F474665

General Info

Members Datasets Scaffolds Average Seq Length
678 327 678 153

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_0630977|Ga0451837_0630977_3483_3977
Length 164
Sequence MAISATLATNRGDIIIELFPDHAPKTVDNFVDLAEGTKGPSGKPFYDGLTFHRVIDGFMIQGGCPEGTGTGGPGYTFEDEFHPDLQFDRPYLLAMANAGPGTNGSQFFITAGPADWLNRRHTIFGEVKDAASRAVVDEIGTTATGPGDRPVDPVVIDQVTITRS

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
94 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
95 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
216 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 11.65
Rhizosphere 87.02
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10045478 3300002075 Bacteria 893
2 JGI24742J22300_10009173 3300002244 Bacteria 1631
3 Ga0070676_10229085 3300005328 Bacteria 1231
4 Ga0070690_100015622 3300005330 Bacteria 4534
5 Ga0070690_100422036 3300005330 Bacteria 983
6 Ga0068869_100394738 3300005334 Bacteria 1136
7 Ga0070666_10036962 3300005335 Bacteria 3245
8 Ga0070666_10964423 3300005335 Bacteria 632
9 Ga0070680_100041033 3300005336 Bacteria 3752
10 Ga0070680_100553936 3300005336 Bacteria 986
11 Ga0070682_100003314 3300005337 Bacteria 8928
12 Ga0070682_100462031 3300005337 Bacteria 975
13 Ga0068868_100118276 3300005338 Bacteria 2160
14 Ga0068868_100226790 3300005338 Bacteria 1566
15 Ga0068868_100787376 3300005338 Bacteria 857
16 Ga0070660_100121303 3300005339 Bacteria 2086
17 Ga0070689_100005870 3300005340 Bacteria 8436
18 Ga0070689_100370615 3300005340 Bacteria 1205
19 Ga0070691_10103802 3300005341 Bacteria 1414
20 Ga0070687_100039689 3300005343 Bacteria 2367
21 Ga0070692_10000439 3300005345 Bacteria 12673
22 Ga0070692_10115921 3300005345 Bacteria 1488
23 Ga0070668_100018041 3300005347 Bacteria 5294
24 Ga0070668_100083638 3300005347 Bacteria 2505
25 Ga0070668_100105834 3300005347 Bacteria 2235
26 Ga0070669_100237244 3300005353 Bacteria 1447
27 Ga0070675_100275415 3300005354 Bacteria 1478
28 Ga0070675_100409400 3300005354 Bacteria 1211
29 Ga0070674_100002226 3300005356 Bacteria 10669
30 Ga0070674_100004454 3300005356 Bacteria 7992
31 Ga0070674_100073229 3300005356 Bacteria 2428
32 Ga0070674_100143669 3300005356 Bacteria 1794
33 Ga0070673_100016796 3300005364 Bacteria 5186
34 Ga0070673_100360266 3300005364 Bacteria 1293
35 Ga0070673_101125842 3300005364 Bacteria 734
36 Ga0070688_100024686 3300005365 Bacteria 3551
37 Ga0070688_101559163 3300005365 Bacteria 539
38 Ga0070659_100065382 3300005366 Bacteria 2880
39 Ga0070667_101727423 3300005367 Bacteria 589
40 Ga0070703_10003330 3300005406 Bacteria 4584
41 Ga0070703_10111078 3300005406 Bacteria 981
42 Ga0070709_10007555 3300005434 Bacteria 5966
43 Ga0070709_10983293 3300005434 Bacteria 671
44 Ga0070714_100043623 3300005435 Bacteria 3794
45 Ga0070714_100062239 3300005435 Bacteria 3207
46 Ga0070714_100076035 3300005435 Bacteria 2914
47 Ga0070713_100069633 3300005436 Bacteria 2967
48 Ga0070713_100255590 3300005436 Bacteria 1600
49 Ga0070710_10009273 3300005437 Bacteria 4809
50 Ga0070710_10087276 3300005437 Bacteria 1833
51 Ga0070701_10032276 3300005438 Bacteria 2606
52 Ga0070701_10156909 3300005438 Bacteria 1315
53 Ga0070711_100012825 3300005439 Bacteria 5248
54 Ga0070711_100049931 3300005439 Bacteria 2866
55 Ga0070711_100256668 3300005439 Bacteria 1373
56 Ga0070705_100034721 3300005440 Bacteria 2821
57 Ga0070705_100050528 3300005440 Bacteria 2419
58 Ga0070705_100093044 3300005440 Bacteria 1883
59 Ga0070705_100119316 3300005440 Bacteria 1700
60 Ga0070700_100005568 3300005441 Bacteria 6676
61 Ga0070700_100034572 3300005441 Bacteria 3053
62 Ga0070700_100169157 3300005441 Bacteria 1512
63 Ga0070694_100018563 3300005444 Bacteria 4415
64 Ga0070694_100018723 3300005444 Bacteria 4398
65 Ga0070694_100179067 3300005444 Bacteria 1567
66 Ga0070694_101028327 3300005444 Bacteria 685
67 Ga0070708_100081904 3300005445 Bacteria 2923
68 Ga0070708_100082457 3300005445 Bacteria 2913
69 Ga0070708_100317525 3300005445 Bacteria 1467
70 Ga0070708_100447592 3300005445 Bacteria 1218
71 Ga0070663_100012552 3300005455 Bacteria 5364
72 Ga0070663_100356863 3300005455 Bacteria 1185
73 Ga0070678_100038757 3300005456 Bacteria 3357
74 Ga0070662_100051825 3300005457 Bacteria 2965
75 Ga0070681_10011124 3300005458 Bacteria 8906
76 Ga0070681_10362466 3300005458 Bacteria 1360
77 Ga0068867_100004976 3300005459 Bacteria 9362
78 Ga0070685_10003021 3300005466 Bacteria 8576
79 Ga0070706_100005687 3300005467 Bacteria 11853
80 Ga0070706_100185114 3300005467 Bacteria 1946
81 Ga0070706_100235264 3300005467 Bacteria 1710
82 Ga0070706_100274519 3300005467 Bacteria 1573
83 Ga0070706_100409191 3300005467 Bacteria 1263
84 Ga0070707_100006504 3300005468 Bacteria 10851
85 Ga0070707_100007253 3300005468 Bacteria 10293
86 Ga0070707_100119191 3300005468 Bacteria 2562
87 Ga0070707_101431808 3300005468 Bacteria 658
88 Ga0070698_100005934 3300005471 Bacteria 13322
89 Ga0070698_100052260 3300005471 Bacteria 4158
90 Ga0070698_100334595 3300005471 Bacteria 1445
91 Ga0070698_101830277 3300005471 Bacteria 560
92 Ga0070699_100011279 3300005518 Bacteria 7720
93 Ga0070699_100028457 3300005518 Bacteria 4819
94 Ga0070699_100029006 3300005518 Bacteria 4771
95 Ga0070699_100056202 3300005518 Bacteria 3407
96 Ga0070699_100375543 3300005518 Bacteria 1283
97 Ga0070699_101036285 3300005518 Bacteria 752
98 Ga0070679_100027608 3300005530 Bacteria 5588
99 Ga0070679_100180252 3300005530 Bacteria 2085
100 Ga0070679_100241510 3300005530 Bacteria 1763
101 Ga0070684_100574792 3300005535 Bacteria 1047
102 Ga0070697_100379406 3300005536 Bacteria 1224
103 Ga0070697_100456782 3300005536 Bacteria 1113
104 Ga0068853_100017405 3300005539 Bacteria 5935
105 Ga0068853_100042148 3300005539 Bacteria 3902
106 Ga0068853_100287994 3300005539 Bacteria 1516
107 Ga0068853_100437892 3300005539 Bacteria 1228
108 Ga0070672_100248156 3300005543 Bacteria 1499
109 Ga0070686_100001866 3300005544 Bacteria 11748
110 Ga0070686_100070726 3300005544 Bacteria 2282
111 Ga0070695_100009953 3300005545 Bacteria 5669
112 Ga0070695_100092594 3300005545 Bacteria 2021
113 Ga0070695_100132289 3300005545 Bacteria 1721
114 Ga0070695_100233849 3300005545 Bacteria 1330
115 Ga0070696_100008980 3300005546 Bacteria 6688
116 Ga0070696_100022074 3300005546 Bacteria 4322
117 Ga0070696_100244913 3300005546 Bacteria 1353
118 Ga0070696_101073038 3300005546 Bacteria 676
119 Ga0070693_100028041 3300005547 Bacteria 3058
120 Ga0070693_100051595 3300005547 Bacteria 2356
121 Ga0070693_100108152 3300005547 Bacteria 1706
122 Ga0070665_100007677 3300005548 Bacteria 10958
123 Ga0070704_100013469 3300005549 Bacteria 5076
124 Ga0070704_100039799 3300005549 Bacteria 3229
125 Ga0070704_100077259 3300005549 Bacteria 2438
126 Ga0070704_100145511 3300005549 Bacteria 1856
127 Ga0068855_100423606 3300005563 Bacteria 1456
128 Ga0068854_100058798 3300005578 Bacteria 2776
129 Ga0068856_100012093 3300005614 Bacteria 8360
130 Ga0068856_102401466 3300005614 Bacteria 534
131 Ga0070702_100001552 3300005615 Bacteria 9458
132 Ga0070702_100008536 3300005615 Bacteria 4967
133 Ga0070702_100015668 3300005615 Bacteria 3875
134 Ga0070702_100071348 3300005615 Bacteria 2053
135 Ga0068859_100155364 3300005617 Bacteria 2365
136 Ga0068864_100099597 3300005618 Bacteria 2575
137 Ga0068866_10074411 3300005718 Bacteria 1806
138 Ga0068866_10091606 3300005718 Bacteria 1657
139 Ga0068866_10306999 3300005718 Bacteria 993
