 Bacteria 4848
315 Ga0439464_0034570 3300042439 Bacteria 1425
316 Ga0439464_0042653 3300042439 Bacteria 1296
317 Ga0451577_0000317 3300042876 Bacteria 91191
318 Ga0451577_0009693 3300042876 Bacteria 9234
319 Ga0451577_0021379 3300042876 Bacteria 5922
320 Ga0451577_0068246 3300042876 Bacteria 3171
321 Ga0451577_0127246 3300042876 Bacteria 2283
322 Ga0451577_0301769 3300042876 Unclassified 1451
323 Ga0451577_0590913 3300042876 Bacteria 1008
324 Ga0466981_0000003 3300044669 Bacteria 248458
325 Ga0453683_0000680 3300044673 Bacteria 36070
326 Ga0453683_0011835 3300044673 Bacteria 5741
327 Ga0453683_0044388 3300044673 Bacteria 2789
328 Ga0453683_0086658 3300044673 Bacteria 1962
329 Ga0453683_0292043 3300044673 Bacteria 1042
330 Ga0453684_0000388 3300044712 Bacteria 180685
331 Ga0453684_0001032 3300044712 Bacteria 89042
332 Ga0453684_0003638 3300044712 Bacteria 34257
333 Ga0453684_0008931 3300044712 Bacteria 17738
334 Ga0453684_0025627 3300044712 Bacteria 8557
335 Ga0453684_0041335 3300044712 Bacteria 6239
336 Ga0453684_0042349 3300044712 Bacteria 6139
337 Ga0453684_0058860 3300044712 Bacteria 4959
338 Ga0451576_0000702 3300045051 Bacteria 68025
339 Ga0451576_0005301 3300045051 Bacteria 16204
340 Ga0451576_0006347 3300045051 Bacteria 14520
341 Ga0451576_0029343 3300045051 Bacteria 5887
342 Ga0451576_0048347 3300045051 Bacteria 4468
343 Ga0451576_0119048 3300045051 Bacteria 2749
344 Ga0495617_089563 3300046452 Bacteria 1005
345 Ga0495627_000019 3300046453 Bacteria 309691
346 Ga0495591_000001 3300046458 Bacteria 503087
347 Ga0495591_000175 3300046458 Bacteria 66184
348 Ga0495591_002419 3300046458 Bacteria 10404
349 Ga0495591_008462 3300046458 Bacteria 4214
350 Ga0495650_0000018 3300046471 Bacteria 538888
351 Ga0495650_0000047 3300046471 Bacteria 335136
352 Ga0495650_0000790 3300046471 Bacteria 38757
353 Ga0495650_0052819 3300046471 Bacteria 1666
354 Ga0495596_0022738 3300046500 Bacteria 2550
355 Ga0495606_0000930 3300046507 Bacteria 43161
356 Ga0495620_0016371 3300046515 Bacteria 3722
357 Ga0495643_0087172 3300046522 Bacteria 1616
358 Ga0495643_0150402 3300046522 Bacteria 1153
359 Ga0495644_0010739 3300046523 Bacteria 3529
360 Ga0495648_0003595 3300046524 Bacteria 13563
361 Ga0495648_0004272 3300046524 Bacteria 12253
362 Ga0495654_0000009 3300046530 Bacteria 381872
363 Ga0495654_0000862 3300046530 Bacteria 22941
364 Ga0495654_0001153 3300046530 Bacteria 18909
365 Ga0495654_0015084 3300046530 Bacteria 4106
366 Ga0495654_0041707 3300046530 Bacteria 2281
367 Ga0495654_0042147 3300046530 Bacteria 2267
368 Ga0495597_0000616 3300046542 Bacteria 29116
369 Ga0495668_0034455 3300046616 Bacteria 2840
370 Ga0495625_0014488 3300046660 Bacteria 6288
371 Ga0495588_0027702 3300046674 Bacteria 2833
372 Ga0495649_0001918 3300046694 Bacteria 15150
373 Ga0495649_0004280 3300046694 Bacteria 9363
374 Ga0495649_0011360 3300046694 Bacteria 5225
375 Ga0495649_0155477 3300046694 Bacteria 1200
376 Ga0495589_0000003 3300046794 Bacteria 453448
377 Ga0495589_0009125 3300046794 Bacteria 5156
378 Ga0495660_0000004 3300046810 Bacteria 1003183
379 Ga0495660_0000015 3300046810 Bacteria 324892
380 Ga0495672_0000001 3300047320 Bacteria 1458820
381 Ga0495672_0000009 3300047320 Bacteria 557755
382 Ga0495672_0000038 3300047320 Bacteria 273489
383 Ga0495679_000113 3300047446 Bacteria 72806
384 Ga0495679_001613 3300047446 Bacteria 12606
385 Ga0495679_014882 3300047446 Bacteria 2865
386 Ga0495679_016770 3300047446 Bacteria 2641
387 Ga0495679_071470 3300047446 Bacteria 999
388 Ga0495673_0000019 3300047469 Bacteria 554389
389 Ga0495673_0000114 3300047469 Bacteria 159048
390 Ga0496101_0000169 3300048904 Bacteria 54000
391 Ga0496101_0118922 3300048904 Bacteria 1996
392 Ga0496102_0001722 3300048905 Bacteria 19138
393 Ga0496102_0091813 3300048905 Bacteria 2811
394 Ga0496104_0000250 3300048907 Bacteria 47643
395 Ga0496105_0028531 3300048908 Bacteria 4563
396 Ga0496105_0031410 3300048908 Bacteria 4353
397 Ga0496105_0156944 3300048908 Bacteria 1868
398 Ga0496113_0179214 3300048916 Bacteria 1680
399 Ga0496116_0000007 3300048919 Bacteria 795464
