F474699

General Info

Members Datasets Scaffolds Average Seq Length
679 220 1358 220

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100435695|Ga0070670_1004356951
Length 221
Sequence VKNSEPIAHDFAWARERMVQEQIIARGITDPRVIAAVRKIPRHVFVDPGIVNRAYDDSALPIGVKQTLSQPYMSARMSEALRLVGAEKVLEIGTGSGFQTAILAELCFNVFSVEKIRALSRRARVLLDQLEYHNIALHVGDGTIGWSEHAPYHAIIVTAGAPQAPQPLLDQLAVGGRLVIPIGDEQGQLLMRLTRTRTGFKKEQLGECKFVKLIGKYGWRE

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.44
Rhizosphere 99.26
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100435695 3300005331 Bacteria 1160
2 JGI25406J46586_10028255 3300003203 Bacteria 2139
3 JGI26129J50193_1000953 3300003349 Bacteria 1902
4 JGI26143J51219_1001120 3300003502 Bacteria 1068
5 Ga0065715_10100783 3300005293 Bacteria 3269
6 Ga0070676_10001703 3300005328 Bacteria 11185
7 Ga0070676_10430628 3300005328 Bacteria 924
8 Ga0070683_100284938 3300005329 Bacteria 1572
9 Ga0070690_100010370 3300005330 Bacteria 5422
10 Ga0070690_100285850 3300005330 Bacteria 1178
11 Ga0070690_100356656 3300005330 Bacteria 1063
12 Ga0070670_100004617 3300005331 Bacteria 11554
13 Ga0068869_100002408 3300005334 Bacteria 11275
14 Ga0068869_100032355 3300005334 Bacteria 3684
15 Ga0070680_100000605 3300005336 Bacteria 24802
16 Ga0070680_100274238 3300005336 Bacteria 1428
17 Ga0070682_100031313 3300005337 Bacteria 3216
18 Ga0068868_100016822 3300005338 Bacteria 5439
19 Ga0070660_100003165 3300005339 Bacteria 11306
20 Ga0070689_100084984 3300005340 Bacteria 2488
21 Ga0070689_100178060 3300005340 Bacteria 1726
22 Ga0070689_100217130 3300005340 Bacteria 1567
23 Ga0070691_10005964 3300005341 Bacteria 5559
24 Ga0070691_10008658 3300005341 Bacteria 4658
25 Ga0070691_10016957 3300005341 Bacteria 3350
26 Ga0070661_100003184 3300005344 Bacteria 11309
27 Ga0070692_10001111 3300005345 Bacteria 9400
28 Ga0070668_100577877 3300005347 Bacteria 981
29 Ga0070669_100047076 3300005353 Bacteria 3145
30 Ga0070669_100309567 3300005353 Bacteria 1273
31 Ga0070671_100033971 3300005355 Bacteria 4221
32 Ga0070688_100342218 3300005365 Bacteria 1092
33 Ga0070659_100003365 3300005366 Bacteria 11380
34 Ga0070667_100352468 3300005367 Bacteria 1333
35 Ga0070703_10010399 3300005406 Bacteria 2622
36 Ga0070713_100607016 3300005436 Bacteria 1040
37 Ga0070701_10171294 3300005438 Unclassified 1264
38 Ga0070701_10212814 3300005438 Bacteria 1149
39 Ga0070705_100003827 3300005440 Bacteria 7360
40 Ga0070705_100030153 3300005440 Bacteria 2991
41 Ga0070705_100070850 3300005440 Bacteria 2106
42 Ga0070705_100280146 3300005440 Bacteria 1185
43 Ga0070705_100401972 3300005440 Bacteria 1015
44 Ga0070694_100000408 3300005444 Bacteria 23354
45 Ga0070694_100002645 3300005444 Bacteria 10600
46 Ga0070694_100012536 3300005444 Bacteria 5273
47 Ga0070694_100031271 3300005444 Bacteria 3490
48 Ga0070694_100039624 3300005444 Bacteria 3137
49 Ga0070694_100067273 3300005444 Bacteria 2459
50 Ga0070694_100137825 3300005444 Bacteria 1769
51 Ga0070694_100198064 3300005444 Bacteria 1496
52 Ga0070708_100056376 3300005445 Bacteria 3495
53 Ga0070708_100191122 3300005445 Bacteria 1915
54 Ga0070708_100231904 3300005445 Bacteria 1732
55 Ga0070708_100278055 3300005445 Bacteria 1575
56 Ga0070708_100342657 3300005445 Bacteria 1408
57 Ga0070708_100598535 3300005445 Bacteria 1039
58 Ga0070708_100609319 3300005445 Unclassified 1029
59 Ga0070708_100801341 3300005445 Bacteria 885
60 Ga0070663_100005122 3300005455 Bacteria 7759
61 Ga0068867_100002975 3300005459 Bacteria 11942
62 Ga0068867_100192640 3300005459 Bacteria 1627
63 Ga0070685_10360927 3300005466 Bacteria 996
64 Ga0070706_100026504 3300005467 Bacteria 5332
65 Ga0070706_100031758 3300005467 Bacteria 4869
66 Ga0070706_100044505 3300005467 Bacteria 4101
67 Ga0070706_100045595 3300005467 Bacteria 4049
68 Ga0070706_100567341 3300005467 Bacteria 1055
69 Ga0070707_100035340 3300005468 Bacteria 4766
70 Ga0070707_100035947 3300005468 Bacteria 4727
71 Ga0070707_100099814 3300005468 Bacteria 2812
72 Ga0070707_100126123 3300005468 Bacteria 2487
73 Ga0070707_100163892 3300005468 Bacteria 2166
74 Ga0070707_100214552 3300005468 Bacteria 1875
75 Ga0070707_100266049 3300005468 Bacteria 1667
76 Ga0070707_100294249 3300005468 Bacteria 1577
77 Ga0070707_100724691 3300005468 Bacteria 957
78 Ga0070698_100055642 3300005471 Bacteria 4010
79 Ga0070698_100078858 3300005471 Bacteria 3291
80 Ga0070698_100114371 3300005471 Bacteria 2663
81 Ga0070698_100189881 3300005471 Bacteria 1992
82 Ga0070698_100211213 3300005471 Bacteria 1875
83 Ga0070698_100797324 3300005471 Bacteria 888
84 Ga0070699_100049922 3300005518 Bacteria 3621
85 Ga0070699_100061766 3300005518 Bacteria 3246
86 Ga0070699_100160053 3300005518 Bacteria 1992
87 Ga0070699_100161255 3300005518 Bacteria 1984
88 Ga0070699_100319246 3300005518 Bacteria 1396
89 Ga0070699_100420557 3300005518 Bacteria 1209
90 Ga0070679_100093327 3300005530 Bacteria 2997
91 Ga0070684_100035716 3300005535 Bacteria 4256
92 Ga0070697_100025541 3300005536 Bacteria 4712
93 Ga0070697_100035156 3300005536 Bacteria 4041
94 Ga0070697_100051671 3300005536 Bacteria 3340
95 Ga0070697_100101983 3300005536 Bacteria 2384
96 Ga0070697_100130871 3300005536 Bacteria 2104
97 Ga0070697_100203696 3300005536 Bacteria 1682
98 Ga0068853_100002322 3300005539 Bacteria 14242
99 Ga0070672_100034878 3300005543 Bacteria 3821
100 Ga0070672_100059712 3300005543 Bacteria 3001
101 Ga0070695_100002393 3300005545 Bacteria 10777
102 Ga0070695_100006770 3300005545 Bacteria 6783
103 Ga0070695_100007171 3300005545 Bacteria 6610
104 Ga0070695_100110462 3300005545 Bacteria 1865
105 Ga0070695_100147058 3300005545 Bacteria 1640
106 Ga0070696_100014399 3300005546 Bacteria 5306
107 Ga0070696_100030268 3300005546 Bacteria 3706
108 Ga0070696_100047504 3300005546 Bacteria 2979
109 Ga0070693_100000576 3300005547 Bacteria 16256
110 Ga0070704_100005790 3300005549 Bacteria 7231
111 Ga0070704_100047265 3300005549 Bacteria 3007
112 Ga0070704_100073047 3300005549 Bacteria 2497
113 Ga0070704_100196969 3300005549 Bacteria 1623
114 Ga0068855_100010316 3300005563 Bacteria 11266
115 Ga0068857_100014015 3300005577 Bacteria 6976
116 Ga0068854_100005165 3300005578 Bacteria 8231
117 Ga0068856_100010125 3300005614 Bacteria 9163
118 Ga0070702_100042268 3300005615 Bacteria 2562
119 Ga0068859_100007217 3300005617 Bacteria 11278
120 Ga0068859_100187947 3300005617 Bacteria 2150
121 Ga0068859_100347137 3300005617 Bacteria 1579
122 Ga0068859_100757701 3300005617 Bacteria 1060