140 Ga0068866_11040518 3300005718 Bacteria 584
141 Ga0068861_100108882 3300005719 Bacteria 2217
142 Ga0068861_100235900 3300005719 Bacteria 1553
143 Ga0068858_100052385 3300005842 Bacteria 3776
144 Ga0068858_100053837 3300005842 Bacteria 3721
145 Ga0068858_100313295 3300005842 Bacteria 1499
146 Ga0068860_100190503 3300005843 Bacteria 1985
147 Ga0068862_100211695 3300005844 Bacteria 1752
148 Ga0068862_100302832 3300005844 Bacteria 1471
149 Ga0081538_10019400 3300005981 Bacteria 5055
150 Ga0081538_10060176 3300005981 Bacteria 2187
151 Ga0081540_1002420 3300005983 Bacteria 15208
152 Ga0081539_10002641 3300005985 Bacteria 24476
153 Ga0081539_10037946 3300005985 Bacteria 2862
154 Ga0081539_10128753 3300005985 Bacteria 1246
155 Ga0070717_10015770 3300006028 Bacteria 5841
156 Ga0070717_10466164 3300006028 Bacteria 1140
157 Ga0075365_10007075 3300006038 Bacteria 6251
158 Ga0075365_10491300 3300006038 Bacteria 867
159 Ga0070712_100002885 3300006175 Bacteria 10660
160 Ga0070712_100005922 3300006175 Bacteria 7567
161 Ga0070712_100027500 3300006175 Bacteria 3798
162 Ga0070712_100434150 3300006175 Bacteria 1091
163 Ga0070712_100531750 3300006175 Bacteria 989
164 Ga0097621_100129237 3300006237 Bacteria 2149
165 Ga0097621_100314158 3300006237 Bacteria 1386
166 Ga0068871_100039536 3300006358 Bacteria 3775
167 Ga0075434_100211706 3300006871 Bacteria 1958
168 Ga0068865_100019162 3300006881 Bacteria 4426
169 Ga0075436_100081851 3300006914 Bacteria 2239
170 Ga0075436_100464899 3300006914 Bacteria 922
171 Ga0097620_100155362 3300006931 Bacteria 2365
172 Ga0075435_100012673 3300007076 Bacteria 6248
173 Ga0075435_100117412 3300007076 Bacteria 2217
174 Ga0105250_10061532 3300009092 Bacteria 1510
175 Ga0105240_10040877 3300009093 Bacteria 5925
176 Ga0111539_10015227 3300009094 Bacteria 9582
177 Ga0105245_10003129 3300009098 Bacteria 14807
178 Ga0105245_10045513 3300009098 Bacteria 3919
179 Ga0105245_10068781 3300009098 Bacteria 3210
180 Ga0105245_10209227 3300009098 Bacteria 1877
181 Ga0105245_10426569 3300009098 Bacteria 1330
182 Ga0105245_11142114 3300009098 Bacteria 826
183 Ga0105245_11692550 3300009098 Bacteria 685
184 Ga0105247_10053950 3300009101 Bacteria 2480
185 Ga0105247_10228655 3300009101 Bacteria 1262
186 Ga0114129_10119515 3300009147 Bacteria 3630
187 Ga0114129_10141619 3300009147 Bacteria 3295
188 Ga0105243_10014995 3300009148 Bacteria 5866
189 Ga0105243_10083842 3300009148 Bacteria 2608
190 Ga0105243_10125712 3300009148 Bacteria 2169
191 Ga0105243_10315303 3300009148 Bacteria 1423
192 Ga0105242_10054559 3300009176 Bacteria 3267
193 Ga0105242_10073289 3300009176 Bacteria 2846
194 Ga0105242_10290667 3300009176 Bacteria 1488
195 Ga0105242_10432258 3300009176 Bacteria 1236
196 Ga0105248_10035208 3300009177 Bacteria 5601
197 Ga0105248_10291150 3300009177 Bacteria 1839
198 Ga0105248_10474976 3300009177 Bacteria 1409
199 Ga0105248_10534168 3300009177 Bacteria 1323
200 Ga0105237_10020791 3300009545 Bacteria 6760
201 Ga0105238_10373015 3300009551 Bacteria 1417
202 Ga0105238_11075008 3300009551 Bacteria 827
203 Ga0105249_10000681 3300009553 Bacteria 30940
204 Ga0105249_10003025 3300009553 Bacteria 14507
205 Ga0105249_10137439 3300009553 Bacteria 2340
206 Ga0105239_10015186 3300010375 Bacteria 8535
207 Ga0105239_10040817 3300010375 Bacteria 5085
208 Ga0105239_10267233 3300010375 Bacteria 1923
209 Ga0105239_10574081 3300010375 Bacteria 1285
210 Ga0105239_11239073 3300010375 Bacteria 860
211 Ga0105246_10018607 3300011119 Bacteria 4430
212 Ga0105246_10116830 3300011119 Bacteria 1970
213 Ga0105246_10235245 3300011119 Bacteria 1445
214 Ga0105246_10648326 3300011119 Bacteria 919
215 Ga0157340_1014888 3300012473 Bacteria 599
216 Ga0157346_1019523 3300012480 Bacteria 580
217 Ga0157323_1005420 3300012495 Bacteria 853
218 Ga0157370_10734678 3300013104 Bacteria 900
219 Ga0157370_11284123 3300013104 Bacteria 660
220 Ga0157369_10425098 3300013105 Bacteria 1377
221 Ga0157369_10618170 3300013105 Bacteria 1118
222 Ga0157374_10128922 3300013296 Bacteria 2447
223 Ga0157378_10573757 3300013297 Bacteria 1136
224 Ga0157378_10589535 3300013297 Bacteria 1121
225 Ga0157378_10773746 3300013297 Bacteria 984
226 Ga0163162_10021273 3300013306 Bacteria 6385
227 Ga0163162_10037767 3300013306 Bacteria 4820
228 Ga0163162_10236358 3300013306 Bacteria 1958
229 Ga0157372_10326715 3300013307 Bacteria 1786
230 Ga0157375_10039284 3300013308 Bacteria 4554
231 Ga0157375_10081214 3300013308 Bacteria 3282
232 Ga0157375_10110329 3300013308 Bacteria 2848
233 Ga0163163_10063106 3300014325 Bacteria 3672
234 Ga0163163_11015296 3300014325 Bacteria 893
235 Ga0157380_10382078 3300014326 Bacteria 1329
236 Ga0157380_10992272 3300014326 Bacteria 873
237 Ga0182008_10127695 3300014497 Bacteria 1267
238 Ga0157377_10012642 3300014745 Bacteria 4249
239 Ga0157377_10025935 3300014745 Bacteria 3130
240 Ga0157377_10044924 3300014745 Bacteria 2465
241 Ga0157379_10100029 3300014968 Bacteria 2603
242 Ga0157376_10613019 3300014969 Bacteria 1085
243 Ga0182006_1221637 3300015261 Bacteria 623
244 Ga0182006_1232102 3300015261 Bacteria 607
245 Ga0182007_10030115 3300015262 Bacteria 1856
246 Ga0163161_10018850 3300017792 Bacteria 4836
247 Ga0206356_11642986 3300020070 Bacteria 2061
248 Ga0206350_10394142 3300020080 Bacteria 955
249 Ga0206353_10708315 3300020082 Bacteria 2101
250 Ga0206353_12030080 3300020082 Bacteria 6381
251 Ga0207692_10008402 3300025898 Bacteria 4270
252 Ga0207692_10346127 3300025898 Bacteria 915
253 Ga0207642_10019387 3300025899 Bacteria 2633
254 Ga0207710_10043800 3300025900 Bacteria 1992
255 Ga0207710_10060015 3300025900 Bacteria 1723
256 Ga0207710_10106421 3300025900 Bacteria 1328
257 Ga0207688_10011869 3300025901 Bacteria 4741
258 Ga0207688_10026672 3300025901 Bacteria 3178
259 Ga0207680_10020622 3300025903 Bacteria 3552
260 Ga0207685_10062827 3300025905 Bacteria 1477
261 Ga0207699_10016790 3300025906 Bacteria 3838
262 Ga0207699_10812044 3300025906 Bacteria 688
263 Ga0207645_10008858 3300025907 Bacteria 6991
264 Ga0207684_10044770 3300025910 Bacteria 3753
265 Ga0207684_10475803 3300025910 Bacteria 1072
266 Ga0207707_10012654 3300025912 Bacteria 7332
267 Ga0207695_10737638 3300025913 Bacteria 865
268 Ga0207671_10814953 3300025914 Bacteria 740
269 Ga0207693_10015719 3300025915 Bacteria 6065
270 Ga0207693_10026600 3300025915 Bacteria 4578
271 Ga0207663_10013249 3300025916 Bacteria 4479
272 Ga0207663_10159872 3300025916 Bacteria 1589
273 Ga0207663_11274383 3300025916 Bacteria 592
274 Ga0207660_10077408 3300025917 Bacteria 2435
275 Ga0207662_10048306 3300025918 Bacteria 2520
276 Ga0207662_10056980 3300025918 Bacteria 2335
277 Ga0207657_10223630 3300025919 Bacteria 1507
278 Ga0207649_10637080 3300025920 Bacteria 823
279 Ga0207652_10061109 3300025921 Bacteria 3253
280 Ga0207652_10183293 3300025921 Bacteria 1882
281 Ga0207646_10003525 3300025922 Bacteria 17627
282 Ga0207646_10005850 3300025922 Bacteria 12856
283 Ga0207646_10076566 3300025922 Bacteria 2990
284 Ga0207681_10279969 3300025923 Bacteria 1313
285 Ga0207694_10721796 3300025924 Bacteria 841
286 Ga0207650_11016956 3300025925 Bacteria 705
287 Ga0207659_11925323 3300025926 Bacteria 501
288 Ga0207687_10040312 3300025927 Bacteria 3201
289 Ga0207687_10045878 3300025927 Bacteria 3023
290 Ga0207687_10195103 3300025927 Bacteria 1579
291 Ga0207687_10239978 3300025927 Bacteria 1436