400 Ga0496116_0000083 3300048919 Bacteria 220955
401 Ga0496116_0000110 3300048919 Bacteria 185668
402 Ga0496116_0000132 3300048919 Bacteria 156427
403 Ga0496116_0002143 3300048919 Bacteria 21016
404 Ga0496116_0005273 3300048919 Bacteria 12064
405 Ga0496116_0011127 3300048919 Bacteria 7480
406 Ga0496116_0105760 3300048919 Bacteria 1668
407 Ga0496117_0000009 3300048920 Bacteria 613759
408 Ga0496117_0000802 3300048920 Bacteria 48832
409 Ga0496117_0000973 3300048920 Bacteria 43846
410 Ga0496117_0001854 3300048920 Bacteria 28514
411 Ga0496117_0002689 3300048920 Bacteria 21964
412 Ga0496117_0003025 3300048920 Bacteria 20171
413 Ga0496117_0033080 3300048920 Bacteria 3915
414 Ga0496117_0049115 3300048920 Bacteria 3005
415 Ga0496117_0057332 3300048920 Bacteria 2706
416 Ga0496117_0060566 3300048920 Bacteria 2607
417 Ga0496117_0067379 3300048920 Bacteria 2422
418 Ga0496117_0096478 3300048920 Bacteria 1886
419 Ga0496117_0106073 3300048920 Bacteria 1764
420 Ga0496118_0000017 3300048921 Bacteria 549445
421 Ga0496118_0000915 3300048921 Bacteria 46107
422 Ga0496118_0003011 3300048921 Bacteria 21764
423 Ga0496118_0006238 3300048921 Bacteria 13174
424 Ga0496118_0015377 3300048921 Bacteria 7086
425 Ga0496118_0021309 3300048921 Bacteria 5709
426 Ga0496118_0046477 3300048921 Bacteria 3376
427 Ga0496118_0071011 3300048921 Bacteria 2509
428 Ga0496118_0072882 3300048921 Bacteria 2463
429 Ga0496118_0075528 3300048921 Bacteria 2402
430 Ga0496118_0099184 3300048921 Bacteria 1975
431 Ga0496118_0129657 3300048921 Bacteria 1622
432 Ga0496118_0135517 3300048921 Bacteria 1572
433 Ga0496119_0000012 3300048922 Bacteria 411917
434 Ga0496119_0000049 3300048922 Bacteria 185482
435 Ga0496119_0000167 3300048922 Bacteria 91883
436 Ga0496119_0000807 3300048922 Bacteria 41929
437 Ga0496119_0001500 3300048922 Bacteria 27903
438 Ga0496119_0002544 3300048922 Bacteria 19840
439 Ga0496119_0002788 3300048922 Bacteria 18735
440 Ga0496119_0005582 3300048922 Bacteria 11962
441 Ga0496119_0029374 3300048922 Bacteria 3730
442 Ga0496119_0068326 3300048922 Bacteria 2092
443 Ga0496120_0000004 3300048923 Bacteria 534793
444 Ga0496120_0000048 3300048923 Bacteria 187988
445 Ga0496120_0000057 3300048923 Bacteria 177460
446 Ga0496120_0000198 3300048923 Bacteria 103186
447 Ga0496120_0000411 3300048923 Bacteria 68454
448 Ga0496120_0000441 3300048923 Bacteria 65743
449 Ga0496120_0001573 3300048923 Bacteria 26679
450 Ga0496120_0001646 3300048923 Bacteria 25844
451 Ga0496120_0001701 3300048923 Bacteria 25189
452 Ga0496120_0009200 3300048923 Bacteria 7039
453 Ga0496120_0010498 3300048923 Bacteria 6456
454 Ga0496120_0044886 3300048923 Bacteria 2564
455 Ga0496120_0084039 3300048923 Bacteria 1717
456 Ga0496121_0003345 3300048924 Bacteria 23009
457 Ga0496121_0005220 3300048924 Bacteria 16821
458 Ga0496121_0006982 3300048924 Bacteria 13737
459 Ga0496121_0010384 3300048924 Bacteria 10514
460 Ga0496121_0039242 3300048924 Bacteria 4177
461 Ga0496121_0080604 3300048924 Bacteria 2579
462 Ga0496122_0000003 3300048925 Bacteria 645810
463 Ga0496122_0000088 3300048925 Bacteria 207600
464 Ga0496122_0000135 3300048925 Bacteria 170955
465 Ga0496122_0001653 3300048925 Bacteria 34606
466 Ga0496122_0011973 3300048925 Bacteria 8702
467 Ga0496122_0013723 3300048925 Bacteria 7902
468 Ga0496122_0016774 3300048925 Bacteria 6899
469 Ga0496122_0029115 3300048925 Bacteria 4667
470 Ga0496122_0033200 3300048925 Bacteria 4250
471 Ga0496122_0033476 3300048925 Bacteria 4225
472 Ga0496122_0035339 3300048925 Bacteria 4068
473 Ga0496122_0091025 3300048925 Bacteria 2079
474 Ga0496123_0000004 3300048926 Bacteria 777230
475 Ga0496123_0000012 3300048926 Bacteria 458760
476 Ga0496123_0000606 3300048926 Bacteria 60830
477 Ga0496123_0001446 3300048926 Bacteria 33076
478 Ga0496123_0002538 3300048926 Bacteria 22355
479 Ga0496123_0005403 3300048926 Bacteria 12876
480 Ga0496123_0011259 3300048926 Bacteria 7775
481 Ga0496123_0011546 3300048926 Bacteria 7642
482 Ga0496123_0017680 3300048926 Bacteria 5719
483 Ga0496123_0049114 3300048926 Bacteria 2832
484 Ga0496123_0059720 3300048926 Bacteria 2462
485 Ga0496123_0080389 3300048926 Bacteria 1987