123 Ga0068864_100019689 3300005618 Bacteria 5643
124 Ga0068866_10096927 3300005718 Bacteria 1619
125 Ga0068851_10011847 3300005834 Bacteria 4099
126 Ga0068870_10015962 3300005840 Bacteria 3576
127 Ga0068858_100559377 3300005842 Bacteria 1107
128 Ga0068860_100005861 3300005843 Bacteria 12367
129 Ga0068860_100019521 3300005843 Bacteria 6571
130 Ga0068860_100160194 3300005843 Bacteria 2170
131 Ga0068862_100011757 3300005844 Bacteria 7223
132 Ga0068862_100031738 3300005844 Bacteria 4462
133 Ga0081455_10000060 3300005937 Bacteria 119012
134 Ga0081455_10311955 3300005937 Bacteria 1124
135 Ga0081539_10000845 3300005985 Bacteria 58627
136 Ga0070716_100000957 3300006173 Bacteria 12521
137 Ga0070712_100012616 3300006175 Bacteria 5376
138 Ga0075370_10210768 3300006353 Bacteria 1147
139 Ga0075428_100008507 3300006844 Bacteria 11382
140 Ga0075428_100020145 3300006844 Bacteria 7387
141 Ga0075428_100020785 3300006844 Bacteria 7268
142 Ga0075428_100066545 3300006844 Bacteria 3945
143 Ga0075428_100084223 3300006844 Bacteria 3469
144 Ga0075428_100116417 3300006844 Bacteria 2911
145 Ga0075428_100203707 3300006844 Bacteria 2139
146 Ga0075428_100255574 3300006844 Bacteria 1887
147 Ga0075428_100362534 3300006844 Bacteria 1554
148 Ga0075428_100601310 3300006844 Bacteria 1175
149 Ga0075428_100628868 3300006844 Bacteria 1145
150 Ga0075430_100001884 3300006846 Bacteria 17174
151 Ga0075430_100010971 3300006846 Bacteria 7674
152 Ga0075430_100052106 3300006846 Bacteria 3447
153 Ga0075430_100090928 3300006846 Bacteria 2553
154 Ga0075430_100166387 3300006846 Bacteria 1835
155 Ga0075431_100000459 3300006847 Bacteria 33563
156 Ga0075431_100005519 3300006847 Bacteria 12486
157 Ga0075431_100025028 3300006847 Bacteria 6119
158 Ga0075431_100028244 3300006847 Bacteria 5761
159 Ga0075431_100030777 3300006847 Bacteria 5528
160 Ga0075431_100103870 3300006847 Bacteria 2933
161 Ga0075431_100160286 3300006847 Bacteria 2313
162 Ga0075431_100200016 3300006847 Bacteria 2044
163 Ga0075433_10000277 3300006852 Bacteria 30315
164 Ga0075433_10003714 3300006852 Bacteria 11816
165 Ga0075433_10018169 3300006852 Bacteria 5840
166 Ga0075433_10025430 3300006852 Bacteria 5005
167 Ga0075433_10051658 3300006852 Bacteria 3580
168 Ga0075433_10089868 3300006852 Bacteria 2715
169 Ga0075433_10096019 3300006852 Bacteria 2623
170 Ga0075433_10149925 3300006852 Bacteria 2074
171 Ga0075433_10288921 3300006852 Bacteria 1452
172 Ga0075433_10374838 3300006852 Bacteria 1257
173 Ga0075434_100001069 3300006871 Bacteria 22396
174 Ga0075434_100008851 3300006871 Bacteria 9369
175 Ga0075434_100009461 3300006871 Bacteria 9085
176 Ga0075434_100013086 3300006871 Bacteria 7879
177 Ga0075434_100016445 3300006871 Bacteria 7111
178 Ga0075434_100023619 3300006871 Bacteria 5996
179 Ga0075434_100029196 3300006871 Bacteria 5423
180 Ga0075434_100084479 3300006871 Bacteria 3173
181 Ga0075434_100193939 3300006871 Bacteria 2052
182 Ga0075434_100364665 3300006871 Bacteria 1466
183 Ga0075434_100722230 3300006871 Bacteria 1013
184 Ga0075429_100006335 3300006880 Bacteria 10241
185 Ga0075429_100019001 3300006880 Bacteria 5953
186 Ga0075429_100024202 3300006880 Bacteria 5267
187 Ga0075429_100034117 3300006880 Bacteria 4422
188 Ga0075429_100041299 3300006880 Bacteria 4017
189 Ga0075429_100048036 3300006880 Bacteria 3712
190 Ga0075429_100067508 3300006880 Bacteria 3112
191 Ga0075429_100155201 3300006880 Bacteria 2004
192 Ga0075429_100281408 3300006880 Bacteria 1457
193 Ga0075436_100012519 3300006914 Bacteria 5813
194 Ga0075436_100019833 3300006914 Bacteria 4610
195 Ga0075436_100199864 3300006914 Bacteria 1415
196 Ga0075436_100232679 3300006914 Unclassified 1309
197 Ga0075436_100270887 3300006914 Bacteria 1212
198 Ga0097620_100007217 3300006931 Bacteria 11278
199 Ga0097620_100187961 3300006931 Bacteria 2150
200 Ga0097620_100347151 3300006931 Bacteria 1579
201 Ga0097620_100757684 3300006931 Bacteria 1060
202 Ga0075435_100002262 3300007076 Bacteria 12717
203 Ga0075435_100002721 3300007076 Bacteria 11801
204 Ga0075435_100057155 3300007076 Bacteria 3155
205 Ga0075435_100073044 3300007076 Bacteria 2803
206 Ga0075435_100130912 3300007076 Bacteria 2099
207 Ga0075435_100291096 3300007076 Bacteria 1395
208 Ga0075435_100385222 3300007076 Bacteria 1204
209 Ga0099794_10009269 3300007265 Bacteria 4129
210 Ga0099794_10103323 3300007265 Bacteria 1423
211 Ga0111539_10018401 3300009094 Bacteria 8654
212 Ga0111539_10046491 3300009094 Bacteria 5191
213 Ga0111539_10182680 3300009094 Bacteria 2449
214 Ga0114129_10001451 3300009147 Bacteria 31997
215 Ga0114129_10002483 3300009147 Bacteria 25613
216 Ga0114129_10006028 3300009147 Bacteria 17182
217 Ga0114129_10007662 3300009147 Bacteria 15364
218 Ga0114129_10009765 3300009147 Bacteria 13684
219 Ga0114129_10010972 3300009147 Bacteria 12907
220 Ga0114129_10011804 3300009147 Bacteria 12427
221 Ga0114129_10016303 3300009147 Bacteria 10576
222 Ga0114129_10025448 3300009147 Bacteria 8387
223 Ga0114129_10045678 3300009147 Bacteria 6156
224 Ga0114129_10071163 3300009147 Bacteria 4849
225 Ga0114129_10075264 3300009147 Bacteria 4701
226 Ga0114129_10485726 3300009147 Bacteria 1615
227 Ga0114129_10572427 3300009147 Bacteria 1466
228 Ga0114129_10599451 3300009147 Bacteria 1427
229 Ga0114129_10745992 3300009147 Bacteria 1254
230 Ga0114129_10888273 3300009147 Bacteria 1130
231 Ga0105243_10807571 3300009148 Bacteria 925
232 Ga0105241_10004062 3300009174 Bacteria 10824
233 Ga0105242_10148514 3300009176 Bacteria 2042
234 Ga0105249_10125354 3300009553 Bacteria 2445
235 Ga0105249_10491967 3300009553 Bacteria 1270
236 Ga0105249_10503987 3300009553 Bacteria 1256
237 Ga0105246_10576951 3300011119 Bacteria 968
238 Ga0157373_10002027 3300013100 Bacteria 15337
239 Ga0157370_10377937 3300013104 Bacteria 1305
240 Ga0157369_10022132 3300013105 Bacteria 7101
241 Ga0157378_10110393 3300013297 Bacteria 2521
242 Ga0157378_10299620 3300013297 Bacteria 1556
243 Ga0163162_10084115 3300013306 Bacteria 3257
244 Ga0163162_10270079 3300013306 Bacteria 1832
245 Ga0157372_10011984 3300013307 Bacteria 9234
246 Ga0157375_10079684 3300013308 Bacteria 3311
247 Ga0157375_10771375 3300013308 Bacteria 1112
248 Ga0157380_10071079 3300014326 Bacteria 2814
249 Ga0157380_10754160 3300014326 Unclassified 985
250 Ga0157380_10771800 3300014326 Bacteria 975
251 Ga0207653_10001961 3300025885 Bacteria 6583
252 Ga0207699_10164807 3300025906 Bacteria 1478
253 Ga0207645_10006207 3300025907 Bacteria 8586