292 Ga0207664_10029121 3300025929 Bacteria 4204
293 Ga0207664_11402195 3300025929 Bacteria 619
294 Ga0207690_10125225 3300025932 Bacteria 1873
295 Ga0207706_10006238 3300025933 Bacteria 11081
296 Ga0207706_10018859 3300025933 Bacteria 6205
297 Ga0207686_10026482 3300025934 Bacteria 3383
298 Ga0207686_10190406 3300025934 Bacteria 1462
299 Ga0207686_10301968 3300025934 Bacteria 1189
300 Ga0207709_10000823 3300025935 Bacteria 23946
301 Ga0207709_10024643 3300025935 Bacteria 3437
302 Ga0207709_10055694 3300025935 Bacteria 2444
303 Ga0207670_10004122 3300025936 Bacteria 7782
304 Ga0207670_10363004 3300025936 Bacteria 1150
305 Ga0207669_10028357 3300025937 Bacteria 3079
306 Ga0207669_10093582 3300025937 Bacteria 1964
307 Ga0207669_10112375 3300025937 Bacteria 1829
308 Ga0207704_10003551 3300025938 Bacteria 7089
309 Ga0207704_11148046 3300025938 Bacteria 661
310 Ga0207665_10041945 3300025939 Bacteria 3057
311 Ga0207665_10409793 3300025939 Bacteria 1034
312 Ga0207691_10296727 3300025940 Bacteria 1389
313 Ga0207691_10396458 3300025940 Bacteria 1177
314 Ga0207711_10026268 3300025941 Bacteria 4885
315 Ga0207711_10344723 3300025941 Bacteria 1379
316 Ga0207711_10349892 3300025941 Bacteria 1368
317 Ga0207711_10562889 3300025941 Bacteria 1063
318 Ga0207661_10001998 3300025944 Bacteria 14033
319 Ga0207661_10581755 3300025944 Bacteria 1027
320 Ga0207712_10001535 3300025961 Bacteria 15634
321 Ga0207712_10006034 3300025961 Bacteria 7642
322 Ga0207668_10001571 3300025972 Bacteria 13367
323 Ga0207668_10032218 3300025972 Bacteria 3461
324 Ga0207668_10328534 3300025972 Bacteria 1271
325 Ga0207640_10316622 3300025981 Bacteria 1240
326 Ga0207677_10197016 3300026023 Bacteria 1598
327 Ga0207677_10355351 3300026023 Bacteria 1229
328 Ga0207677_10790570 3300026023 Bacteria 849
329 Ga0207677_11701104 3300026023 Bacteria 585
330 Ga0207677_11719793 3300026023 Bacteria 582
331 Ga0207703_10034712 3300026035 Bacteria 4004
332 Ga0207703_10150195 3300026035 Bacteria 2031
333 Ga0207639_10042782 3300026041 Bacteria 3397
334 Ga0207639_10563307 3300026041 Bacteria 1047
335 Ga0207678_10251455 3300026067 Bacteria 1514
336 Ga0207708_10005998 3300026075 Bacteria 9002
337 Ga0207708_10010501 3300026075 Bacteria 6874
338 Ga0207708_10060071 3300026075 Bacteria 2902
339 Ga0207708_10173934 3300026075 Bacteria 1707
340 Ga0207702_10065832 3300026078 Bacteria 3104
341 Ga0207648_10000097 3300026089 Bacteria 83554
342 Ga0207648_10028628 3300026089 Bacteria 4938
343 Ga0207648_10078870 3300026089 Bacteria 2873
344 Ga0207676_10026117 3300026095 Bacteria 4341
345 Ga0207676_10266658 3300026095 Bacteria 1549
346 Ga0207676_10365294 3300026095 Bacteria 1339
347 Ga0207675_100001912 3300026118 Bacteria 20780
348 Ga0207675_100178849 3300026118 Bacteria 2031
349 Ga0207675_100207451 3300026118 Bacteria 1883
350 Ga0207675_100265613 3300026118 Bacteria 1664
351 Ga0207683_10000038 3300026121 Bacteria 100875
352 Ga0207698_10095551 3300026142 Bacteria 2447
353 Ga0207428_10002883 3300027907 Bacteria 17042
354 Ga0268266_10091365 3300028379 Bacteria 2669
355 Ga0268265_10094966 3300028380 Bacteria 2393
356 Ga0268265_10319433 3300028380 Bacteria 1405
357 Ga0268265_10520187 3300028380 Bacteria 1125
358 Ga0268264_11576849 3300028381 Bacteria 667
359 Ga0265319_1004631 3300028563 Bacteria 6761
360 Ga0265334_10118695 3300028573 Bacteria 946
361 Ga0265322_10012031 3300028654 Bacteria 2503
362 Ga0265336_10025764 3300028666 Bacteria 1851
363 Ga0265338_10098477 3300028800 Bacteria 2392
364 Ga0265332_10000830 3300031238 Bacteria 18745
365 Ga0265320_10038881 3300031240 Bacteria 2382
366 Ga0265329_10030443 3300031242 Bacteria 1758
367 Ga0265339_10002754 3300031249 Bacteria 12482
368 Ga0265331_10157106 3300031250 Bacteria 1031
369 Ga0265314_10039431 3300031711 Bacteria 3402
370 Ga0307413_10039275 3300031824 Bacteria 2751
371 Ga0307413_10305559 3300031824 Bacteria 1208
372 Ga0307413_10970779 3300031824 Bacteria 726
373 Ga0307410_11517676 3300031852 Bacteria 590
374 Ga0307406_10055297 3300031901 Bacteria 2536
375 Ga0307409_100106705 3300031995 Bacteria 2338
376 Ga0307416_100373303 3300032002 Bacteria 1453
377 Ga0307416_102131483 3300032002 Bacteria 662
378 Ga0307416_102552427 3300032002 Bacteria 609
379 Ga0307411_10024445 3300032005 Bacteria 3602
380 Ga0307411_10129185 3300032005 Bacteria 1844
381 Ga0307415_100017115 3300032126 Bacteria 4339
382 Ga0373930_0006042 3300034816 Bacteria 2031
383 Ga0373948_0019024 3300034817 Bacteria 1295
384 Ga0373959_0214727 3300034820 Bacteria 513
385 Ga0373938_0229262 3300034957 Bacteria 524
386 Ga0373929_0037821 3300035085 Bacteria 1059
387 Ga0373944_0272644 3300035089 Bacteria 629
388 Ga0373949_0003557 3300035090 Bacteria 3681
389 Ga0373951_0001825 3300035091 Bacteria 5525
390 Ga0373952_0006760 3300035092 Bacteria 2131
391 Ga0373932_0008867 3300035112 Bacteria 2408
392 Ga0373936_0388656 3300035113 Bacteria 639
393 Ga0373939_0017759 3300035114 Bacteria 1894
394 Ga0373941_0001105 3300035115 Bacteria 5625
395 Ga0373943_0487315 3300035170 Bacteria 719
396 Ga0373946_0011487 3300035171 Bacteria 3306
397 Ga0373942_0054474 3300035207 Bacteria 1130
398 Ga0373962_0002255 3300035242 Bacteria 4608
399 Ga0316574_0015191 3300035398 Bacteria 4467
400 Ga0373931_0015842 3300035691 Bacteria 3701
401 Ga0373947_0046859 3300035725 Bacteria 2589
402 Ga0373947_0073117 3300035725 Bacteria 2107
403 Ga0373947_0141698 3300035725 Bacteria 1542
404 Ga0373937_0005831 3300036401 Bacteria 10589
405 Ga0373925_0109745 3300037068 Bacteria 2130
406 Ga0395899_0007102 3300037312 Bacteria 8668
407 Ga0395899_0012461 3300037312 Bacteria 6515
408 Ga0395899_0022426 3300037312 Bacteria 4788
409 Ga0395899_0036492 3300037312 Bacteria 3687
410 Ga0395899_0043610 3300037312 Bacteria 3345
411 Ga0395899_0553088 3300037312 Bacteria 739
412 Ga0395900_0001661 3300037418 Bacteria 26033
413 Ga0395900_0005716 3300037418 Bacteria 12997
414 Ga0395900_0016989 3300037418 Bacteria 7427
415 Ga0395900_0019506 3300037418 Bacteria 6913
416 Ga0395900_0023789 3300037418 Bacteria 6268
417 Ga0395900_0026222 3300037418 Bacteria 5968
418 Ga0395900_0072861 3300037418 Bacteria 3530
419 Ga0395900_0084667 3300037418 Bacteria 3258
420 Ga0395900_0106543 3300037418 Bacteria 2879
421 Ga0395900_0142244 3300037418 Bacteria 2456
422 Ga0395900_0182653 3300037418 Bacteria 2130
423 Ga0395900_0392784 3300037418 Bacteria 1353
424 Ga0395900_0897263 3300037418 Bacteria 810
425 Ga0395898_0003643 3300037466 Bacteria 17125
426 Ga0395898_0004328 3300037466 Bacteria 15549
427 Ga0395898_0006068 3300037466 Bacteria 12973
428 Ga0395898_0025504 3300037466 Bacteria 5956
429 Ga0395898_0031445 3300037466 Bacteria 5303
430 Ga0395898_0072722 3300037466 Bacteria 3321
431 Ga0395898_0140998 3300037466 Bacteria 2307
432 Ga0395898_0469159 3300037466 Bacteria 1198
433 Ga0395898_0990406 3300037466 Bacteria 777
434 Ga0395905_0003336 3300037471 Bacteria 17229
435 Ga0395905_0008963 3300037471 Bacteria 9817
436 Ga0395905_0014334 3300037471 Bacteria 7576
437 Ga0395905_0019447 3300037471 Bacteria 6438
438 Ga0395905_0052189 3300037471 Bacteria 3828
439 Ga0395905_0062176 3300037471 Bacteria 3492
440 Ga0395905_0154775 3300037471 Bacteria 2156
441 Ga0395905_0181051 3300037471 Bacteria 1978
442 Ga0395905_0305381 3300037471 Archaea 1479
443 Ga0395905_0397142 3300037471 Bacteria 1273
444 Ga0395905_0585997 3300037471 Bacteria 1017
445 Ga0395901_0000956 3300038443 Bacteria 31448