486 Ga0496123_0135871 3300048926 Bacteria 1353
487 Ga0496123_0198827 3300048926 Bacteria 1029
488 Ga0496124_0000028 3300048927 Bacteria 357219
489 Ga0496124_0000045 3300048927 Bacteria 287396
490 Ga0496124_0000165 3300048927 Bacteria 134661
491 Ga0496124_0000611 3300048927 Bacteria 60081
492 Ga0496124_0000990 3300048927 Bacteria 44992
493 Ga0496124_0001906 3300048927 Bacteria 28630
494 Ga0496124_0002699 3300048927 Bacteria 22685
495 Ga0496124_0004775 3300048927 Bacteria 15598
496 Ga0496124_0012270 3300048927 Bacteria 8468
497 Ga0496124_0018566 3300048927 Bacteria 6509
498 Ga0496124_0056478 3300048927 Bacteria 3310
499 Ga0496124_0086712 3300048927 Bacteria 2561
500 Ga0496124_0222666 3300048927 Bacteria 1417
501 Ga0496125_0000091 3300048928 Bacteria 212668
502 Ga0496125_0000131 3300048928 Bacteria 162607
503 Ga0496125_0002460 3300048928 Bacteria 24063
504 Ga0496125_0009402 3300048928 Bacteria 10052
505 Ga0496125_0033990 3300048928 Bacteria 4502
506 Ga0496125_0052972 3300048928 Bacteria 3331
507 Ga0496125_0075880 3300048928 Bacteria 2598
508 Ga0496125_0078980 3300048928 Bacteria 2526
509 Ga0496126_0002503 3300048929 Bacteria 24664
510 Ga0496126_0004059 3300048929 Bacteria 17766
511 Ga0496126_0015207 3300048929 Bacteria 7748
512 Ga0496126_0038645 3300048929 Bacteria 4437
513 Ga0496126_0056918 3300048929 Bacteria 3532
514 Ga0496126_0081355 3300048929 Bacteria 2863
515 Ga0496126_0112830 3300048929 Bacteria 2366
516 Ga0496126_0266583 3300048929 Bacteria 1422
517 Ga0495678_001229 3300049459 Bacteria 20888
518 Ga0495682_0000001 3300049460 Bacteria 1559116
519 nmdc:mga03683_255_c1 3300050489 Bacteria 16638
520 nmdc:mga03n38_179174_c1 3300050490 Unclassified 1085
521 nmdc:mga00v17_23128_c1 3300050491 Bacteria 3593
522 nmdc:mga00v17_36331_c1 3300050491 Bacteria 2935
523 nmdc:mga00v17_42571_c1 3300050491 Bacteria 2732
524 nmdc:mga00v17_840_c1 3300050491 Bacteria 16658
525 Ga0500621_000002 3300053126 Bacteria 849473
526 Ga0500638_000001 3300053162 Bacteria 354827
527 2506579445 2506520007 Bacteria 5442880
528 2506584584 2506520008 Bacteria 5443009
529 2508853289 2508501071 Bacteria 5454741
530 2511379989 2511231025 Bacteria 5324661
531 2511435009 2511231035 Bacteria 5341610
532 2538424207 2537561728 Bacteria 5149301
533 2547698552 2547132181 Bacteria 4945084
534 2548648337 2547132416 Bacteria 4633861
535 2555259757 2554235234 Bacteria 5762085
536 2562463454 2561511199 Bacteria 5155034
537 2585829709 2585427591 Bacteria 5482980
538 2585835330 2585427592 Bacteria 5370892
539 2599411347 2599185169 Bacteria 5441380
540 2599926436 2599185299 Bacteria 4854625
541 2601524342 2600255254 Bacteria 5281859
542 2601529496 2600255255 Bacteria 5282785
543 2601534937 2600255256 Bacteria 5597742
544 2601539434 2600255257 Bacteria 5597196
545 2601616330 2600255280 Bacteria 5292309
546 2601621052 2600255281 Bacteria 5288753
547 2601644396 2600255287 Bacteria 5210468
548 2601649449 2600255288 Bacteria 5282738
549 2601654376 2600255289 Bacteria 5281907
550 2601659798 2600255290 Bacteria 5282218
551 2601664218 2600255291 Bacteria 5217298
552 2601697178 2600255298 Bacteria 5215185
553 2601702224 2600255299 Bacteria 5218662
554 2601707120 2600255300 Bacteria 5287774
555 2601711928 2600255301 Bacteria 5280532
556 2601717637 2600255302 Bacteria 5288235
557 2601722096 2600255303 Bacteria 5219315
558 2601727565 2600255304 Bacteria 5283973
559 2601732370 2600255305 Bacteria 5282329
560 2601737115 2600255306 Bacteria 5281613
561 2601741397 2600255307 Bacteria 5439064
562 2601752349 2600255309 Bacteria 5431045
563 2601757784 2600255310 Bacteria 5600903
564 2601764142 2600255311 Bacteria 5598766
565 2602019190 2600255392 Bacteria 5437392
566 2603636952 2602042046 Bacteria 5483348
567 2603644925 2602042047 Bacteria 4697674
568 2603662382 2602042052 Bacteria 5215873
569 2603667278 2602042053 Bacteria 5214361
570 2603699260 2602042066 Bacteria 4423871
571 2603705294 2602042067 Bacteria 4863713
572 2603839989 2602042103 Bacteria 5284714
573 2603845066 2602042104 Bacteria 5281639
574 2603849930 2602042105 Bacteria 5282303
575 2603855207 2602042106 Bacteria 5282744