254 Ga0207643_10000342 3300025908 Bacteria 31606
255 Ga0207684_10003270 3300025910 Bacteria 15906
256 Ga0207684_10025724 3300025910 Bacteria 5014
257 Ga0207684_10027997 3300025910 Bacteria 4801
258 Ga0207684_10035509 3300025910 Bacteria 4233
259 Ga0207684_10131616 3300025910 Bacteria 2147
260 Ga0207684_10252190 3300025910 Bacteria 1523
261 Ga0207654_10002380 3300025911 Bacteria 9629
262 Ga0207654_10082028 3300025911 Bacteria 1943
263 Ga0207707_10000861 3300025912 Bacteria 29639
264 Ga0207693_10102369 3300025915 Bacteria 2246
265 Ga0207663_10028025 3300025916 Bacteria 3291
266 Ga0207660_10002323 3300025917 Bacteria 12525
267 Ga0207660_10007618 3300025917 Bacteria 7008
268 Ga0207662_10035749 3300025918 Bacteria 2902
269 Ga0207657_10007379 3300025919 Bacteria 11278
270 Ga0207649_10002891 3300025920 Bacteria 9451
271 Ga0207652_10001845 3300025921 Bacteria 18378
272 Ga0207646_10000336 3300025922 Bacteria 63561
273 Ga0207646_10005250 3300025922 Bacteria 13668
274 Ga0207646_10053078 3300025922 Bacteria 3626
275 Ga0207646_10064983 3300025922 Bacteria 3257
276 Ga0207646_10105734 3300025922 Bacteria 2524
277 Ga0207646_10217419 3300025922 Bacteria 1726
278 Ga0207646_10319098 3300025922 Bacteria 1404
279 Ga0207646_10366532 3300025922 Bacteria 1301
280 Ga0207646_10390481 3300025922 Bacteria 1257
281 Ga0207681_10052199 3300025923 Bacteria 2772
282 Ga0207681_10052890 3300025923 Bacteria 2755
283 Ga0207650_10038564 3300025925 Bacteria 3490
284 Ga0207690_10002528 3300025932 Bacteria 11055
285 Ga0207706_10055439 3300025933 Bacteria 3495
286 Ga0207706_10111670 3300025933 Bacteria 2405
287 Ga0207686_10264162 3300025934 Bacteria 1263
288 Ga0207709_10128997 3300025935 Bacteria 1720
289 Ga0207670_10014217 3300025936 Bacteria 4719
290 Ga0207670_10150821 3300025936 Bacteria 1725
291 Ga0207670_10196427 3300025936 Bacteria 1530
292 Ga0207665_10012637 3300025939 Bacteria 5549
293 Ga0207691_10050745 3300025940 Bacteria 3796
294 Ga0207691_10074434 3300025940 Bacteria 3063
295 Ga0207711_10562633 3300025941 Bacteria 1064
296 Ga0207689_10002654 3300025942 Bacteria 16540
297 Ga0207689_10076269 3300025942 Bacteria 2756
298 Ga0207689_10280848 3300025942 Bacteria 1379
299 Ga0207661_10116772 3300025944 Bacteria 2266
300 Ga0207679_10003743 3300025945 Bacteria 9431
301 Ga0207667_10017135 3300025949 Bacteria 8167
302 Ga0207712_10256088 3300025961 Bacteria 1417
303 Ga0207668_10225312 3300025972 Bacteria 1508
304 Ga0207677_10037677 3300026023 Bacteria 3162
305 Ga0207678_10005668 3300026067 Bacteria 11161
306 Ga0207708_10094012 3300026075 Bacteria 2314
307 Ga0207702_10003899 3300026078 Bacteria 13426
308 Ga0207648_10001490 3300026089 Bacteria 25781
309 Ga0207648_10589638 3300026089 Bacteria 1024
310 Ga0207648_10765507 3300026089 Bacteria 897
311 Ga0207676_10100104 3300026095 Bacteria 2400
312 Ga0207676_10807119 3300026095 Bacteria 916
313 Ga0207674_10001831 3300026116 Bacteria 27110
314 Ga0207675_100008397 3300026118 Bacteria 9736
315 Ga0209969_1022628 3300027360 Bacteria 941
316 Ga0209981_1017322 3300027378 Bacteria 1016
317 Ga0209996_1006600 3300027395 Bacteria 1502
318 Ga0209995_1007471 3300027471 Bacteria 1761
319 Ga0209999_1004552 3300027543 Bacteria 2487
320 Ga0209970_1000493 3300027614 Bacteria 6748
321 Ga0209983_1000836 3300027665 Bacteria 6743
322 Ga0209588_1014069 3300027671 Bacteria 2447
323 Ga0209971_1000361 3300027682 Bacteria 12412
324 Ga0209971_1010136 3300027682 Bacteria 2230
325 Ga0209966_1000409 3300027695 Bacteria 12586
326 Ga0209966_1034923 3300027695 Bacteria 1030
327 Ga0209998_10000117 3300027717 Bacteria 31452
328 Ga0209974_10006523 3300027876 Bacteria 4071
329 Ga0209974_10112602 3300027876 Bacteria 959
330 Ga0207428_10084234 3300027907 Bacteria 2478
331 Ga0268265_10199643 3300028380 Bacteria 1734
332 Ga0268265_10403288 3300028380 Bacteria 1264
333 Ga0268264_10001622 3300028381 Bacteria 20783
334 Ga0268264_10113666 3300028381 Bacteria 2375
335 Ga0268264_10483030 3300028381 Bacteria 1205
336 Ga0307408_100063271 3300031548 Bacteria 2706
337 Ga0307408_100139294 3300031548 Bacteria 1903
338 Ga0307408_100228121 3300031548 Bacteria 1523
339 Ga0307408_100282515 3300031548 Bacteria 1383
340 Ga0307405_10403906 3300031731 Bacteria 1070
341 Ga0307410_10856062 3300031852 Bacteria 776
342 Ga0307406_10323505 3300031901 Bacteria 1194
343 Ga0307406_10395099 3300031901 Bacteria 1094
344 Ga0307406_10803734 3300031901 Bacteria 794
345 Ga0307412_10042022 3300031911 Bacteria 2967
346 Ga0307409_100088922 3300031995 Bacteria 2523
347 Ga0307409_100551773 3300031995 Bacteria 1131
348 Ga0307416_100002271 3300032002 Bacteria 10951
349 Ga0307416_100034804 3300032002 Bacteria 3838
350 Ga0307416_100347599 3300032002 Bacteria 1499
351 Ga0373930_0024085 3300034816 Bacteria 1215
352 Ga0373948_0004792 3300034817 Bacteria 2159
353 Ga0373959_0012567 3300034820 Bacteria 1515
354 Ga0373928_0026184 3300035084 Bacteria 1262
355 Ga0373940_0013806 3300035088 Bacteria 1962
356 Ga0373940_0049675 3300035088 Bacteria 1175
357 Ga0373949_0017313 3300035090 Bacteria 1623
358 Ga0373949_0018207 3300035090 Bacteria 1591
359 Ga0373939_0201720 3300035114 Bacteria 753
360 Ga0373954_0086866 3300035118 Bacteria 1499
361 Ga0373960_0001823 3300035121 Bacteria 4768
362 Ga0373961_0003688 3300035241 Bacteria 3751
363 Ga0373935_0527591 3300035692 Bacteria 859
364 Ga0373937_0208837 3300036401 Bacteria 1837
365 Ga0395899_0010391 3300037312 Bacteria 7132
366 Ga0395898_0008660 3300037466 Bacteria 10734
367 Ga0395901_0002060 3300038443 Bacteria 20612
368 Ga0439441_027155 3300042001 Bacteria 1091
369 Ga0439448_0000432 3300042005 Bacteria 9609
370 Ga0439448_0081429 3300042005 Bacteria 1087
371 Ga0439455_0039934 3300042012 Bacteria 1198
372 Ga0439455_0044952 3300042012 Bacteria 1140
373 Ga0439459_0002106 3300042438 Bacteria 3040
374 Ga0439464_0005329 3300042439 Bacteria 3321
375 Ga0439460_0015603 3300042461 Bacteria 2013
376 Ga0451577_0013284 3300042876 Bacteria 7715
377 Ga0451577_0037091 3300042876 Bacteria 4389
378 Ga0451577_0077949 3300042876 Bacteria 2955
379 Ga0451577_0121848 3300042876 Bacteria 2336
380 Ga0453683_0024111 3300044673 Bacteria 3874
381 Ga0453684_0469576 3300044712 Bacteria 1397
382 Ga0451576_0034900 3300045051 Bacteria 5339
383 Ga0451576_0043735 3300045051 Bacteria 4724
384 Ga0451576_0224713 3300045051 Bacteria 1960
385 Ga0451576_0484861 3300045051 Bacteria 1299
386 Ga0495580_0002310 3300046472 Bacteria 16626
387 Ga0495580_0024351 3300046472 Bacteria 4434