446 Ga0395901_0004995 3300038443 Bacteria 13391
447 Ga0395901_0013042 3300038443 Bacteria 8434
448 Ga0395901_0046765 3300038443 Bacteria 4495
449 Ga0395901_0047097 3300038443 Bacteria 4477
450 Ga0395901_0070904 3300038443 Bacteria 3630
451 Ga0395901_0162730 3300038443 Bacteria 2343
452 Ga0395901_0174570 3300038443 Bacteria 2254
453 Ga0395901_0368885 3300038443 Bacteria 1479
454 Ga0395901_0488894 3300038443 Bacteria 1254
455 Ga0395901_0524070 3300038443 Bacteria 1203
456 Ga0395901_0539897 3300038443 Bacteria 1183
457 Ga0395901_0550367 3300038443 Bacteria 1169
458 Ga0395901_1067842 3300038443 Bacteria 779
459 Ga0242422_09518 3300038699 Bacteria 565
460 Ga0242420_068899 3300038996 Bacteria 716
461 Ga0436365_0209504 3300039437 Bacteria 793
462 Ga0436363_1175972 3300039450 Bacteria 569
463 Ga0451793_0184281 3300041452 Bacteria 5752
464 Ga0451807_0422792 3300041486 Bacteria 721
465 Ga0451837_0630977 3300041494 Bacteria 5127
466 Ga0451851_0168620 3300041507 Bacteria 540
467 Ga0439437_021989 3300042000 Bacteria 775
468 Ga0439448_0007952 3300042005 Bacteria 3090
469 Ga0450907_004419 3300042146 Bacteria 2428
470 Ga0466963_0008599 3300044694 Bacteria 6128
471 Ga0466963_0294336 3300044694 Bacteria 1141
472 Ga0466963_0561411 3300044694 Bacteria 806
473 Ga0466971_0012510 3300044719 Bacteria 3721
474 Ga0466957_0012714 3300044842 Bacteria 4878
475 Ga0466957_0013907 3300044842 Bacteria 4679
476 Ga0466960_0028499 3300044901 Bacteria 2556
477 Ga0466960_0048693 3300044901 Bacteria 2037
478 Ga0451576_0021703 3300045051 Bacteria 6974
479 Ga0466958_0069980 3300045836 Bacteria 2146
480 Ga0466958_1033685 3300045836 Bacteria 536
481 Ga0466967_0001385 3300045976 Bacteria 13992
482 Ga0466967_0031189 3300045976 Bacteria 4484
483 Ga0466967_0066356 3300045976 Bacteria 3215
484 Ga0466967_0829781 3300045976 Bacteria 918
485 Ga0466967_0830639 3300045976 Bacteria 918
486 Ga0495603_0000394 3300046455 Bacteria 23982
487 Ga0495603_0082422 3300046455 Bacteria 1884
488 Ga0495641_0005687 3300046461 Bacteria 8308
489 Ga0495641_0034890 3300046461 Bacteria 2375
490 Ga0495653_0556184 3300046463 Bacteria 709
491 Ga0495580_0294289 3300046472 Bacteria 1106
492 Ga0495582_0141729 3300046473 Bacteria 1362
493 Ga0495582_0345785 3300046473 Bacteria 856
494 Ga0495605_0047235 3300046474 Bacteria 2112
495 Ga0495605_0229456 3300046474 Bacteria 800
496 Ga0495639_0063801 3300046475 Bacteria 1692
497 Ga0495584_0059027 3300046491 Bacteria 1930
498 Ga0495584_0198873 3300046491 Bacteria 1019
499 Ga0495584_0226184 3300046491 Bacteria 951
500 Ga0495585_0230603 3300046492 Bacteria 931
501 Ga0495594_0000597 3300046499 Bacteria 18592
502 Ga0495596_0042160 3300046500 Bacteria 1799
503 Ga0495596_0148737 3300046500 Bacteria 910
504 Ga0495607_0253021 3300046501 Bacteria 847
505 Ga0495630_0153833 3300046517 Bacteria 1750
506 Ga0495631_0107917 3300046518 Bacteria 1197
507 Ga0495631_0170337 3300046518 Bacteria 934
508 Ga0495637_0181445 3300046520 Bacteria 780
509 Ga0495644_0088788 3300046523 Bacteria 1166
510 Ga0495663_0032625 3300046525 Bacteria 1552
511 Ga0495666_0152732 3300046526 Bacteria 1073
512 Ga0495666_0159231 3300046526 Bacteria 1047
513 Ga0495652_0426054 3300046529 Bacteria 934
514 Ga0495665_0097452 3300046531 Bacteria 1544
515 Ga0495665_0421653 3300046531 Bacteria 676
516 Ga0495640_0284474 3300046533 Bacteria 1029
517 Ga0495609_0062602 3300046538 Bacteria 1643
518 Ga0495622_0090480 3300046557 Bacteria 1406
519 Ga0495667_0084055 3300046559 Bacteria 2067
520 Ga0495656_0084713 3300046615 Bacteria 1438
521 Ga0495656_0350189 3300046615 Bacteria 765
522 Ga0495634_0732201 3300046642 Bacteria 567
523 Ga0495611_0535936 3300046648 Bacteria 531
524 Ga0495659_0028483 3300046664 Bacteria 1934
525 Ga0495661_0160590 3300046665 Bacteria 1207
526 Ga0495588_0000483 3300046674 Bacteria 19736
527 Ga0495588_0077991 3300046674 Bacteria 1728
528 Ga0495647_0038652 3300046681 Bacteria 1805
529 Ga0495647_0348723 3300046681 Bacteria 674
530 Ga0495658_0137338 3300046683 Bacteria 1493
531 Ga0495658_0386356 3300046683 Bacteria 892
532 Ga0495669_0370449 3300046684 Bacteria 693
533 Ga0495624_0311657 3300046690 Bacteria 948
534 Ga0495670_0276311 3300046691 Bacteria 898
535 Ga0495670_0489786 3300046691 Bacteria 667
536 Ga0495671_0570904 3300046692 Bacteria 538
537 Ga0495589_0054689 3300046794 Bacteria 1968
538 Ga0495581_0093423 3300047315 Bacteria 1746
539 Ga0495581_0099929 3300047315 Bacteria 1685
540 Ga0495636_0389521 3300047318 Bacteria 662
541 Ga0495674_0245018 3300047319 Bacteria 1476
542 Ga0495676_0010528 3300047321 Bacteria 8381
543 Ga0495676_0017024 3300047321 Bacteria 6434
544 Ga0495676_0046204 3300047321 Bacteria 3537
545 Ga0495676_0647141 3300047321 Bacteria 686
546 Ga0495683_0127503 3300047323 Bacteria 1203
547 Ga0495677_0067000 3300047445 Bacteria 1336
548 Ga0495614_0417762 3300048089 Bacteria 632
549 Ga0495615_0135201 3300048090 Bacteria 724
550 Ga0496100_0025684 3300048903 Bacteria 3603
551 Ga0496100_0413035 3300048903 Bacteria 1030
552 Ga0496100_0877137 3300048903 Bacteria 704
553 Ga0496101_0035677 3300048904 Bacteria 3519
554 Ga0496101_0039743 3300048904 Bacteria 3347
555 Ga0496101_0075309 3300048904 Bacteria 2484
556 Ga0496101_0290977 3300048904 Bacteria 1278
557 Ga0496101_0437689 3300048904 Bacteria 1031
558 Ga0496102_0046636 3300048905 Bacteria 3936
559 Ga0496102_0070848 3300048905 Bacteria 3201
560 Ga0496102_0122382 3300048905 Bacteria 2430
561 Ga0496102_0170273 3300048905 Bacteria 2050
562 Ga0496102_0197236 3300048905 Bacteria 1897
563 Ga0496102_0312581 3300048905 Bacteria 1481
564 Ga0496102_0696783 3300048905 Bacteria 939
565 Ga0496102_1310810 3300048905 Bacteria 643
566 Ga0496102_1521808 3300048905 Bacteria 588
567 Ga0496103_0002524 3300048906 Bacteria 11471
568 Ga0496103_0079911 3300048906 Bacteria 2055
569 Ga0496103_0839874 3300048906 Bacteria 578
570 Ga0496104_0000003 3300048907 Bacteria 669219
571 Ga0496104_0000432 3300048907 Bacteria 36339
572 Ga0496104_0018643 3300048907 Bacteria 6334
573 Ga0496104_0018678 3300048907 Bacteria 6329
574 Ga0496104_0122252 3300048907 Bacteria 2499
575 Ga0496104_0459018 3300048907 Bacteria 1185
576 Ga0496104_1198745 3300048907 Bacteria 662
577 Ga0496105_0000003 3300048908 Bacteria 713251
578 Ga0496105_0000348 3300048908 Bacteria 30485
579 Ga0496105_0004665 3300048908 Bacteria 10331
580 Ga0496105_0027494 3300048908 Bacteria 4648
581 Ga0496105_0052739 3300048908 Bacteria 3359
582 Ga0496105_0135018 3300048908 Bacteria 2033
583 Ga0496106_0001818 3300048909 Bacteria 15953
584 Ga0496106_0026958 3300048909 Bacteria 4278
585 Ga0496106_0296337 3300048909 Bacteria 1297
586 Ga0496107_0000389 3300048910 Bacteria 23869
587 Ga0496107_0007441 3300048910 Bacteria 7548
588 Ga0496107_0042096 3300048910 Bacteria 3281
589 Ga0496107_1177120 3300048910 Bacteria 552
590 Ga0496108_0005047 3300048911 Bacteria 10662
591 Ga0496108_0022292 3300048911 Bacteria 5206
592 Ga0496108_0055960 3300048911 Bacteria 3313
593 Ga0496108_0075704 3300048911 Bacteria 2844
594 Ga0496108_0714008 3300048911 Bacteria 869
595 Ga0496109_0037547 3300048912 Bacteria 4376
596 Ga0496109_0050242 3300048912 Bacteria 3798
597 Ga0496109_0065498 3300048912 Bacteria 3326
598 Ga0496109_0170351 3300048912 Bacteria 2042
599 Ga0496109_0180199 3300048912 Bacteria 1984
600 Ga0496109_0297769 3300048912 Bacteria 1521
601 Ga0496109_0356725 3300048912 Bacteria 1381