576 2603868018 2602042109 Bacteria 5152801
577 2603872787 2602042110 Bacteria 5283285
578 2603878089 2602042111 Bacteria 5212080
579 2606049756 2603880178 Bacteria 5283018
580 2606071418 2603880184 Bacteria 5217896
581 2606147651 2603880202 Bacteria 5284684
582 2606177645 2603880211 Bacteria 5284226
583 2608669968 2608642108 Bacteria 4104624
584 2609909740 2609459761 Bacteria 5513740
585 2637224167 2636415599 Bacteria 5718434
586 2650897180 2648501693 Bacteria 5069560
587 2656275963 2654587920 Bacteria 5475511
588 2671101204 2667528172 Bacteria 5170840
589 2671107022 2667528173 Bacteria 5375747
590 2671584622 2671180115 Bacteria 5353919
591 2676405572 2675903046 Bacteria 5451247
592 2681996297 2681812866 Bacteria 4552357
593 2682006357 2681812869 Bacteria 5014465
594 2686354088 2684622997 Bacteria 4624240
595 2687579309 2687453129 Bacteria 4387428
596 2689446020 2687453601 Bacteria 5546041
597 2707100488 2706794495 Bacteria 4536932
598 2740991466 2740891818 Bacteria 6711283
599 2753856841 2751185917 Bacteria 4551186
600 2765589936 2765235842 Bacteria 4799256
601 2772439901 2772190666 Bacteria 5117644
602 2775541382 2775506706 Bacteria 4873073
603 2777020860 2775507074 Bacteria 5532402
604 2791922206 2791354903 Bacteria 4937680
605 2792312104 2791355010 Bacteria 4864581
606 2793404814 2791355275 Bacteria 4429597
607 2807180043 2806310673 Bacteria 4801221
608 2809125641 2808606414 Bacteria 4917181
609 2813727963 2811995292 Bacteria 5303342
610 2814695505 2814123068 Bacteria 5687681
611 2821120965 2821118458 Bacteria 4714306
612 2823375590 2823373977 Bacteria 4779415
613 2844428284 2844425489 Bacteria 4854065
614 2844529065 2844528606 Bacteria 4733806
615 2846543331 2846540461 Bacteria 5471451
616 2847086694 2847085930 Bacteria 5070450
617 2847799057 2847797336 Bacteria 5176640
618 2852103936 2852103415 Bacteria 5193810
619 2858467605 2858466076 Bacteria 4722413
620 2865018529 2865014394 Bacteria 4764573
621 2869555365 2869551831 Bacteria 5474685
622 2871274222 2871272651 Bacteria 5042015
623 2871285343 2871282230 Bacteria 4917173
624 2876603338 2876601092 Bacteria 5114497
625 2881612871 2881609920 Bacteria 4405319
626 2884088014 2884086401 Bacteria 5005459
627 2888370010 2888366609 Bacteria 5155009
628 2888377485 2888373701 Bacteria 5098052
629 2891671505 2891670763 Bacteria 4967099
630 2900052386 2900051742 Bacteria 4985156
631 2904475951 2904474040 Bacteria 5504324
632 2904506348 2904504865 Bacteria 5152820
633 2904515481 2904513164 Bacteria 5476410
634 2908672357 2908669403 Bacteria 5740494
635 2919110865 2919108558 Bacteria 5897419
636 2919152120 2919150387 Bacteria 5500879
637 2919493250 2919493220 Bacteria 4598500
638 2919543125 2919543075 Bacteria 4728703
639 2923528362 2923525760 Bacteria 4472324
640 2923635750 2923634449 Bacteria 4753480
641 2927144789 2927143783 Bacteria 5504251
642 2927837748 2927833300 Bacteria 4923934
643 2932408928 2932406140 Bacteria 5134491
644 2935625838 2935625433 Bacteria 5042964
645 2937542530 2937539931 Bacteria 4639830
646 2937968545 2937967321 Bacteria 5094075
647 2939569960 2939568625 Bacteria 4542555
648 2939575238 2939573065 Bacteria 4926053
649 2939582060 2939577877 Bacteria 5132791
650 2939604742 2939602548 Bacteria 4950493
651 2939608756 2939607340 Bacteria 4719256
652 2939618413 2939617950 Bacteria 4820956
653 2939643021 2939642701 Bacteria 4475280
654 2945876929 2945874760 Bacteria 5527237
655 2945952291 2945951305 Bacteria 4918162
656 2969081202 2969079654 Bacteria 5439582
657 2971822588 2971820967 Bacteria 5823634
658 2974311178 2974310843 Bacteria 4947816
659 2974439207 2974435778 Bacteria 4876478
660 2978978766 2978975091 Bacteria 4704313
661 2984497451 2984494565 Bacteria 5000175
662 2984563660 2984559226 Bacteria 5683096
663 2984596394 2984595703 Bacteria 5682994
664 2990261402 2990261002 Bacteria 4919493
665 3000378450 3000376612 Bacteria 4705565
666 640938770 640753048 Bacteria 5495657
667 8004596075 8004592986 Bacteria 5122074
668 8015396582 8015394850 Bacteria 5064660
669 8016735131 8016733728 Bacteria 5274317
670 8018225724 8018221730 Bacteria 4616064