388 Ga0495580_0395327 3300046472 Bacteria 933
389 Ga0495580_0402773 3300046472 Bacteria 922
390 Ga0495636_0067335 3300047318 Bacteria 1524
391 Ga0496102_0833831 3300048905 Bacteria 844
392 Ga0496106_0384882 3300048909 Bacteria 1127
393 Ga0496112_0028568 3300048915 Bacteria 5385
394 Ga0501031_0072335 3300049568 Bacteria 2245
395 Ga0501031_0410379 3300049568 Unclassified 876
396 Ga0501033_0089563 3300049570 Bacteria 2251
397 Ga0501033_0103715 3300049570 Bacteria 2074
398 Ga0501036_0005207 3300049572 Bacteria 10513
399 Ga0501036_0047237 3300049572 Bacteria 3646
400 Ga0501036_0288489 3300049572 Bacteria 1373
401 Ga0501036_0345798 3300049572 Bacteria 1242
402 Ga0501037_0054237 3300049573 Bacteria 2932
403 Ga0501037_0193218 3300049573 Bacteria 1441
404 Ga0501037_0285392 3300049573 Bacteria 1149
405 Ga0501037_0413387 3300049573 Bacteria 924
406 Ga0501038_0021008 3300049574 Bacteria 5866
407 Ga0501038_0033188 3300049574 Bacteria 4547
408 Ga0501038_0192566 3300049574 Bacteria 1640
409 Ga0501038_0195720 3300049574 Bacteria 1625
410 Ga0501038_0198771 3300049574 Bacteria 1610
411 Ga0501038_0380956 3300049574 Bacteria 1094
412 Ga0501038_0513787 3300049574 Unclassified 915
413 Ga0501038_0548874 3300049574 Bacteria 879
414 Ga0501039_0002996 3300049575 Bacteria 12630
415 Ga0501039_0060962 3300049575 Bacteria 2921
416 Ga0501039_0178450 3300049575 Bacteria 1670
417 Ga0501039_0404524 3300049575 Bacteria 1072
418 Ga0501040_0001650 3300049576 Bacteria 14251
419 Ga0501040_0002591 3300049576 Bacteria 11661
420 Ga0501040_0014139 3300049576 Bacteria 5254
421 Ga0501040_0051361 3300049576 Bacteria 2820
422 Ga0501040_0051853 3300049576 Bacteria 2807
423 Ga0501040_0127725 3300049576 Bacteria 1786
424 Ga0501040_0133559 3300049576 Bacteria 1746
425 Ga0501040_0138602 3300049576 Bacteria 1713
426 Ga0501040_0218861 3300049576 Bacteria 1355
427 Ga0501040_0318362 3300049576 Bacteria 1112
428 Ga0501041_0002540 3300049577 Bacteria 10398
429 Ga0501041_0007183 3300049577 Bacteria 6535
430 Ga0501041_0294863 3300049577 Bacteria 1021
431 Ga0501041_0466221 3300049577 Bacteria 802
432 Ga0501042_0041424 3300049578 Bacteria 3275
433 Ga0501042_0052058 3300049578 Bacteria 2920
434 Ga0501042_0053669 3300049578 Bacteria 2875
435 Ga0501042_0069797 3300049578 Bacteria 2513
436 Ga0501042_0104877 3300049578 Bacteria 2034
437 Ga0501042_0124761 3300049578 Bacteria 1854
438 Ga0501042_0174229 3300049578 Bacteria 1552
439 Ga0501042_0180052 3300049578 Bacteria 1525
440 Ga0501042_0186947 3300049578 Bacteria 1494
441 Ga0501042_0497628 3300049578 Bacteria 885
442 Ga0501043_0087204 3300049579 Bacteria 2453
443 Ga0501043_0256208 3300049579 Bacteria 1347
444 Ga0501043_0465502 3300049579 Bacteria 948
445 Ga0501046_0005540 3300049580 Bacteria 11279
446 Ga0501046_0008481 3300049580 Bacteria 8950
447 Ga0501046_0081799 3300049580 Bacteria 2494
448 Ga0501046_0156274 3300049580 Bacteria 1718
449 Ga0501046_0170643 3300049580 Bacteria 1633
450 Ga0501046_0248258 3300049580 Bacteria 1311
451 Ga0501046_0258756 3300049580 Bacteria 1279
452 Ga0501046_0566091 3300049580 Bacteria 809
453 Ga0501048_0010115 3300049582 Bacteria 7054
454 Ga0501048_0011456 3300049582 Bacteria 6616
455 Ga0501048_0045930 3300049582 Bacteria 3118
456 Ga0501048_0192058 3300049582 Bacteria 1447
457 Ga0501048_0274536 3300049582 Bacteria 1198
458 Ga0501048_0298319 3300049582 Bacteria 1146
459 Ga0501048_0423848 3300049582 Bacteria 952
460 Ga0501067_0016811 3300049583 Bacteria 4041
461 Ga0501067_0141042 3300049583 Bacteria 1342
462 Ga0501068_0018710 3300049584 Bacteria 4013
463 Ga0501068_0036596 3300049584 Bacteria 2936
464 Ga0501068_0216016 3300049584 Bacteria 1218
465 Ga0501068_0532984 3300049584 Bacteria 763
466 Ga0501071_0006060 3300049587 Bacteria 7833
467 Ga0501071_0025637 3300049587 Bacteria 4133
468 Ga0501071_0047055 3300049587 Unclassified 3099
469 Ga0501071_0051552 3300049587 Bacteria 2966
470 Ga0501071_0145502 3300049587 Bacteria 1766
471 Ga0501071_0331695 3300049587 Bacteria 1156
472 Ga0501072_0003873 3300049588 Bacteria 11315
473 Ga0501072_0021270 3300049588 Bacteria 5031
474 Ga0501072_0055372 3300049588 Bacteria 3126
475 Ga0501072_0057100 3300049588 Bacteria 3076
476 Ga0501072_0068660 3300049588 Bacteria 2797
477 Ga0501072_0075209 3300049588 Bacteria 2671
478 Ga0501072_0079821 3300049588 Bacteria 2591
479 Ga0501072_0107189 3300049588 Bacteria 2222
480 Ga0501072_0115354 3300049588 Bacteria 2139
481 Ga0501072_0121811 3300049588 Bacteria 2078
482 Ga0501072_0199973 3300049588 Bacteria 1593
483 Ga0501072_0604652 3300049588 Bacteria 864
484 Ga0501074_0012231 3300049590 Bacteria 6239
485 Ga0501074_0049368 3300049590 Bacteria 3038
486 Ga0501074_0086414 3300049590 Bacteria 2247
487 Ga0501074_0090278 3300049590 Bacteria 2194
488 Ga0501074_0251366 3300049590 Bacteria 1257
489 Ga0501074_0293039 3300049590 Unclassified 1156
490 Ga0501074_0402436 3300049590 Bacteria 971
491 Ga0501074_0403059 3300049590 Bacteria 970
492 Ga0501074_0792230 3300049590 Bacteria 668
493 Ga0501075_0001967 3300049591 Bacteria 13556
494 Ga0501075_0003546 3300049591 Bacteria 10445
495 Ga0501075_0019660 3300049591 Bacteria 4902
496 Ga0501075_0022380 3300049591 Bacteria 4616
497 Ga0501075_0032270 3300049591 Bacteria 3890
498 Ga0501075_0039132 3300049591 Bacteria 3548
499 Ga0501075_0063268 3300049591 Bacteria 2789
500 Ga0501075_0110157 3300049591 Bacteria 2093
501 Ga0501075_0168650 3300049591 Bacteria 1670
502 Ga0501075_0273565 3300049591 Bacteria 1287
503 Ga0501075_0433723 3300049591 Bacteria 1002
504 Ga0501076_0000492 3300049592 Bacteria 24925
505 Ga0501076_0015719 3300049592 Bacteria 5722
506 Ga0501076_0016200 3300049592 Bacteria 5646
507 Ga0501076_0029990 3300049592 Bacteria 4234
508 Ga0501076_0041986 3300049592 Bacteria 3601
509 Ga0501076_0054090 3300049592 Bacteria 3181
510 Ga0501076_0088353 3300049592 Bacteria 2491
511 Ga0501076_0108274 3300049592 Bacteria 2244
512 Ga0501076_0125841 3300049592 Bacteria 2076
513 Ga0501076_0163967 3300049592 Bacteria 1811
514 Ga0501076_0193636 3300049592 Bacteria 1659
515 Ga0501076_0204139 3300049592 Bacteria 1614
516 Ga0501076_0386768 3300049592 Bacteria 1150
517 Ga0501076_0400530 3300049592 Unclassified 1129
518 Ga0501076_0490397 3300049592 Bacteria 1013
519 Ga0501077_0005099 3300049593 Bacteria 7973
520 Ga0501077_0042449 3300049593 Bacteria 2892
521 Ga0501077_0074647 3300049593 Bacteria 2148
522 Ga0501077_0079292 3300049593 Bacteria 2080
523 Ga0501077_0335437 3300049593 Bacteria 964