602 Ga0496110_0000944 3300048913 Bacteria 20341
603 Ga0496110_0067296 3300048913 Bacteria 3169
604 Ga0496110_0111139 3300048913 Bacteria 2463
605 Ga0496110_0309694 3300048913 Bacteria 1438
606 Ga0496110_0382812 3300048913 Bacteria 1282
607 Ga0496110_1034925 3300048913 Bacteria 729
608 Ga0496111_0000045 3300048914 Bacteria 48903
609 Ga0496111_0091733 3300048914 Bacteria 2226
610 Ga0496111_0516167 3300048914 Bacteria 879
611 Ga0496112_0014277 3300048915 Bacteria 7360
612 Ga0496112_0085852 3300048915 Bacteria 3113
613 Ga0496112_0174562 3300048915 Bacteria 2114
614 Ga0496112_0836085 3300048915 Bacteria 844
615 Ga0496112_0894273 3300048915 Bacteria 810
616 Ga0496112_0965235 3300048915 Bacteria 773
617 Ga0496113_0000076 3300048916 Bacteria 42925
618 Ga0496113_0171876 3300048916 Bacteria 1716
619 Ga0496113_0190448 3300048916 Bacteria 1628
620 Ga0496114_0018856 3300048917 Bacteria 5586
621 Ga0496114_0028495 3300048917 Bacteria 4583
622 Ga0496114_0041150 3300048917 Bacteria 3829
623 Ga0496114_0399487 3300048917 Bacteria 1217
624 Ga0496114_0441732 3300048917 Bacteria 1152
625 Ga0496115_0008731 3300048918 Bacteria 7512
626 Ga0496115_0017633 3300048918 Bacteria 5465
627 Ga0496122_0205098 3300048925 Bacteria 1148
628 Ga0496126_0014963 3300048929 Bacteria 7821
629 Ga0501032_0106529 3300049569 Bacteria 1857
630 Ga0501038_1336247 3300049574 Bacteria 517
631 Ga0501042_0378920 3300049578 Unclassified 1024
632 Ga0501043_0041324 3300049579 Bacteria 3623
633 Ga0501046_0102715 3300049580 Bacteria 2192
634 Ga0501047_0237422 3300049581 Bacteria 1674
635 Ga0501067_0009040 3300049583 Bacteria 5518
636 Ga0501067_0022007 3300049583 Bacteria 3527
637 Ga0501067_0101540 3300049583 Bacteria 1598
638 Ga0501068_0182180 3300049584 Bacteria 1328
639 Ga0501069_0009379 3300049585 Bacteria 5166
640 Ga0501069_0032720 3300049585 Bacteria 2862
641 Ga0501069_0041169 3300049585 Bacteria 2553
642 Ga0501069_0060706 3300049585 Bacteria 2111
643 Ga0501069_0179267 3300049585 Bacteria 1224
644 Ga0501070_0010946 3300049586 Bacteria 7658
645 Ga0501072_0319992 3300049588 Unclassified 1233
646 Ga0501072_0873341 3300049588 Bacteria 703
647 Ga0501073_0067037 3300049589 Bacteria 2502
648 Ga0501074_0026101 3300049590 Bacteria 4236
649 Ga0501079_0005310 3300049741 Bacteria 9588
650 Ga0501080_0001819 3300049742 Bacteria 18282
651 Ga0501080_0084696 3300049742 Bacteria 2945
652 Ga0501080_0118671 3300049742 Bacteria 2452
653 Ga0501083_0016753 3300049744 Bacteria 5119
654 Ga0501083_0426098 3300049744 Bacteria 863
655 Ga0501044_0055236 3300049823 Bacteria 4079
656 Ga0501045_0129363 3300049824 Unclassified 1877
657 nmdc:mga0yw44_13283_c1 3300050492 Bacteria 4330
658 nmdc:mga05p37_304803_c1 3300050507 Bacteria 1891
659 nmdc:mga05p37_455627_c1 3300050507 Bacteria 1479
660 nmdc:mga05p37_758028_c1 3300050507 Bacteria 1069
661 nmdc:mga06r32_59004_c1 3300050510 Bacteria 3689
662 nmdc:mga06r32_607861_c1 3300050510 Bacteria 1064
663 nmdc:mga08y16_20136_c1 3300050511 Bacteria 7041
664 nmdc:mga0n895_5243_c1 3300050512 Bacteria 10802
665 nmdc:mga0rr50_294503_c1 3300050513 Bacteria 1357
666 nmdc:mga0rr50_62604_c1 3300050513 Bacteria 2808
667 nmdc:mga08x19_29306_c1 3300050514 Bacteria 3452
668 nmdc:mga08x19_77019_c1 3300050514 Bacteria 2184
669 nmdc:mga0a205_174868_c1 3300050515 Bacteria 2043
670 nmdc:mga0a205_46736_c1 3300050515 Bacteria 4175
671 Ga0495601_0026997 3300053077 Bacteria 3548
672 Ga0495612_0532307 3300053078 Bacteria 540
673 Ga0495595_0394799 3300053084 Bacteria 701
674 Ga0587066_142228 3300059490 Bacteria 587
675 Ga0466962_0010804 3300061719 Bacteria 4389
676 Ga0530510_0087539 3300061734 Bacteria 2269
677 Ga0530510_0194326 3300061734 Bacteria 1506
678 Ga0530510_1041787 3300061734 Bacteria 626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10007075 Ga0075365_100070752 150
2 3300006038 Ga0075365_10491300 Ga0075365_104913001 150
3 3300037418 Ga0395900_0897263 Ga0395900_0897263_27_488 150
4 3300038443 Ga0395901_0488894 Ga0395901_0488894_268_768 150
5 3300050492 nmdc:mga0yw44_13283_c1 nmdc:mga0yw44_13283_c1_900_1400 150
6 3300002244 JGI24742J22300_10009173 JGI24742J22300_100091731 151
7 3300005330 Ga0070690_100015622 Ga0070690_1000156223 151
8 3300005335 Ga0070666_10036962 Ga0070666_100369625 151
9 3300005336 Ga0070680_100553936 Ga0070680_1005539362 151
10 3300005337 Ga0070682_100003314 Ga0070682_10000331413 151
11 3300005337 Ga0070682_100462031 Ga0070682_1004620311 151
12 3300005338 Ga0068868_100787376 Ga0068868_1007873762 151
13 3300005340 Ga0070689_100005870 Ga0070689_1000058704 151
14 3300005343 Ga0070687_100039689 Ga0070687_1000396894 151
15 3300005345 Ga0070692_10000439 Ga0070692_1000043917 151
16 3300005347 Ga0070668_100018041 Ga0070668_1000180413 151
17 3300005354 Ga0070675_100275415 Ga0070675_1002754152 151
18 3300005354 Ga0070675_100409400 Ga0070675_1004094001 151
19 3300005356 Ga0070674_100002226 Ga0070674_1000022266 151
20 3300005364 Ga0070673_100016796 Ga0070673_1000167967 151
21 3300005365 Ga0070688_100024686 Ga0070688_1000246862 151
22 3300005366 Ga0070659_100065382 Ga0070659_1000653823 151
23 3300005406 Ga0070703_10111078 Ga0070703_101110782 151
24 3300005434 Ga0070709_10007555 Ga0070709_100075558 151
25 3300005435 Ga0070714_100076035 Ga0070714_1000760355 151
26 3300005436 Ga0070713_100069633 Ga0070713_1000696331 151
27 3300005436 Ga0070713_100255590 Ga0070713_1002555902 151
28 3300005437 Ga0070710_10009273 Ga0070710_100092733 151
29 3300005438 Ga0070701_10032276 Ga0070701_100322762 151
30 3300005439 Ga0070711_100012825 Ga0070711_1000128255 151
31 3300005441 Ga0070700_100005568 Ga0070700_1000055688 151
32 3300005444 Ga0070694_100179067 Ga0070694_1001790672 151
33 3300005444 Ga0070694_101028327 Ga0070694_1010283272 151
34 3300005445 Ga0070708_100082457 Ga0070708_1000824575 151
35 3300005445 Ga0070708_100447592 Ga0070708_1004475922 151
36 3300005455 Ga0070663_100012552 Ga0070663_10001255210 151
37 3300005455 Ga0070663_100356863 Ga0070663_1003568632 151
38 3300005456 Ga0070678_100038757 Ga0070678_1000387574 151
39 3300005458 Ga0070681_10362466 Ga0070681_103624662 151
40 3300005459 Ga0068867_100004976 Ga0068867_1000049763 151
41 3300005466 Ga0070685_10003021 Ga0070685_100030218 151
42 3300005467 Ga0070706_100005687 Ga0070706_10000568712 151
43 3300005467 Ga0070706_100185114 Ga0070706_1001851142 151
44 3300005468 Ga0070707_100006504 Ga0070707_10000650410 151
45 3300005471 Ga0070698_100005934 Ga0070698_1000059349 151
46 3300005471 Ga0070698_100334595 Ga0070698_1003345952 151
47 3300005471 Ga0070698_101830277 Ga0070698_1018302771 151
48 3300005518 Ga0070699_100011279 Ga0070699_1000112792 151
49 3300005518 Ga0070699_100028457 Ga0070699_1000284573 151
50 3300005518 Ga0070699_100056202 Ga0070699_1000562022 151
51 3300005518 Ga0070699_100375543 Ga0070699_1003755432 151
52 3300005530 Ga0070679_100027608 Ga0070679_1000276082 151
53 3300005530 Ga0070679_100180252 Ga0070679_1001802523 151
54 3300005536 Ga0070697_100379406 Ga0070697_1003794062 151
55 3300005536 Ga0070697_100456782 Ga0070697_1004567822 151
56 3300005539 Ga0068853_100017405 Ga0068853_1000174056 151
57 3300005544 Ga0070686_100001866 Ga0070686_10000186613 151
58 3300005545 Ga0070695_100092594 Ga0070695_1000925941 151
59 3300005546 Ga0070696_100022074 Ga0070696_1000220744 151
60 3300005546 Ga0070696_100244913 Ga0070696_1002449132 151
61 3300005547 Ga0070693_100108152 Ga0070693_1001081523 151