671 8019501386 8019499862 Bacteria 5169538
672 8019505249 8019504834 Bacteria 4819156
673 8054846556 8054844752 Bacteria 4450330
674 8054851892 8054849141 Bacteria 5232694
675 8055092086 8055087960 Bacteria 4784273
676 8055095422 8055092621 Bacteria 4873875
677 8055100118 8055097453 Bacteria 4865496
678 8055696725 8055693939 Bacteria 4772047
679 8057306857 8057304971 Bacteria 4649742
680 Ga0075370_10045422
681 SwRhRL2b_contig_1568905
682 SwRhRL2b_contig_1593964
683 SwRhRL2b_contig_704064
684 JGI24739J22299_10000367
685 JGI25162J39368_1003285
686 JGI25163J39215_1000388
687 JGI25164J39214_1000098
688 JGI25152J39213_1005840
689 rootH2_10009953
690 Ga0055538_1000003
691 Ga0055539_1000003
692 Ga0055533_1000005
693 Ga0055525_1000005
694 Ga0055541_1000003
695 Ga0058692_1000106
696 Ga0058692_1000371
697 Ga0058692_1001037
698 Ga0058692_1002070
699 Ga0058692_1003079
700 Ga0058692_1004680
701 Ga0058692_1005659
702 Ga0058692_1005661
703 Ga0058692_1005725
704 Ga0058692_1006199
705 Ga0058692_1020730
706 Ga0065704_10000547
707 Ga0065704_10004903
708 Ga0065704_10012519
709 Ga0065704_10077492
710 Ga0065704_10104675
711 Ga0070668_100059577
712 Ga0070662_100109476
713 Ga0070679_100114375
714 Ga0070665_100000683
715 Ga0070665_100061741
716 Ga0068851_10160216
717 Ga0075363_100000436
718 Ga0075364_10000277
719 Ga0075364_10006861
720 Ga0075364_10033302
721 Ga0075364_10050040
722 Ga0075364_10060238
723 Ga0075362_10000200
724 Ga0079104_1000018
725 Ga0079104_1000182
726 Ga0079104_1000293
727 Ga0079104_1000407
728 Ga0079104_1001234
729 Ga0079104_1001474
730 Ga0079104_1001679
731 Ga0079104_1001840
732 Ga0079104_1004358
733 Ga0079104_1006774
734 Ga0105251_10000258
735 Ga0105251_10000458
736 Ga0105251_10000961
737 Ga0105251_10001422
738 Ga0105251_10001458
739 Ga0105251_10001701
740 Ga0105251_10005108
741 Ga0105251_10006050
742 Ga0105251_10012176
743 Ga0105251_10062302
744 Ga0105251_10136010
745 Ga0105244_10000009
746 Ga0105244_10000040
747 Ga0105244_10000238
748 Ga0105244_10000419
749 Ga0105244_10000941
750 Ga0105244_10002390
751 Ga0105244_10005583
752 Ga0105244_10006898
753 Ga0105244_10032424
754 Ga0105244_10035096
755 Ga0105244_10106316
756 Ga0105244_10151908
757 Ga0105250_10000007
758 Ga0105250_10000018
759 Ga0105250_10000054
760 Ga0105250_10001789
761 Ga0105250_10003129
762 Ga0105250_10003485
763 Ga0105250_10058569
764 Ga0105250_10066879
765 Ga0105240_10417836
766 Ga0105247_10000100
767 Ga0105243_10022378
768 Ga0105243_10037282
769 Ga0105241_10000001
770 Ga0105237_10406255
771 Ga0105238_10790563
772 Ga0105239_10536875
773 Ga0105239_10679832
774 Ga0105246_10406087
775 Ga0157373_10000314
776 Ga0157373_10001635
777 Ga0157373_10025332
778 Ga0157373_10061554
779 Ga0157373_10073222
780 Ga0157371_10000254
781 Ga0157371_10000859
782 Ga0157371_10006941
783 Ga0157371_10007312
784 Ga0157370_10000123
785 Ga0157370_10006736
786 Ga0157370_10007311
787 Ga0157370_10700070
788 Ga0157369_10011177
789 Ga0157372_10003751
790 Ga0157372_10022326
791 Ga0157372_10023042
792 Ga0157372_10026795
793 Ga0182008_10000656
794 Ga0182008_10026761
795 Ga0182006_1000018
796 Ga0182006_1011932
797 Ga0183366_1001
798 Ga0183370_1001
799 Ga0183369_1001
800 Ga0183368_1001
801 Ga0163161_10000003
802 Ga0163161_10272636
803 Ga0213876_10000023
804 Ga0209760_100002
805 Ga0209784_100001
806 Ga0209566_100001
807 Ga0209674_100002
808 Ga0209563_100002
809 Ga0207427_100009
810 Ga0209437_100001
811 Ga0209437_100103
812 Ga0209677_100002
813 Ga0209129_1000037
814 Ga0209233_1006582
815 Ga0207696_1000001
816 Ga0207696_1000013
817 Ga0207696_1000029
818 Ga0207696_1000053
819 Ga0207696_1000296
820 Ga0207696_1000422
821 Ga0207696_1000613
822 Ga0207696_1014996
823 Ga0207655_1000002
824 Ga0207655_1000004
825 Ga0207655_1000007
826 Ga0207655_1000036
827 Ga0207655_1000041
828 Ga0207655_1000241
829 Ga0207655_1000440
830 Ga0207655_1000589
831 Ga0207655_1000656
832 Ga0207655_1004853
833 Ga0207655_1007454
834 Ga0207655_1007588
835 Ga0207655_1008845
836 Ga0207655_1026789
837 Ga0207713_1000001
838 Ga0207713_1000004
839 Ga0207713_1000018
840 Ga0207713_1000022
841 Ga0207713_1000023