524 Ga0501079_0005433 3300049741 Bacteria 9498
525 Ga0501079_0005782 3300049741 Bacteria 9245
526 Ga0501079_0024648 3300049741 Bacteria 4616
527 Ga0501079_0028074 3300049741 Bacteria 4317
528 Ga0501079_0044708 3300049741 Bacteria 3417
529 Ga0501079_0083028 3300049741 Bacteria 2478
530 Ga0501079_0163228 3300049741 Bacteria 1737
531 Ga0501079_0504026 3300049741 Bacteria 952
532 Ga0501080_0009892 3300049742 Bacteria 8712
533 Ga0501080_0036580 3300049742 Bacteria 4582
534 Ga0501080_0038515 3300049742 Bacteria 4463
535 Ga0501080_0063337 3300049742 Bacteria 3442
536 Ga0501080_0094349 3300049742 Bacteria 2779
537 Ga0501080_0114781 3300049742 Bacteria 2497
538 Ga0501080_0180409 3300049742 Bacteria 1943
539 Ga0501080_0266068 3300049742 Unclassified 1561
540 Ga0501081_0001487 3300049743 Bacteria 14379
541 Ga0501081_0002057 3300049743 Bacteria 12550
542 Ga0501081_0003720 3300049743 Bacteria 9775
543 Ga0501081_0046355 3300049743 Bacteria 2987
544 Ga0501081_0047538 3300049743 Bacteria 2952
545 Ga0501081_0066357 3300049743 Bacteria 2509
546 Ga0501081_0224048 3300049743 Bacteria 1368
547 Ga0501081_0302385 3300049743 Bacteria 1174
548 Ga0501081_0324597 3300049743 Bacteria 1132
549 Ga0501083_0009662 3300049744 Bacteria 6815
550 Ga0501083_0012315 3300049744 Bacteria 5986
551 Ga0501083_0026973 3300049744 Bacteria 3967
552 Ga0501083_0065512 3300049744 Bacteria 2420
553 Ga0501083_0278425 3300049744 Bacteria 1088
554 Ga0501035_0012435 3300049822 Bacteria 7867
555 Ga0501035_0516339 3300049822 Bacteria 982
556 Ga0501035_0522751 3300049822 Bacteria 975
557 Ga0501035_0704829 3300049822 Bacteria 814
558 Ga0501044_0409903 3300049823 Bacteria 1267
559 Ga0501044_0518493 3300049823 Bacteria 1092
560 Ga0501045_0001064 3300049824 Bacteria 18134
561 Ga0501045_0005203 3300049824 Bacteria 8997
562 Ga0501045_0069709 3300049824 Bacteria 2585
563 Ga0501045_0072301 3300049824 Bacteria 2539
564 Ga0501045_0132702 3300049824 Bacteria 1851
565 Ga0501045_0215526 3300049824 Bacteria 1430
566 Ga0501045_0236795 3300049824 Bacteria 1359
567 Ga0501045_0387327 3300049824 Bacteria 1040
568 Ga0501045_0640048 3300049824 Bacteria 786
569 nmdc:mga07m45_266205_c1 3300050496 Bacteria 997
570 nmdc:mga05p37_1000288_c1 3300050507 Bacteria 888
571 nmdc:mga05p37_10655_c1 3300050507 Bacteria 10909
572 nmdc:mga05p37_117365_c1 3300050507 Bacteria 3270
573 nmdc:mga05p37_117410_c1 3300050507 Bacteria 3270
574 nmdc:mga05p37_13405_c1 3300050507 Bacteria 9824
575 nmdc:mga05p37_14991_c1 3300050507 Bacteria 9304
576 nmdc:mga05p37_19326_c1 3300050507 Bacteria 8241
577 nmdc:mga05p37_249830_c1 3300050507 Bacteria 2128
578 nmdc:mga05p37_29501_c1 3300050507 Bacteria 6693
579 nmdc:mga05p37_316987_c1 3300050507 Bacteria 1847
580 nmdc:mga05p37_34667_c1 3300050507 Bacteria 6183
581 nmdc:mga05p37_391749_c1 3300050507 Bacteria 1625
582 nmdc:mga05p37_440729_c1 3300050507 Bacteria 1511
583 nmdc:mga05p37_44314_c1 3300050507 Bacteria 5473
584 nmdc:mga05p37_552_c1 3300050507 Bacteria 41127
585 nmdc:mga05p37_584794_c1 3300050507 Bacteria 1264
586 nmdc:mga05p37_598688_c1 3300050507 Bacteria 1245
587 nmdc:mga05p37_69602_c1 3300050507 Bacteria 4328
588 nmdc:mga05p37_793707_c1 3300050507 Bacteria 1037
589 nmdc:mga09592_18635_c1 3300050508 Bacteria 5693
590 nmdc:mga09592_20699_c1 3300050508 Bacteria 5414
591 nmdc:mga09592_37259_c1 3300050508 Bacteria 4079
592 nmdc:mga09592_451612_c1 3300050508 Bacteria 1109
593 nmdc:mga09592_483481_c1 3300050508 Bacteria 1067
594 nmdc:mga09592_6488_c1 3300050508 Bacteria 9530
595 nmdc:mga09592_6587_c1 3300050508 Bacteria 9458
596 nmdc:mga09592_97857_c1 3300050508 Bacteria 2511
597 nmdc:mga0qj67_15528_c1 3300050509 Bacteria 5766
598 nmdc:mga0qj67_198533_c1 3300050509 Bacteria 1630
599 nmdc:mga0qj67_211_c1 3300050509 Bacteria 39522
600 nmdc:mga0qj67_267013_c1 3300050509 Bacteria 1388
601 nmdc:mga0qj67_599244_c1 3300050509 Bacteria 881
602 nmdc:mga0qj67_650526_c1 3300050509 Unclassified 841
603 nmdc:mga0qj67_86876_c1 3300050509 Bacteria 2509
604 nmdc:mga06r32_125575_c1 3300050510 Bacteria 2534
605 nmdc:mga06r32_12846_c1 3300050510 Bacteria 7571
606 nmdc:mga06r32_2144_c1 3300050510 Bacteria 17639
607 nmdc:mga06r32_22471_c1 3300050510 Bacteria 5833
608 nmdc:mga06r32_389282_c1 3300050510 Bacteria 1377
609 nmdc:mga06r32_54487_c1 3300050510 Bacteria 3835
610 nmdc:mga06r32_66511_c1 3300050510 Bacteria 3478
611 nmdc:mga08y16_1024524_c1 3300050511 Bacteria 804
612 nmdc:mga08y16_27093_c1 3300050511 Bacteria 6040
613 nmdc:mga08y16_36826_c1 3300050511 Bacteria 5138
614 nmdc:mga0n895_29501_c1 3300050512 Bacteria 5234
615 nmdc:mga0n895_396632_c1 3300050512 Bacteria 1396
616 nmdc:mga0n895_424503_c1 3300050512 Bacteria 1344
617 nmdc:mga0n895_4347_c1 3300050512 Bacteria 11615
618 nmdc:mga0n895_696874_c1 3300050512 Bacteria 1012
619 nmdc:mga0n895_708995_c1 3300050512 Bacteria 1002
620 nmdc:mga0n895_727481_c1 3300050512 Bacteria 987
621 nmdc:mga0n895_8030_c1 3300050512 Bacteria 9103
622 nmdc:mga0n895_81979_c1 3300050512 Bacteria 3215
623 nmdc:mga0rr50_1427_c1 3300050513 Bacteria 13124
624 nmdc:mga0rr50_202008_c1 3300050513 Bacteria 1633
625 nmdc:mga0rr50_202227_c1 3300050513 Bacteria 1633
626 nmdc:mga0rr50_270140_c1 3300050513 Bacteria 1417
627 nmdc:mga0rr50_76446_c1 3300050513 Bacteria 2570
628 nmdc:mga0rr50_90545_c1 3300050513 Bacteria 2381
629 nmdc:mga0rr50_965927_c1 3300050513 Bacteria 726
630 nmdc:mga08x19_108378_c1 3300050514 Bacteria 1850
631 nmdc:mga08x19_13841_c1 3300050514 Bacteria 4887
632 nmdc:mga08x19_208228_c1 3300050514 Unclassified 1342
633 nmdc:mga08x19_296717_c1 3300050514 Bacteria 1122
634 nmdc:mga08x19_330599_c1 3300050514 Bacteria 1062
635 nmdc:mga08x19_615828_c1 3300050514 Bacteria 769
636 nmdc:mga0a205_108701_c1 3300050515 Bacteria 2671
637 nmdc:mga0a205_23762_c1 3300050515 Bacteria 5817
638 nmdc:mga0a205_27540_c1 3300050515 Bacteria 5427
639 nmdc:mga0a205_31143_c1 3300050515 Bacteria 5109
640 nmdc:mga0a205_31386_c1 3300050515 Bacteria 5090
641 nmdc:mga0a205_358233_c1 3300050515 Bacteria 1326
642 nmdc:mga0a205_42845_c1 3300050515 Bacteria 4362
643 nmdc:mga0a205_431_c1 3300050515 Bacteria 32283
644 nmdc:mga0a205_502845_c1 3300050515 Bacteria 1069
645 nmdc:mga0a205_766890_c1 3300050515 Bacteria 813
646 nmdc:mga0a205_93674_c1 3300050515 Unclassified 2902
647 Ga0501084_0006770 3300054114 Bacteria 9419
648 Ga0501084_0009649 3300054114 Bacteria 7985
649 Ga0501084_0011306 3300054114 Bacteria 7391
650 Ga0501084_0120143 3300054114 Bacteria 2209