62 3300005548 Ga0070665_100007677 Ga0070665_1000076775 151
63 3300005549 Ga0070704_100013469 Ga0070704_1000134694 151
64 3300005563 Ga0068855_100423606 Ga0068855_1004236063 151
65 3300005614 Ga0068856_100012093 Ga0068856_10001209313 151
66 3300005614 Ga0068856_102401466 Ga0068856_1024014661 151
67 3300005615 Ga0070702_100008536 Ga0070702_1000085369 151
68 3300005718 Ga0068866_10074411 Ga0068866_100744112 151
69 3300005842 Ga0068858_100053837 Ga0068858_1000538376 151
70 3300005844 Ga0068862_100302832 Ga0068862_1003028322 151
71 3300005985 Ga0081539_10002641 Ga0081539_100026417 151
72 3300005985 Ga0081539_10128753 Ga0081539_101287531 151
73 3300006028 Ga0070717_10015770 Ga0070717_100157706 151
74 3300006028 Ga0070717_10466164 Ga0070717_104661643 151
75 3300006175 Ga0070712_100005922 Ga0070712_1000059222 151
76 3300006175 Ga0070712_100027500 Ga0070712_1000275006 151
77 3300006175 Ga0070712_100434150 Ga0070712_1004341503 151
78 3300006175 Ga0070712_100531750 Ga0070712_1005317502 151
79 3300006237 Ga0097621_100129237 Ga0097621_1001292372 151
80 3300006358 Ga0068871_100039536 Ga0068871_1000395363 151
81 3300006881 Ga0068865_100019162 Ga0068865_1000191621 151
82 3300006914 Ga0075436_100081851 Ga0075436_1000818514 151
83 3300009093 Ga0105240_10040877 Ga0105240_100408777 151
84 3300009094 Ga0111539_10015227 Ga0111539_100152277 151
85 3300009098 Ga0105245_10003129 Ga0105245_1000312911 151
86 3300009098 Ga0105245_11692550 Ga0105245_116925501 151
87 3300009101 Ga0105247_10053950 Ga0105247_100539504 151
88 3300009147 Ga0114129_10141619 Ga0114129_101416192 151
89 3300009148 Ga0105243_10014995 Ga0105243_100149952 151
90 3300009176 Ga0105242_10054559 Ga0105242_100545596 151
91 3300009176 Ga0105242_10432258 Ga0105242_104322582 151
92 3300009177 Ga0105248_10035208 Ga0105248_100352086 151
93 3300009177 Ga0105248_10291150 Ga0105248_102911502 151
94 3300009545 Ga0105237_10020791 Ga0105237_100207912 151
95 3300009551 Ga0105238_10373015 Ga0105238_103730152 151
96 3300009551 Ga0105238_11075008 Ga0105238_110750082 151
97 3300009553 Ga0105249_10000681 Ga0105249_1000068122 151
98 3300010375 Ga0105239_10015186 Ga0105239_100151865 151
99 3300011119 Ga0105246_10018607 Ga0105246_100186076 151
100 3300011119 Ga0105246_10235245 Ga0105246_102352452 151
101 3300011119 Ga0105246_10648326 Ga0105246_106483262 151
102 3300013104 Ga0157370_10734678 Ga0157370_107346782 151
103 3300013296 Ga0157374_10128922 Ga0157374_101289223 151
104 3300013306 Ga0163162_10037767 Ga0163162_100377674 151
105 3300013308 Ga0157375_10039284 Ga0157375_100392844 151
106 3300013308 Ga0157375_10081214 Ga0157375_100812145 151
107 3300014325 Ga0163163_11015296 Ga0163163_110152962 151
108 3300014745 Ga0157377_10012642 Ga0157377_100126424 151
109 3300014968 Ga0157379_10100029 Ga0157379_101000292 151
110 3300015261 Ga0182006_1221637 Ga0182006_12216371 151
111 3300017792 Ga0163161_10018850 Ga0163161_100188509 151
112 3300020080 Ga0206350_10394142 Ga0206350_103941422 151
113 3300020082 Ga0206353_10708315 Ga0206353_107083152 151
114 3300025898 Ga0207692_10008402 Ga0207692_100084024 151
115 3300025899 Ga0207642_10019387 Ga0207642_100193874 151
116 3300025900 Ga0207710_10060015 Ga0207710_100600153 151
117 3300025901 Ga0207688_10026672 Ga0207688_100266727 151
118 3300025903 Ga0207680_10020622 Ga0207680_100206226 151
119 3300025905 Ga0207685_10062827 Ga0207685_100628272 151
120 3300025906 Ga0207699_10016790 Ga0207699_100167902 151
121 3300025910 Ga0207684_10044770 Ga0207684_100447707 151
122 3300025915 Ga0207693_10015719 Ga0207693_100157194 151
123 3300025915 Ga0207693_10026600 Ga0207693_100266006 151
124 3300025916 Ga0207663_10013249 Ga0207663_100132492 151
125 3300025916 Ga0207663_10159872 Ga0207663_101598724 151
126 3300025917 Ga0207660_10077408 Ga0207660_100774081 151
127 3300025918 Ga0207662_10048306 Ga0207662_100483062 151
128 3300025921 Ga0207652_10183293 Ga0207652_101832932 151
129 3300025922 Ga0207646_10003525 Ga0207646_1000352518 151
130 3300025925 Ga0207650_11016956 Ga0207650_110169561 151
131 3300025927 Ga0207687_10045878 Ga0207687_100458783 151
132 3300025934 Ga0207686_10026482 Ga0207686_100264823 151
133 3300025934 Ga0207686_10190406 Ga0207686_101904062 151
134 3300025935 Ga0207709_10000823 Ga0207709_100008238 151
135 3300025936 Ga0207670_10004122 Ga0207670_100041224 151
136 3300025936 Ga0207670_10363004 Ga0207670_103630042 151
137 3300025937 Ga0207669_10028357 Ga0207669_100283572 151
138 3300025938 Ga0207704_10003551 Ga0207704_100035515 151
139 3300025939 Ga0207665_10041945 Ga0207665_100419452 151
140 3300025940 Ga0207691_10296727 Ga0207691_102967272 151
141 3300025941 Ga0207711_10026268 Ga0207711_100262685 151
142 3300025941 Ga0207711_10344723 Ga0207711_103447233 151
143 3300025944 Ga0207661_10001998 Ga0207661_1000199816 151
144 3300025944 Ga0207661_10581755 Ga0207661_105817552 151
145 3300025961 Ga0207712_10001535 Ga0207712_1000153516 151
146 3300025972 Ga0207668_10001571 Ga0207668_100015715 151
147 3300026023 Ga0207677_10790570 Ga0207677_107905701 151
148 3300026041 Ga0207639_10042782 Ga0207639_100427826 151
149 3300026067 Ga0207678_10251455 Ga0207678_102514552 151
150 3300026075 Ga0207708_10010501 Ga0207708_100105012 151
151 3300026078 Ga0207702_10065832 Ga0207702_100658324 151
152 3300026089 Ga0207648_10000097 Ga0207648_1000009720 151
153 3300026095 Ga0207676_10266658 Ga0207676_102666582 151
154 3300026121 Ga0207683_10000038 Ga0207683_1000003888 151
155 3300028379 Ga0268266_10091365 Ga0268266_100913652 151
156 3300028380 Ga0268265_10094966 Ga0268265_100949661 151
157 3300031824 Ga0307413_10039275 Ga0307413_100392752 151
158 3300031852 Ga0307410_11517676 Ga0307410_115176761 151
159 3300031901 Ga0307406_10055297 Ga0307406_100552972 151
160 3300032005 Ga0307411_10024445 Ga0307411_100244452 151
161 3300032126 Ga0307415_100017115 Ga0307415_1000171154 151
162 3300035113 Ga0373936_0388656 Ga0373936_0388656_63_527 151
163 3300035725 Ga0373947_0073117 Ga0373947_0073117_778_1242 151
164 3300035725 Ga0373947_0141698 Ga0373947_0141698_307_771 151
165 3300037068 Ga0373925_0109745 Ga0373925_0109745_796_1260 151
166 3300037312 Ga0395899_0012461 Ga0395899_0012461_5877_6341 151
167 3300037312 Ga0395899_0022426 Ga0395899_0022426_2891_3352 151
168 3300037312 Ga0395899_0043610 Ga0395899_0043610_2267_2731 151
169 3300037418 Ga0395900_0001661 Ga0395900_0001661_259_720 151
170 3300037418 Ga0395900_0005716 Ga0395900_0005716_1652_2116 151
171 3300037418 Ga0395900_0026222 Ga0395900_0026222_2643_3107 151
172 3300037418 Ga0395900_0084667 Ga0395900_0084667_1296_1760 151
173 3300037418 Ga0395900_0106543 Ga0395900_0106543_1802_2266 151
174 3300037466 Ga0395898_0004328 Ga0395898_0004328_9310_9771 151
175 3300037466 Ga0395898_0025504 Ga0395898_0025504_2107_2571 151
176 3300037466 Ga0395898_0072722 Ga0395898_0072722_1123_1587 151
177 3300037466 Ga0395898_0140998 Ga0395898_0140998_1044_1508 151
178 3300037466 Ga0395898_0469159 Ga0395898_0469159_189_647 151
179 3300037471 Ga0395905_0003336 Ga0395905_0003336_15415_15876 151
180 3300037471 Ga0395905_0019447 Ga0395905_0019447_3361_3825 151
181 3300037471 Ga0395905_0052189 Ga0395905_0052189_881_1345 151
182 3300037471 Ga0395905_0062176 Ga0395905_0062176_1642_2106 151
183 3300037471 Ga0395905_0181051 Ga0395905_0181051_715_1179 151
184 3300037471 Ga0395905_0305381 Ga0395905_0305381_423_887 151