842 Ga0207713_1000047
843 Ga0207713_1003478
844 Ga0207713_1004646
845 Ga0207713_1004888
846 Ga0207713_1005717
847 Ga0207713_1013334
848 Ga0207713_1014411
849 Ga0207713_1016945
850 Ga0207713_1044133
851 Ga0207713_1064518
852 Ga0207713_1086614
853 Ga0207710_10000337
854 Ga0207654_10000004
855 Ga0207652_10030840
856 Ga0207652_10082562
857 Ga0207706_10143328
858 Ga0207709_10116592
859 Ga0209281_1000004
860 Ga0209281_1000006
861 Ga0209281_1000014
862 Ga0209281_1000038
863 Ga0209281_1000300
864 Ga0209281_1000379
865 Ga0209281_1000473
866 Ga0209281_1000597
867 Ga0209281_1000672
868 Ga0209281_1001197
869 Ga0209281_1002669
870 Ga0209371_1000001
871 Ga0209371_1000002
872 Ga0209371_1000005
873 Ga0209371_1000015
874 Ga0209371_1000100
875 Ga0209371_1000216
876 Ga0209371_1000262
877 Ga0209371_1000389
878 Ga0209371_1000786
879 Ga0209371_1001560
880 Ga0209371_1001626
881 Ga0209371_1003018
882 Ga0209371_1003141
883 Ga0209371_1003238
884 Ga0209371_1004086
885 Ga0209371_1010404
886 Ga0209371_1010700
887 Ga0268266_10003550
888 Ga0268256_1000001
889 Ga0268256_1000002
890 Ga0268256_1000006
891 Ga0268256_1000018
892 Ga0268256_1000035
893 Ga0268256_1000089
894 Ga0268256_1000783
895 Ga0268256_1000925
896 Ga0268256_1001777
897 Ga0268256_1002801
898 Ga0268256_1002941
899 Ga0268256_1003019
900 Ga0268256_1004368
901 Ga0268256_1009064
902 Ga0268256_1011057
903 Ga0265327_10075311
904 Ga0265316_10049105
905 Ga0265342_10053795
906 Ga0316576_10010486
907 Ga0316576_10018586
908 Ga0316576_10032156
909 Ga0316576_10261527
910 Ga0316578_10100442
911 Ga0316578_10131624
912 Ga0316578_10209759
913 Ga0316577_10000066
914 Ga0316577_10080654
915 Ga0316577_10107855
916 Ga0316583_10025948
917 Ga0316580_10006841
918 Ga0316593_10051914
919 Ga0316593_10072172
920 Ga0316596_1008136
921 Ga0316574_0018103
922 Ga0316574_0026700
923 Ga0316582_0056111
924 Ga0316584_0208025
925 Ga0316584_0297493
926 Ga0316584_0299698
927 Ga0400484_00293
928 Ga0400484_03662
929 Ga0400490_10089
930 Ga0400490_24476
931 Ga0400490_26859
932 Ga0400490_34423
933 Ga0400490_35683
934 Ga0400490_47969
935 Ga0400490_54276
936 Ga0400490_59274
937 Ga0400491_00707
938 Ga0400491_26268
939 Ga0400491_26892
940 Ga0400485_06984
941 Ga0400485_07339
942 Ga0400485_07748
943 Ga0400485_14019
944 Ga0400488_18567
945 Ga0400488_28819
946 Ga0400488_54045
947 Ga0400486_00296
948 Ga0400486_00966
949 Ga0400486_01623
950 Ga0400486_14087
951 Ga0400486_14586
952 Ga0400486_19415
953 Ga0400486_24596
954 Ga0400486_29974
955 Ga0400483_038188
956 Ga0400483_041847
957 Ga0400483_084528
958 Ga0400483_129672
959 Ga0400483_155485
960 Ga0400483_163918
961 Ga0400483_216040
962 Ga0400483_264393
963 Ga0400483_269519
964 Ga0400489_08878
965 Ga0400489_26482
966 Ga0400489_44709
967 Ga0400489_58669
968 Ga0400487_04533
969 Ga0400487_21430
970 Ga0400487_55774
971 Ga0400487_56668
972 Ga0400487_59162
973 Ga0400487_62693
974 Ga0436365_0965775
975 Ga0439438_000002
976 Ga0439438_003537
977 Ga0439438_050800
978 Ga0439447_007471
979 Ga0439447_009309
980 Ga0439447_013379
981 Ga0439466_0000001
982 Ga0439432_001624
983 Ga0439432_015113
984 Ga0439432_021944
985 Ga0439449_0015235
986 Ga0439452_000001
987 Ga0439452_000002
988 Ga0439452_000020
989 Ga0439452_000032
990 Ga0439452_003837
991 Ga0439456_009256
992 Ga0439463_023682
993 Ga0450907_001577
994 Ga0439464_0034570
995 Ga0439464_0042653
996 Ga0451577_0000317
997 Ga0451577_0009693
998 Ga0451577_0021379
999 Ga0451577_0068246
1000 Ga0451577_0127246
1001 Ga0451577_0301769
1002 Ga0451577_0590913
1003 Ga0466981_0000003
1004 Ga0453683_0000680
1005 Ga0453683_0011835
1006 Ga0453683_0044388
1007 Ga0453683_0086658
1008 Ga0453683_0292043
1009 Ga0453684_0000388
1010 Ga0453684_0001032
1011 Ga0453684_0003638
1012 Ga0453684_0008931
1013 Ga0453684_0025627
1014 Ga0453684_0041335
1015 Ga0453684_0042349
1016 Ga0453684_0058860
1017 Ga0451576_0000702
1018 Ga0451576_0005301
1019 Ga0451576_0006347
1020 Ga0451576_0029343
1021 Ga0451576_0048347
1022 Ga0451576_0119048
1023 Ga0495617_089563
1024 Ga0495627_000019
1025 Ga0495591_000001
1026 Ga0495591_000175
1027 Ga0495591_002419
1028 Ga0495591_008462
1029 Ga0495650_0000018