651 Ga0501084_0149106 3300054114 Bacteria 1971
652 Ga0501084_0202427 3300054114 Bacteria 1675
653 Ga0501084_0380963 3300054114 Bacteria 1192
654 Ga0501084_0435418 3300054114 Bacteria 1108
655 Ga0501084_0768349 3300054114 Bacteria 812
656 Ga0501084_0810573 3300054114 Bacteria 788
657 Ga0501084_1013409 3300054114 Unclassified 698
658 Ga0590077_032088 3300059426 Unclassified 1150
659 Ga0501082_0002629 3300060353 Bacteria 15694
660 Ga0501082_0005080 3300060353 Bacteria 11465
661 Ga0501082_0044985 3300060353 Bacteria 3807
662 Ga0501082_0048602 3300060353 Bacteria 3656
663 Ga0501082_0104967 3300060353 Bacteria 2445
664 Ga0501082_0169056 3300060353 Bacteria 1900
665 Ga0501082_0191453 3300060353 Bacteria 1779
666 Ga0501082_0227993 3300060353 Bacteria 1621
667 Ga0501082_0237798 3300060353 Bacteria 1585
668 Ga0501082_0706938 3300060353 Bacteria 882
669 Ga0530510_0000073 3300061734 Bacteria 51407
670 Ga0530510_0001631 3300061734 Bacteria 15150
671 Ga0530510_0004121 3300061734 Bacteria 10036
672 Ga0530510_0009935 3300061734 Bacteria 6677
673 Ga0530510_0018578 3300061734 Bacteria 4929
674 Ga0530510_0056656 3300061734 Bacteria 2832
675 Ga0530510_0064612 3300061734 Bacteria 2650
676 Ga0530510_0140567 3300061734 Bacteria 1778
677 Ga0530510_0143959 3300061734 Bacteria 1757
678 Ga0530510_0284688 3300061734 Bacteria 1235
679 Ga0530510_0390117 3300061734 Bacteria 1049
680 Ga0070670_100435695
681 JGI25406J46586_10028255
682 JGI26129J50193_1000953
683 JGI26143J51219_1001120
684 Ga0065715_10100783
685 Ga0070676_10001703
686 Ga0070676_10430628
687 Ga0070683_100284938
688 Ga0070690_100010370
689 Ga0070690_100285850
690 Ga0070690_100356656
691 Ga0070670_100004617
692 Ga0068869_100002408
693 Ga0068869_100032355
694 Ga0070680_100000605
695 Ga0070680_100274238
696 Ga0070682_100031313
697 Ga0068868_100016822
698 Ga0070660_100003165
699 Ga0070689_100084984
700 Ga0070689_100178060
701 Ga0070689_100217130
702 Ga0070691_10005964
703 Ga0070691_10008658
704 Ga0070691_10016957
705 Ga0070661_100003184
706 Ga0070692_10001111
707 Ga0070668_100577877
708 Ga0070669_100047076
709 Ga0070669_100309567
710 Ga0070671_100033971
711 Ga0070688_100342218
712 Ga0070659_100003365
713 Ga0070667_100352468
714 Ga0070703_10010399
715 Ga0070713_100607016
716 Ga0070701_10171294
717 Ga0070701_10212814
718 Ga0070705_100003827
719 Ga0070705_100030153
720 Ga0070705_100070850
721 Ga0070705_100280146
722 Ga0070705_100401972
723 Ga0070694_100000408
724 Ga0070694_100002645
725 Ga0070694_100012536
726 Ga0070694_100031271
727 Ga0070694_100039624
728 Ga0070694_100067273
729 Ga0070694_100137825
730 Ga0070694_100198064
731 Ga0070708_100056376
732 Ga0070708_100191122
733 Ga0070708_100231904
734 Ga0070708_100278055
735 Ga0070708_100342657
736 Ga0070708_100598535
737 Ga0070708_100609319
738 Ga0070708_100801341
739 Ga0070663_100005122
740 Ga0068867_100002975
741 Ga0068867_100192640
742 Ga0070685_10360927
743 Ga0070706_100026504
744 Ga0070706_100031758
745 Ga0070706_100044505
746 Ga0070706_100045595
747 Ga0070706_100567341
748 Ga0070707_100035340
749 Ga0070707_100035947
750 Ga0070707_100099814
751 Ga0070707_100126123
752 Ga0070707_100163892
753 Ga0070707_100214552
754 Ga0070707_100266049
755 Ga0070707_100294249
756 Ga0070707_100724691
757 Ga0070698_100055642
758 Ga0070698_100078858
759 Ga0070698_100114371
760 Ga0070698_100189881
761 Ga0070698_100211213
762 Ga0070698_100797324
763 Ga0070699_100049922
764 Ga0070699_100061766
765 Ga0070699_100160053
766 Ga0070699_100161255
767 Ga0070699_100319246
768 Ga0070699_100420557
769 Ga0070679_100093327
770 Ga0070684_100035716
771 Ga0070697_100025541
772 Ga0070697_100035156
773 Ga0070697_100051671
774 Ga0070697_100101983
775 Ga0070697_100130871
776 Ga0070697_100203696
777 Ga0068853_100002322
778 Ga0070672_100034878
779 Ga0070672_100059712
780 Ga0070695_100002393
781 Ga0070695_100006770
782 Ga0070695_100007171
783 Ga0070695_100110462
784 Ga0070695_100147058
785 Ga0070696_100014399
786 Ga0070696_100030268
787 Ga0070696_100047504
788 Ga0070693_100000576
789 Ga0070704_100005790
790 Ga0070704_100047265
791 Ga0070704_100073047
792 Ga0070704_100196969
793 Ga0068855_100010316
794 Ga0068857_100014015
795 Ga0068854_100005165
796 Ga0068856_100010125
797 Ga0070702_100042268
798 Ga0068859_100007217
799 Ga0068859_100187947
800 Ga0068859_100347137
801 Ga0068859_100757701
802 Ga0068864_100019689
803 Ga0068866_10096927
804 Ga0068851_10011847
805 Ga0068870_10015962
806 Ga0068858_100559377
807 Ga0068860_100005861
808 Ga0068860_100019521
809 Ga0068860_100160194
810 Ga0068862_100011757
811 Ga0068862_100031738
812 Ga0081455_10000060
813 Ga0081455_10311955
814 Ga0081539_10000845
815 Ga0070716_100000957
816 Ga0070712_100012616
817 Ga0075370_10210768
818 Ga0075428_100008507
819 Ga0075428_100020145
820 Ga0075428_100020785
821 Ga0075428_100066545
822 Ga0075428_100084223
823 Ga0075428_100116417
824 Ga0075428_100203707
825 Ga0075428_100255574
826 Ga0075428_100362534
827 Ga0075428_100601310
828 Ga0075428_100628868
829 Ga0075430_100001884
830 Ga0075430_100010971
831 Ga0075430_100052106
832 Ga0075430_100090928
833 Ga0075430_100166387
834 Ga0075431_100000459
835 Ga0075431_100005519
836 Ga0075431_100025028
837 Ga0075431_100028244
838 Ga0075431_100030777
839 Ga0075431_100103870
840 Ga0075431_100160286
841 Ga0075431_100200016
842 Ga0075433_10000277
843 Ga0075433_10003714
844 Ga0075433_10018169
845 Ga0075433_10025430
846 Ga0075433_10051658
847 Ga0075433_10089868
848 Ga0075433_10096019
849 Ga0075433_10149925
850 Ga0075433_10288921
851 Ga0075433_10374838
852 Ga0075434_100001069
853 Ga0075434_100008851
854 Ga0075434_100009461
855 Ga0075434_100013086
856 Ga0075434_100016445
857 Ga0075434_100023619
858 Ga0075434_100029196
859 Ga0075434_100084479
860 Ga0075434_100193939
861 Ga0075434_100364665
862 Ga0075434_100722230
863 Ga0075429_100006335
864 Ga0075429_100019001
865 Ga0075429_100024202
866 Ga0075429_100034117
867 Ga0075429_100041299
868 Ga0075429_100048036
869 Ga0075429_100067508
870 Ga0075429_100155201
871 Ga0075429_100281408
872 Ga0075436_100012519
873 Ga0075436_100019833
874 Ga0075436_100199864
875 Ga0075436_100232679
876 Ga0075436_100270887
877 Ga0097620_100007217
878 Ga0097620_100187961
879 Ga0097620_100347151
880 Ga0097620_100757684
881 Ga0075435_100002262
882 Ga0075435_100002721
883 Ga0075435_100057155
884 Ga0075435_100073044
885 Ga0075435_100130912
886 Ga0075435_100291096
887 Ga0075435_100385222
888 Ga0099794_10009269
889 Ga0099794_10103323