185 3300038443 Ga0395901_0004995 Ga0395901_0004995_212_676 151
186 3300038443 Ga0395901_0013042 Ga0395901_0013042_3468_3929 151
187 3300038443 Ga0395901_0046765 Ga0395901_0046765_622_1086 151
188 3300038443 Ga0395901_0047097 Ga0395901_0047097_2728_3192 151
189 3300038443 Ga0395901_0368885 Ga0395901_0368885_849_1313 151
190 3300038443 Ga0395901_1067842 Ga0395901_1067842_136_600 151
191 3300041452 Ga0451793_0184281 Ga0451793_0184281_1552_2046 151
192 3300041486 Ga0451807_0422792 Ga0451807_0422792_15_479 151
193 3300041494 Ga0451837_0630977 Ga0451837_0630977_3483_3977 151
194 3300041507 Ga0451851_0168620 Ga0451851_0168620_24_485 151
195 3300044694 Ga0466963_0561411 Ga0466963_0561411_168_626 151
196 3300045976 Ga0466967_0066356 Ga0466967_0066356_2442_2900 151
197 3300045976 Ga0466967_0830639 Ga0466967_0830639_158_616 151
198 3300046473 Ga0495582_0141729 Ga0495582_0141729_751_1215 151
199 3300046474 Ga0495605_0047235 Ga0495605_0047235_1179_1643 151
200 3300046475 Ga0495639_0063801 Ga0495639_0063801_29_493 151
201 3300046491 Ga0495584_0059027 Ga0495584_0059027_1159_1623 151
202 3300046491 Ga0495584_0198873 Ga0495584_0198873_51_515 151
203 3300046491 Ga0495584_0226184 Ga0495584_0226184_156_620 151
204 3300046492 Ga0495585_0230603 Ga0495585_0230603_279_743 151
205 3300046500 Ga0495596_0042160 Ga0495596_0042160_877_1341 151
206 3300046501 Ga0495607_0253021 Ga0495607_0253021_197_661 151
207 3300046517 Ga0495630_0153833 Ga0495630_0153833_1131_1595 151
208 3300046518 Ga0495631_0107917 Ga0495631_0107917_540_1004 151
209 3300046520 Ga0495637_0181445 Ga0495637_0181445_27_491 151
210 3300046523 Ga0495644_0088788 Ga0495644_0088788_344_808 151
211 3300046525 Ga0495663_0032625 Ga0495663_0032625_555_1019 151
212 3300046526 Ga0495666_0152732 Ga0495666_0152732_168_632 151
213 3300046529 Ga0495652_0426054 Ga0495652_0426054_34_495 151
214 3300046538 Ga0495609_0062602 Ga0495609_0062602_370_834 151
215 3300046615 Ga0495656_0084713 Ga0495656_0084713_552_1016 151
216 3300046664 Ga0495659_0028483 Ga0495659_0028483_116_580 151
217 3300046665 Ga0495661_0160590 Ga0495661_0160590_142_606 151
218 3300046674 Ga0495588_0077991 Ga0495588_0077991_49_513 151
219 3300046683 Ga0495658_0137338 Ga0495658_0137338_61_525 151
220 3300046684 Ga0495669_0370449 Ga0495669_0370449_18_482 151
221 3300046690 Ga0495624_0311657 Ga0495624_0311657_403_867 151
222 3300046691 Ga0495670_0489786 Ga0495670_0489786_22_486 151
223 3300046794 Ga0495589_0054689 Ga0495589_0054689_1146_1610 151
224 3300047315 Ga0495581_0099929 Ga0495581_0099929_197_661 151
225 3300047318 Ga0495636_0389521 Ga0495636_0389521_10_474 151
226 3300047321 Ga0495676_0017024 Ga0495676_0017024_1503_1967 151
227 3300047321 Ga0495676_0647141 Ga0495676_0647141_171_635 151
228 3300047323 Ga0495683_0127503 Ga0495683_0127503_358_822 151
229 3300047445 Ga0495677_0067000 Ga0495677_0067000_318_782 151
230 3300048903 Ga0496100_0025684 Ga0496100_0025684_1341_1805 151
231 3300048904 Ga0496101_0039743 Ga0496101_0039743_1637_2101 151
232 3300048904 Ga0496101_0075309 Ga0496101_0075309_324_788 151
233 3300048905 Ga0496102_0170273 Ga0496102_0170273_1201_1665 151
234 3300048905 Ga0496102_1310810 Ga0496102_1310810_114_578 151
235 3300048906 Ga0496103_0002524 Ga0496103_0002524_7169_7633 151
236 3300048906 Ga0496103_0839874 Ga0496103_0839874_51_515 151
237 3300048907 Ga0496104_0018643 Ga0496104_0018643_329_787 151
238 3300048907 Ga0496104_0122252 Ga0496104_0122252_649_1113 151
239 3300048907 Ga0496104_0459018 Ga0496104_0459018_469_933 151
240 3300048908 Ga0496105_0004665 Ga0496105_0004665_3820_4278 151
241 3300048908 Ga0496105_0052739 Ga0496105_0052739_921_1385 151
242 3300048909 Ga0496106_0001818 Ga0496106_0001818_2499_2963 151
243 3300048910 Ga0496107_0000389 Ga0496107_0000389_11246_11710 151
244 3300048911 Ga0496108_0055960 Ga0496108_0055960_41_505 151
245 3300048911 Ga0496108_0075704 Ga0496108_0075704_1450_1914 151
246 3300048912 Ga0496109_0050242 Ga0496109_0050242_3125_3583 151
247 3300048912 Ga0496109_0065498 Ga0496109_0065498_2066_2530 151
248 3300048912 Ga0496109_0170351 Ga0496109_0170351_913_1377 151
249 3300048913 Ga0496110_0067296 Ga0496110_0067296_902_1366 151
250 3300048914 Ga0496111_0091733 Ga0496111_0091733_730_1194 151
251 3300048915 Ga0496112_0085852 Ga0496112_0085852_227_691 151
252 3300048915 Ga0496112_0174562 Ga0496112_0174562_315_773 151
253 3300048915 Ga0496112_0965235 Ga0496112_0965235_68_532 151
254 3300048916 Ga0496113_0171876 Ga0496113_0171876_333_797 151
255 3300048916 Ga0496113_0190448 Ga0496113_0190448_630_1094 151
256 3300048917 Ga0496114_0018856 Ga0496114_0018856_2803_3267 151
257 3300048917 Ga0496114_0399487 Ga0496114_0399487_31_495 151
258 3300048917 Ga0496114_0441732 Ga0496114_0441732_369_833 151
259 3300048918 Ga0496115_0017633 Ga0496115_0017633_2636_3100 151
260 3300049742 Ga0501080_0084696 Ga0501080_0084696_878_1339 151
261 3300050507 nmdc:mga05p37_455627_c1 nmdc:mga05p37_455627_c1_486_950 151
262 3300050510 nmdc:mga06r32_607861_c1 nmdc:mga06r32_607861_c1_173_637 151
263 3300002075 JGI24738J21930_10045478 JGI24738J21930_100454782 152
264 3300005328 Ga0070676_10229085 Ga0070676_102290852 152
265 3300005330 Ga0070690_100422036 Ga0070690_1004220362 152
266 3300005334 Ga0068869_100394738 Ga0068869_1003947381 152
267 3300005335 Ga0070666_10964423 Ga0070666_109644231 152
268 3300005336 Ga0070680_100041033 Ga0070680_1000410332 152
269 3300005338 Ga0068868_100118276 Ga0068868_1001182762 152
270 3300005338 Ga0068868_100226790 Ga0068868_1002267902 152
271 3300005339 Ga0070660_100121303 Ga0070660_1001213033 152
272 3300005340 Ga0070689_100370615 Ga0070689_1003706152 152
273 3300005341 Ga0070691_10103802 Ga0070691_101038022 152
274 3300005345 Ga0070692_10115921 Ga0070692_101159212 152
275 3300005347 Ga0070668_100083638 Ga0070668_1000836382 152
276 3300005347 Ga0070668_100105834 Ga0070668_1001058343 152
277 3300005353 Ga0070669_100237244 Ga0070669_1002372442 152
278 3300005356 Ga0070674_100004454 Ga0070674_1000044541 152
279 3300005356 Ga0070674_100073229 Ga0070674_1000732293 152
280 3300005356 Ga0070674_100143669 Ga0070674_1001436693 152
281 3300005364 Ga0070673_100360266 Ga0070673_1003602662 152
282 3300005364 Ga0070673_101125842 Ga0070673_1011258421 152
283 3300005365 Ga0070688_101559163 Ga0070688_1015591631 152
284 3300005367 Ga0070667_101727423 Ga0070667_1017274231 152
285 3300005406 Ga0070703_10003330 Ga0070703_100033305 152
286 3300005434 Ga0070709_10983293 Ga0070709_109832931 152
287 3300005435 Ga0070714_100043623 Ga0070714_1000436233 152
288 3300005435 Ga0070714_100062239 Ga0070714_1000622393 152
289 3300005437 Ga0070710_10087276 Ga0070710_100872763 152
290 3300005438 Ga0070701_10156909 Ga0070701_101569092 152
291 3300005439 Ga0070711_100049931 Ga0070711_1000499312 152
292 3300005439 Ga0070711_100256668 Ga0070711_1002566682 152
293 3300005440 Ga0070705_100034721 Ga0070705_1000347212 152
294 3300005440 Ga0070705_100050528 Ga0070705_1000505281 152
295 3300005440 Ga0070705_100093044 Ga0070705_1000930441 152
296 3300005440 Ga0070705_100119316 Ga0070705_1001193163 152
297 3300005441 Ga0070700_100034572 Ga0070700_1000345724 152
298 3300005441 Ga0070700_100169157 Ga0070700_1001691572 152
299 3300005444 Ga0070694_100018563 Ga0070694_1000185634 152
300 3300005444 Ga0070694_100018723 Ga0070694_1000187232 152
301 3300005445 Ga0070708_100081904 Ga0070708_1000819042 152