1030 Ga0495650_0000047
1031 Ga0495650_0000790
1032 Ga0495650_0052819
1033 Ga0495596_0022738
1034 Ga0495606_0000930
1035 Ga0495620_0016371
1036 Ga0495643_0087172
1037 Ga0495643_0150402
1038 Ga0495644_0010739
1039 Ga0495648_0003595
1040 Ga0495648_0004272
1041 Ga0495654_0000009
1042 Ga0495654_0000862
1043 Ga0495654_0001153
1044 Ga0495654_0015084
1045 Ga0495654_0041707
1046 Ga0495654_0042147
1047 Ga0495597_0000616
1048 Ga0495668_0034455
1049 Ga0495625_0014488
1050 Ga0495588_0027702
1051 Ga0495649_0001918
1052 Ga0495649_0004280
1053 Ga0495649_0011360
1054 Ga0495649_0155477
1055 Ga0495589_0000003
1056 Ga0495589_0009125
1057 Ga0495660_0000004
1058 Ga0495660_0000015
1059 Ga0495672_0000001
1060 Ga0495672_0000009
1061 Ga0495672_0000038
1062 Ga0495679_000113
1063 Ga0495679_001613
1064 Ga0495679_014882
1065 Ga0495679_016770
1066 Ga0495679_071470
1067 Ga0495673_0000019
1068 Ga0495673_0000114
1069 Ga0496101_0000169
1070 Ga0496101_0118922
1071 Ga0496102_0001722
1072 Ga0496102_0091813
1073 Ga0496104_0000250
1074 Ga0496105_0028531
1075 Ga0496105_0031410
1076 Ga0496105_0156944
1077 Ga0496113_0179214
1078 Ga0496116_0000007
1079 Ga0496116_0000083
1080 Ga0496116_0000110
1081 Ga0496116_0000132
1082 Ga0496116_0002143
1083 Ga0496116_0005273
1084 Ga0496116_0011127
1085 Ga0496116_0105760
1086 Ga0496117_0000009
1087 Ga0496117_0000802
1088 Ga0496117_0000973
1089 Ga0496117_0001854
1090 Ga0496117_0002689
1091 Ga0496117_0003025
1092 Ga0496117_0033080
1093 Ga0496117_0049115
1094 Ga0496117_0057332
1095 Ga0496117_0060566
1096 Ga0496117_0067379
1097 Ga0496117_0096478
1098 Ga0496117_0106073
1099 Ga0496118_0000017
1100 Ga0496118_0000915
1101 Ga0496118_0003011
1102 Ga0496118_0006238
1103 Ga0496118_0015377
1104 Ga0496118_0021309
1105 Ga0496118_0046477
1106 Ga0496118_0071011
1107 Ga0496118_0072882
1108 Ga0496118_0075528
1109 Ga0496118_0099184
1110 Ga0496118_0129657
1111 Ga0496118_0135517
1112 Ga0496119_0000012
1113 Ga0496119_0000049
1114 Ga0496119_0000167
1115 Ga0496119_0000807
1116 Ga0496119_0001500
1117 Ga0496119_0002544
1118 Ga0496119_0002788
1119 Ga0496119_0005582
1120 Ga0496119_0029374
1121 Ga0496119_0068326
1122 Ga0496120_0000004
1123 Ga0496120_0000048
1124 Ga0496120_0000057
1125 Ga0496120_0000198
1126 Ga0496120_0000411
1127 Ga0496120_0000441
1128 Ga0496120_0001573
1129 Ga0496120_0001646
1130 Ga0496120_0001701
1131 Ga0496120_0009200
1132 Ga0496120_0010498
1133 Ga0496120_0044886
1134 Ga0496120_0084039
1135 Ga0496121_0003345
1136 Ga0496121_0005220
1137 Ga0496121_0006982
1138 Ga0496121_0010384
1139 Ga0496121_0039242
1140 Ga0496121_0080604
1141 Ga0496122_0000003
1142 Ga0496122_0000088
1143 Ga0496122_0000135
1144 Ga0496122_0001653
1145 Ga0496122_0011973
1146 Ga0496122_0013723
1147 Ga0496122_0016774
1148 Ga0496122_0029115
1149 Ga0496122_0033200
1150 Ga0496122_0033476
1151 Ga0496122_0035339
1152 Ga0496122_0091025
1153 Ga0496123_0000004
1154 Ga0496123_0000012
1155 Ga0496123_0000606
1156 Ga0496123_0001446
1157 Ga0496123_0002538
1158 Ga0496123_0005403
1159 Ga0496123_0011259
1160 Ga0496123_0011546
1161 Ga0496123_0017680
1162 Ga0496123_0049114
1163 Ga0496123_0059720
1164 Ga0496123_0080389
1165 Ga0496123_0135871
1166 Ga0496123_0198827
1167 Ga0496124_0000028
1168 Ga0496124_0000045
1169 Ga0496124_0000165
1170 Ga0496124_0000611
1171 Ga0496124_0000990
1172 Ga0496124_0001906
1173 Ga0496124_0002699
1174 Ga0496124_0004775
1175 Ga0496124_0012270
1176 Ga0496124_0018566
1177 Ga0496124_0056478
1178 Ga0496124_0086712
1179 Ga0496124_0222666
1180 Ga0496125_0000091
1181 Ga0496125_0000131
1182 Ga0496125_0002460
1183 Ga0496125_0009402
1184 Ga0496125_0033990
1185 Ga0496125_0052972
1186 Ga0496125_0075880
1187 Ga0496125_0078980
1188 Ga0496126_0002503
1189 Ga0496126_0004059
1190 Ga0496126_0015207
1191 Ga0496126_0038645
1192 Ga0496126_0056918
1193 Ga0496126_0081355
1194 Ga0496126_0112830
1195 Ga0496126_0266583
1196 Ga0495678_001229
1197 Ga0495682_0000001
1198 nmdc:mga03683_255_c1
1199 nmdc:mga03n38_179174_c1
1200 nmdc:mga00v17_23128_c1
1201 nmdc:mga00v17_36331_c1
1202 nmdc:mga00v17_42571_c1
1203 nmdc:mga00v17_840_c1
1204 Ga0500621_000002
1205 Ga0500638_000001
1206 2506579445