890 Ga0111539_10018401
891 Ga0111539_10046491
892 Ga0111539_10182680
893 Ga0114129_10001451
894 Ga0114129_10002483
895 Ga0114129_10006028
896 Ga0114129_10007662
897 Ga0114129_10009765
898 Ga0114129_10010972
899 Ga0114129_10011804
900 Ga0114129_10016303
901 Ga0114129_10025448
902 Ga0114129_10045678
903 Ga0114129_10071163
904 Ga0114129_10075264
905 Ga0114129_10485726
906 Ga0114129_10572427
907 Ga0114129_10599451
908 Ga0114129_10745992
909 Ga0114129_10888273
910 Ga0105243_10807571
911 Ga0105241_10004062
912 Ga0105242_10148514
913 Ga0105249_10125354
914 Ga0105249_10491967
915 Ga0105249_10503987
916 Ga0105246_10576951
917 Ga0157373_10002027
918 Ga0157370_10377937
919 Ga0157369_10022132
920 Ga0157378_10110393
921 Ga0157378_10299620
922 Ga0163162_10084115
923 Ga0163162_10270079
924 Ga0157372_10011984
925 Ga0157375_10079684
926 Ga0157375_10771375
927 Ga0157380_10071079
928 Ga0157380_10754160
929 Ga0157380_10771800
930 Ga0207653_10001961
931 Ga0207699_10164807
932 Ga0207645_10006207
933 Ga0207643_10000342
934 Ga0207684_10003270
935 Ga0207684_10025724
936 Ga0207684_10027997
937 Ga0207684_10035509
938 Ga0207684_10131616
939 Ga0207684_10252190
940 Ga0207654_10002380
941 Ga0207654_10082028
942 Ga0207707_10000861
943 Ga0207693_10102369
944 Ga0207663_10028025
945 Ga0207660_10002323
946 Ga0207660_10007618
947 Ga0207662_10035749
948 Ga0207657_10007379
949 Ga0207649_10002891
950 Ga0207652_10001845
951 Ga0207646_10000336
952 Ga0207646_10005250
953 Ga0207646_10053078
954 Ga0207646_10064983
955 Ga0207646_10105734
956 Ga0207646_10217419
957 Ga0207646_10319098
958 Ga0207646_10366532
959 Ga0207646_10390481
960 Ga0207681_10052199
961 Ga0207681_10052890
962 Ga0207650_10038564
963 Ga0207690_10002528
964 Ga0207706_10055439
965 Ga0207706_10111670
966 Ga0207686_10264162
967 Ga0207709_10128997
968 Ga0207670_10014217
969 Ga0207670_10150821
970 Ga0207670_10196427
971 Ga0207665_10012637
972 Ga0207691_10050745
973 Ga0207691_10074434
974 Ga0207711_10562633
975 Ga0207689_10002654
976 Ga0207689_10076269
977 Ga0207689_10280848
978 Ga0207661_10116772
979 Ga0207679_10003743
980 Ga0207667_10017135
981 Ga0207712_10256088
982 Ga0207668_10225312
983 Ga0207677_10037677
984 Ga0207678_10005668
985 Ga0207708_10094012
986 Ga0207702_10003899
987 Ga0207648_10001490
988 Ga0207648_10589638
989 Ga0207648_10765507
990 Ga0207676_10100104
991 Ga0207676_10807119
992 Ga0207674_10001831
993 Ga0207675_100008397
994 Ga0209969_1022628
995 Ga0209981_1017322
996 Ga0209996_1006600
997 Ga0209995_1007471
998 Ga0209999_1004552
999 Ga0209970_1000493
1000 Ga0209983_1000836
1001 Ga0209588_1014069
1002 Ga0209971_1000361
1003 Ga0209971_1010136
1004 Ga0209966_1000409
1005 Ga0209966_1034923
1006 Ga0209998_10000117
1007 Ga0209974_10006523
1008 Ga0209974_10112602
1009 Ga0207428_10084234
1010 Ga0268265_10199643
1011 Ga0268265_10403288
1012 Ga0268264_10001622
1013 Ga0268264_10113666
1014 Ga0268264_10483030
1015 Ga0307408_100063271
1016 Ga0307408_100139294
1017 Ga0307408_100228121
1018 Ga0307408_100282515
1019 Ga0307405_10403906
1020 Ga0307410_10856062
1021 Ga0307406_10323505
1022 Ga0307406_10395099
1023 Ga0307406_10803734
1024 Ga0307412_10042022
1025 Ga0307409_100088922
1026 Ga0307409_100551773
1027 Ga0307416_100002271
1028 Ga0307416_100034804
1029 Ga0307416_100347599
1030 Ga0373930_0024085
1031 Ga0373948_0004792
1032 Ga0373959_0012567
1033 Ga0373928_0026184
1034 Ga0373940_0013806
1035 Ga0373940_0049675
1036 Ga0373949_0017313
1037 Ga0373949_0018207
1038 Ga0373939_0201720
1039 Ga0373954_0086866
1040 Ga0373960_0001823
1041 Ga0373961_0003688
1042 Ga0373935_0527591
1043 Ga0373937_0208837
1044 Ga0395899_0010391
1045 Ga0395898_0008660
1046 Ga0395901_0002060
1047 Ga0439441_027155
1048 Ga0439448_0000432
1049 Ga0439448_0081429
1050 Ga0439455_0039934
1051 Ga0439455_0044952
1052 Ga0439459_0002106
1053 Ga0439464_0005329
1054 Ga0439460_0015603
1055 Ga0451577_0013284
1056 Ga0451577_0037091
1057 Ga0451577_0077949
1058 Ga0451577_0121848
1059 Ga0453683_0024111
1060 Ga0453684_0469576
1061 Ga0451576_0034900
1062 Ga0451576_0043735
1063 Ga0451576_0224713
1064 Ga0451576_0484861
1065 Ga0495580_0002310
1066 Ga0495580_0024351
1067 Ga0495580_0395327
1068 Ga0495580_0402773
1069 Ga0495636_0067335
1070 Ga0496102_0833831
1071 Ga0496106_0384882
1072 Ga0496112_0028568
1073 Ga0501031_0072335
1074 Ga0501031_0410379
1075 Ga0501033_0089563
1076 Ga0501033_0103715
1077 Ga0501036_0005207
1078 Ga0501036_0047237
1079 Ga0501036_0288489
1080 Ga0501036_0345798
1081 Ga0501037_0054237
1082 Ga0501037_0193218
1083 Ga0501037_0285392
1084 Ga0501037_0413387
1085 Ga0501038_0021008
1086 Ga0501038_0033188
1087 Ga0501038_0192566
1088 Ga0501038_0195720
1089 Ga0501038_0198771
1090 Ga0501038_0380956
1091 Ga0501038_0513787
1092 Ga0501038_0548874
1093 Ga0501039_0002996
1094 Ga0501039_0060962
1095 Ga0501039_0178450
1096 Ga0501039_0404524
1097 Ga0501040_0001650
1098 Ga0501040_0002591
1099 Ga0501040_0014139
1100 Ga0501040_0051361
1101 Ga0501040_0051853
1102 Ga0501040_0127725
1103 Ga0501040_0133559
1104 Ga0501040_0138602
1105 Ga0501040_0218861
1106 Ga0501040_0318362
1107 Ga0501041_0002540
1108 Ga0501041_0007183
1109 Ga0501041_0294863
1110 Ga0501041_0466221
1111 Ga0501042_0041424
1112 Ga0501042_0052058
1113 Ga0501042_0053669
1114 Ga0501042_0069797
1115 Ga0501042_0104877
1116 Ga0501042_0124761
1117 Ga0501042_0174229
1118 Ga0501042_0180052
1119 Ga0501042_0186947
1120 Ga0501042_0497628
1121 Ga0501043_0087204
1122 Ga0501043_0256208
1123 Ga0501043_0465502
1124 Ga0501046_0005540
1125 Ga0501046_0008481
1126 Ga0501046_0081799
1127 Ga0501046_0156274
1128 Ga0501046_0170643
1129 Ga0501046_0248258
1130 Ga0501046_0258756
1131 Ga0501046_0566091
1132 Ga0501048_0010115
1133 Ga0501048_0011456
1134 Ga0501048_0045930
1135 Ga0501048_0192058
1136 Ga0501048_0274536
1137 Ga0501048_0298319
1138 Ga0501048_0423848
1139 Ga0501067_0016811
1140 Ga0501067_0141042
1141 Ga0501068_0018710
1142 Ga0501068_0036596
1143 Ga0501068_0216016
1144 Ga0501068_0532984
1145 Ga0501071_0006060
1146 Ga0501071_0025637
1147 Ga0501071_0047055
1148 Ga0501071_0051552
1149 Ga0501071_0145502
1150 Ga0501071_0331695
1151 Ga0501072_0003873
1152 Ga0501072_0021270
1153 Ga0501072_0055372
1154 Ga0501072_0057100
1155 Ga0501072_0068660
1156 Ga0501072_0075209
1157 Ga0501072_0079821
1158 Ga0501072_0107189
1159 Ga0501072_0115354
1160 Ga0501072_0121811
1161 Ga0501072_0199973
1162 Ga0501072_0604652
1163 Ga0501074_0012231
1164 Ga0501074_0049368
1165 Ga0501074_0086414
1166 Ga0501074_0090278