1207 2506584584
1208 2508853289
1209 2511379989
1210 2511435009
1211 2538424207
1212 2547698552
1213 2548648337
1214 2555259757
1215 2562463454
1216 2585829709
1217 2585835330
1218 2599411347
1219 2599926436
1220 2601524342
1221 2601529496
1222 2601534937
1223 2601539434
1224 2601616330
1225 2601621052
1226 2601644396
1227 2601649449
1228 2601654376
1229 2601659798
1230 2601664218
1231 2601697178
1232 2601702224
1233 2601707120
1234 2601711928
1235 2601717637
1236 2601722096
1237 2601727565
1238 2601732370
1239 2601737115
1240 2601741397
1241 2601752349
1242 2601757784
1243 2601764142
1244 2602019190
1245 2603636952
1246 2603644925
1247 2603662382
1248 2603667278
1249 2603699260
1250 2603705294
1251 2603839989
1252 2603845066
1253 2603849930
1254 2603855207
1255 2603868018
1256 2603872787
1257 2603878089
1258 2606049756
1259 2606071418
1260 2606147651
1261 2606177645
1262 2608669968
1263 2609909740
1264 2637224167
1265 2650897180
1266 2656275963
1267 2671101204
1268 2671107022
1269 2671584622
1270 2676405572
1271 2681996297
1272 2682006357
1273 2686354088
1274 2687579309
1275 2689446020
1276 2707100488
1277 2740991466
1278 2753856841
1279 2765589936
1280 2772439901
1281 2775541382
1282 2777020860
1283 2791922206
1284 2792312104
1285 2793404814
1286 2807180043
1287 2809125641
1288 2813727963
1289 2814695505
1290 2821120965
1291 2823375590
1292 2844428284
1293 2844529065
1294 2846543331
1295 2847086694
1296 2847799057
1297 2852103936
1298 2858467605
1299 2865018529
1300 2869555365
1301 2871274222
1302 2871285343
1303 2876603338
1304 2881612871
1305 2884088014
1306 2888370010
1307 2888377485
1308 2891671505
1309 2900052386
1310 2904475951
1311 2904506348
1312 2904515481
1313 2908672357
1314 2919110865
1315 2919152120
1316 2919493250
1317 2919543125
1318 2923528362
1319 2923635750
1320 2927144789
1321 2927837748
1322 2932408928
1323 2935625838
1324 2937542530
1325 2937968545
1326 2939569960
1327 2939575238
1328 2939582060
1329 2939604742
1330 2939608756
1331 2939618413
1332 2939643021
1333 2945876929
1334 2945952291
1335 2969081202
1336 2971822588
1337 2974311178
1338 2974439207
1339 2978978766
1340 2984497451
1341 2984563660
1342 2984596394
1343 2990261402
1344 3000378450
1345 640938770
1346 8004596075
1347 8015396582
1348 8016735131
1349 8018225724
1350 8019501386
1351 8019505249
1352 8054846556
1353 8054851892
1354 8055092086
1355 8055095422
1356 8055100118
1357 8055696725
1358 8057306857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

77

335

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq9-assembly1.cif.gz_A high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna 1.001 1 279
4k1g-assembly2.cif.gz_B structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair 1 1 279
1qum-assembly1.cif.gz_A crystal structure of escherichia coli endonuclease iv in complex with damaged dna 0.9995 1 279
2nqj-assembly1.cif.gz_A crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna 0.9994 1 279
2nq9-assembly1.cif.gz_A high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna 0.997 1 279
ID Description Score Start End Superfamily
1qumA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9995 1 279 3.20.20.150
1qumA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.996 1 279 3.20.20.150
af_Q8IE02_304_597_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9863 2 282 3.20.20.150
af_Q10002_117_395_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9837 1 278 3.20.20.150
af_Q966U0_262_539_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9791 4 282 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A377TWT9-F1-model_v4 Endonuclease IV (EC 3.1.21.2) 1.006 144 215 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A6L3XEW6-F1-model_v4 TIM barrel protein 1.004 1 124 GO:0003677
GO:0003906
GO:0004519
GO:0006284
GO:0008081
GO:0008270
AF-A0A2T4MM21-F1-model_v4 deleted 1.004 79 208
AF-A0A6D0MB81-F1-model_v4 deleted 1.003 23 158
AF-A0A376NSA2-F1-model_v4 Probable endonuclease 4 (EC 3.1.21.2) (Endodeoxyribonuclease IV) (Endonuclease IV) 1.002 1 227 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833

Map