1167 Ga0501074_0251366
1168 Ga0501074_0293039
1169 Ga0501074_0402436
1170 Ga0501074_0403059
1171 Ga0501074_0792230
1172 Ga0501075_0001967
1173 Ga0501075_0003546
1174 Ga0501075_0019660
1175 Ga0501075_0022380
1176 Ga0501075_0032270
1177 Ga0501075_0039132
1178 Ga0501075_0063268
1179 Ga0501075_0110157
1180 Ga0501075_0168650
1181 Ga0501075_0273565
1182 Ga0501075_0433723
1183 Ga0501076_0000492
1184 Ga0501076_0015719
1185 Ga0501076_0016200
1186 Ga0501076_0029990
1187 Ga0501076_0041986
1188 Ga0501076_0054090
1189 Ga0501076_0088353
1190 Ga0501076_0108274
1191 Ga0501076_0125841
1192 Ga0501076_0163967
1193 Ga0501076_0193636
1194 Ga0501076_0204139
1195 Ga0501076_0386768
1196 Ga0501076_0400530
1197 Ga0501076_0490397
1198 Ga0501077_0005099
1199 Ga0501077_0042449
1200 Ga0501077_0074647
1201 Ga0501077_0079292
1202 Ga0501077_0335437
1203 Ga0501079_0005433
1204 Ga0501079_0005782
1205 Ga0501079_0024648
1206 Ga0501079_0028074
1207 Ga0501079_0044708
1208 Ga0501079_0083028
1209 Ga0501079_0163228
1210 Ga0501079_0504026
1211 Ga0501080_0009892
1212 Ga0501080_0036580
1213 Ga0501080_0038515
1214 Ga0501080_0063337
1215 Ga0501080_0094349
1216 Ga0501080_0114781
1217 Ga0501080_0180409
1218 Ga0501080_0266068
1219 Ga0501081_0001487
1220 Ga0501081_0002057
1221 Ga0501081_0003720
1222 Ga0501081_0046355
1223 Ga0501081_0047538
1224 Ga0501081_0066357
1225 Ga0501081_0224048
1226 Ga0501081_0302385
1227 Ga0501081_0324597
1228 Ga0501083_0009662
1229 Ga0501083_0012315
1230 Ga0501083_0026973
1231 Ga0501083_0065512
1232 Ga0501083_0278425
1233 Ga0501035_0012435
1234 Ga0501035_0516339
1235 Ga0501035_0522751
1236 Ga0501035_0704829
1237 Ga0501044_0409903
1238 Ga0501044_0518493
1239 Ga0501045_0001064
1240 Ga0501045_0005203
1241 Ga0501045_0069709
1242 Ga0501045_0072301
1243 Ga0501045_0132702
1244 Ga0501045_0215526
1245 Ga0501045_0236795
1246 Ga0501045_0387327
1247 Ga0501045_0640048
1248 nmdc:mga07m45_266205_c1
1249 nmdc:mga05p37_1000288_c1
1250 nmdc:mga05p37_10655_c1
1251 nmdc:mga05p37_117365_c1
1252 nmdc:mga05p37_117410_c1
1253 nmdc:mga05p37_13405_c1
1254 nmdc:mga05p37_14991_c1
1255 nmdc:mga05p37_19326_c1
1256 nmdc:mga05p37_249830_c1
1257 nmdc:mga05p37_29501_c1
1258 nmdc:mga05p37_316987_c1
1259 nmdc:mga05p37_34667_c1
1260 nmdc:mga05p37_391749_c1
1261 nmdc:mga05p37_440729_c1
1262 nmdc:mga05p37_44314_c1
1263 nmdc:mga05p37_552_c1
1264 nmdc:mga05p37_584794_c1
1265 nmdc:mga05p37_598688_c1
1266 nmdc:mga05p37_69602_c1
1267 nmdc:mga05p37_793707_c1
1268 nmdc:mga09592_18635_c1
1269 nmdc:mga09592_20699_c1
1270 nmdc:mga09592_37259_c1
1271 nmdc:mga09592_451612_c1
1272 nmdc:mga09592_483481_c1
1273 nmdc:mga09592_6488_c1
1274 nmdc:mga09592_6587_c1
1275 nmdc:mga09592_97857_c1
1276 nmdc:mga0qj67_15528_c1
1277 nmdc:mga0qj67_198533_c1
1278 nmdc:mga0qj67_211_c1
1279 nmdc:mga0qj67_267013_c1
1280 nmdc:mga0qj67_599244_c1
1281 nmdc:mga0qj67_650526_c1
1282 nmdc:mga0qj67_86876_c1
1283 nmdc:mga06r32_125575_c1
1284 nmdc:mga06r32_12846_c1
1285 nmdc:mga06r32_2144_c1
1286 nmdc:mga06r32_22471_c1
1287 nmdc:mga06r32_389282_c1
1288 nmdc:mga06r32_54487_c1
1289 nmdc:mga06r32_66511_c1
1290 nmdc:mga08y16_1024524_c1
1291 nmdc:mga08y16_27093_c1
1292 nmdc:mga08y16_36826_c1
1293 nmdc:mga0n895_29501_c1
1294 nmdc:mga0n895_396632_c1
1295 nmdc:mga0n895_424503_c1
1296 nmdc:mga0n895_4347_c1
1297 nmdc:mga0n895_696874_c1
1298 nmdc:mga0n895_708995_c1
1299 nmdc:mga0n895_727481_c1
1300 nmdc:mga0n895_8030_c1
1301 nmdc:mga0n895_81979_c1
1302 nmdc:mga0rr50_1427_c1
1303 nmdc:mga0rr50_202008_c1
1304 nmdc:mga0rr50_202227_c1
1305 nmdc:mga0rr50_270140_c1
1306 nmdc:mga0rr50_76446_c1
1307 nmdc:mga0rr50_90545_c1
1308 nmdc:mga0rr50_965927_c1
1309 nmdc:mga08x19_108378_c1
1310 nmdc:mga08x19_13841_c1
1311 nmdc:mga08x19_208228_c1
1312 nmdc:mga08x19_296717_c1
1313 nmdc:mga08x19_330599_c1
1314 nmdc:mga08x19_615828_c1
1315 nmdc:mga0a205_108701_c1
1316 nmdc:mga0a205_23762_c1
1317 nmdc:mga0a205_27540_c1
1318 nmdc:mga0a205_31143_c1
1319 nmdc:mga0a205_31386_c1
1320 nmdc:mga0a205_358233_c1
1321 nmdc:mga0a205_42845_c1
1322 nmdc:mga0a205_431_c1
1323 nmdc:mga0a205_502845_c1
1324 nmdc:mga0a205_766890_c1
1325 nmdc:mga0a205_93674_c1
1326 Ga0501084_0006770
1327 Ga0501084_0009649
1328 Ga0501084_0011306
1329 Ga0501084_0120143
1330 Ga0501084_0149106
1331 Ga0501084_0202427
1332 Ga0501084_0380963
1333 Ga0501084_0435418
1334 Ga0501084_0768349
1335 Ga0501084_0810573
1336 Ga0501084_1013409
1337 Ga0590077_032088
1338 Ga0501082_0002629
1339 Ga0501082_0005080
1340 Ga0501082_0044985
1341 Ga0501082_0048602
1342 Ga0501082_0104967
1343 Ga0501082_0169056
1344 Ga0501082_0191453
1345 Ga0501082_0227993
1346 Ga0501082_0237798
1347 Ga0501082_0706938
1348 Ga0530510_0000073
1349 Ga0530510_0001631
1350 Ga0530510_0004121
1351 Ga0530510_0009935
1352 Ga0530510_0018578
1353 Ga0530510_0056656
1354 Ga0530510_0064612
1355 Ga0530510_0140567
1356 Ga0530510_0143959
1357 Ga0530510_0284688
1358 Ga0530510_0390117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

14

218

0.95

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

65

154

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l7v-assembly1.cif.gz_A crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae 0.9875 15 213
3lbf-assembly3.cif.gz_C crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9854 13 213
3lbf-assembly4.cif.gz_D crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9837 11 213
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.972 7 218
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.9658 9 218
ID Description Score Start End Superfamily
4l7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9875 15 213 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.972 7 218 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9583 12 212 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9543 7 218 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9475 81 138 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7G3ELI4-F1-model_v4 deleted 0.9988 69 209
AF-A0A7V3RYU9-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9987 6 101 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A1W9Q5I7-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) 0.9978 75 219 GO:0004719
GO:0005737
GO:0030091
GO:0032259
GO:0036211
AF-A0A2T2VGC3-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.997 17 118 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A661L4B9-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9961 9 131 GO:0004719
GO:0005737
GO:0032259
GO:0036211

Map