302 3300005445 Ga0070708_100317525 Ga0070708_1003175252 152
303 3300005457 Ga0070662_100051825 Ga0070662_1000518254 152
304 3300005458 Ga0070681_10011124 Ga0070681_100111243 152
305 3300005467 Ga0070706_100235264 Ga0070706_1002352642 152
306 3300005467 Ga0070706_100274519 Ga0070706_1002745191 152
307 3300005467 Ga0070706_100409191 Ga0070706_1004091912 152
308 3300005468 Ga0070707_100007253 Ga0070707_10000725313 152
309 3300005468 Ga0070707_100119191 Ga0070707_1001191914 152
310 3300005468 Ga0070707_101431808 Ga0070707_1014318081 152
311 3300005471 Ga0070698_100052260 Ga0070698_1000522602 152
312 3300005518 Ga0070699_100029006 Ga0070699_1000290063 152
313 3300005518 Ga0070699_101036285 Ga0070699_1010362851 152
314 3300005530 Ga0070679_100241510 Ga0070679_1002415103 152
315 3300005535 Ga0070684_100574792 Ga0070684_1005747921 152
316 3300005539 Ga0068853_100042148 Ga0068853_1000421482 152
317 3300005539 Ga0068853_100287994 Ga0068853_1002879943 152
318 3300005539 Ga0068853_100437892 Ga0068853_1004378922 152
319 3300005543 Ga0070672_100248156 Ga0070672_1002481562 152
320 3300005544 Ga0070686_100070726 Ga0070686_1000707261 152
321 3300005545 Ga0070695_100009953 Ga0070695_1000099535 152
322 3300005545 Ga0070695_100132289 Ga0070695_1001322892 152
323 3300005545 Ga0070695_100233849 Ga0070695_1002338492 152
324 3300005546 Ga0070696_100008980 Ga0070696_1000089802 152
325 3300005546 Ga0070696_101073038 Ga0070696_1010730381 152
326 3300005547 Ga0070693_100028041 Ga0070693_1000280414 152
327 3300005547 Ga0070693_100051595 Ga0070693_1000515953 152
328 3300005549 Ga0070704_100039799 Ga0070704_1000397993 152
329 3300005549 Ga0070704_100077259 Ga0070704_1000772593 152
330 3300005549 Ga0070704_100145511 Ga0070704_1001455112 152
331 3300005578 Ga0068854_100058798 Ga0068854_1000587984 152
332 3300005615 Ga0070702_100001552 Ga0070702_1000015522 152
333 3300005615 Ga0070702_100015668 Ga0070702_1000156681 152
334 3300005615 Ga0070702_100071348 Ga0070702_1000713481 152
335 3300005617 Ga0068859_100155364 Ga0068859_1001553642 152
336 3300005618 Ga0068864_100099597 Ga0068864_1000995973 152
337 3300005718 Ga0068866_10091606 Ga0068866_100916062 152
338 3300005718 Ga0068866_10306999 Ga0068866_103069992 152
339 3300005718 Ga0068866_11040518 Ga0068866_110405182 152
340 3300005719 Ga0068861_100108882 Ga0068861_1001088822 152
341 3300005719 Ga0068861_100235900 Ga0068861_1002359002 152
342 3300005842 Ga0068858_100052385 Ga0068858_1000523852 152
343 3300005842 Ga0068858_100313295 Ga0068858_1003132953 152
344 3300005843 Ga0068860_100190503 Ga0068860_1001905033 152
345 3300005844 Ga0068862_100211695 Ga0068862_1002116952 152
346 3300005981 Ga0081538_10019400 Ga0081538_100194003 152
347 3300005981 Ga0081538_10060176 Ga0081538_100601763 152
348 3300005983 Ga0081540_1002420 Ga0081540_100242014 152
349 3300005985 Ga0081539_10037946 Ga0081539_100379463 152
350 3300006175 Ga0070712_100002885 Ga0070712_1000028859 152
351 3300006237 Ga0097621_100314158 Ga0097621_1003141582 152
352 3300006871 Ga0075434_100211706 Ga0075434_1002117063 152
353 3300006914 Ga0075436_100464899 Ga0075436_1004648992 152
354 3300006931 Ga0097620_100155362 Ga0097620_1001553622 152
355 3300007076 Ga0075435_100012673 Ga0075435_1000126734 152
356 3300007076 Ga0075435_100117412 Ga0075435_1001174123 152
357 3300009092 Ga0105250_10061532 Ga0105250_100615322 152
358 3300009098 Ga0105245_10045513 Ga0105245_100455133 152
359 3300009098 Ga0105245_10068781 Ga0105245_100687813 152
360 3300009098 Ga0105245_10209227 Ga0105245_102092272 152
361 3300009098 Ga0105245_10426569 Ga0105245_104265692 152
362 3300009098 Ga0105245_11142114 Ga0105245_111421142 152
363 3300009101 Ga0105247_10228655 Ga0105247_102286552 152
364 3300009147 Ga0114129_10119515 Ga0114129_101195153 152
365 3300009148 Ga0105243_10083842 Ga0105243_100838422 152
366 3300009148 Ga0105243_10125712 Ga0105243_101257122 152
367 3300009148 Ga0105243_10315303 Ga0105243_103153032 152
368 3300009176 Ga0105242_10073289 Ga0105242_100732894 152
369 3300009176 Ga0105242_10290667 Ga0105242_102906672 152
370 3300009177 Ga0105248_10474976 Ga0105248_104749762 152
371 3300009177 Ga0105248_10534168 Ga0105248_105341682 152
372 3300009553 Ga0105249_10003025 Ga0105249_100030255 152
373 3300009553 Ga0105249_10137439 Ga0105249_101374392 152
374 3300010375 Ga0105239_10040817 Ga0105239_100408175 152
375 3300010375 Ga0105239_10267233 Ga0105239_102672332 152
376 3300010375 Ga0105239_10574081 Ga0105239_105740812 152
377 3300010375 Ga0105239_11239073 Ga0105239_112390731 152
378 3300011119 Ga0105246_10116830 Ga0105246_101168302 152
379 3300012473 Ga0157340_1014888 Ga0157340_10148881 152
380 3300012480 Ga0157346_1019523 Ga0157346_10195231 152
381 3300012495 Ga0157323_1005420 Ga0157323_10054202 152
382 3300013104 Ga0157370_11284123 Ga0157370_112841231 152
383 3300013105 Ga0157369_10425098 Ga0157369_104250983 152
384 3300013105 Ga0157369_10618170 Ga0157369_106181702 152
385 3300013297 Ga0157378_10573757 Ga0157378_105737572 152
386 3300013297 Ga0157378_10589535 Ga0157378_105895352 152
387 3300013297 Ga0157378_10773746 Ga0157378_107737462 152
388 3300013306 Ga0163162_10021273 Ga0163162_100212734 152
389 3300013306 Ga0163162_10236358 Ga0163162_102363583 152
390 3300013307 Ga0157372_10326715 Ga0157372_103267153 152
391 3300013308 Ga0157375_10110329 Ga0157375_101103292 152
392 3300014325 Ga0163163_10063106 Ga0163163_100631063 152
393 3300014326 Ga0157380_10382078 Ga0157380_103820782 152
394 3300014326 Ga0157380_10992272 Ga0157380_109922722 152
395 3300014497 Ga0182008_10127695 Ga0182008_101276951 152
396 3300014745 Ga0157377_10025935 Ga0157377_100259352 152
397 3300014745 Ga0157377_10044924 Ga0157377_100449243 152
398 3300014969 Ga0157376_10613019 Ga0157376_106130192 152
399 3300015261 Ga0182006_1232102 Ga0182006_12321022 152
400 3300015262 Ga0182007_10030115 Ga0182007_100301153 152
401 3300020070 Ga0206356_11642986 Ga0206356_116429861 152
402 3300020082 Ga0206353_12030080 Ga0206353_120300806 152
403 3300025898 Ga0207692_10346127 Ga0207692_103461272 152
404 3300025900 Ga0207710_10043800 Ga0207710_100438002 152
405 3300025900 Ga0207710_10106421 Ga0207710_101064211 152
406 3300025901 Ga0207688_10011869 Ga0207688_100118692 152
407 3300025906 Ga0207699_10812044 Ga0207699_108120442 152
408 3300025907 Ga0207645_10008858 Ga0207645_100088582 152
409 3300025910 Ga0207684_10475803 Ga0207684_104758032 152
410 3300025912 Ga0207707_10012654 Ga0207707_100126546 152
411 3300025913 Ga0207695_10737638 Ga0207695_107376381 152
412 3300025914 Ga0207671_10814953 Ga0207671_108149531 152
413 3300025916 Ga0207663_11274383 Ga0207663_112743831 152
414 3300025918 Ga0207662_10056980 Ga0207662_100569802 152
415 3300025919 Ga0207657_10223630 Ga0207657_102236303 152
416 3300025920 Ga0207649_10637080 Ga0207649_106370802 152
417 3300025921 Ga0207652_10061109 Ga0207652_100611094 152
418 3300025922 Ga0207646_10005850 Ga0207646_1000585015 152
419 3300025922 Ga0207646_10076566 Ga0207646_100765666 152
420 3300025923 Ga0207681_10279969 Ga0207681_102799692 152
421 3300025924 Ga0207694_10721796 Ga0207694_107217962 152
422 3300025926 Ga0207659_11925323 Ga0207659_119253231 152
423 3300025927 Ga0207687_10040312 Ga0207687_100403124 152
424 3300025927 Ga0207687_10195103 Ga0207687_101951032 152
425 3300025927 Ga0207687_10239978 Ga0207687_102399783 152
426 3300025929 Ga0207664_10029121 Ga0207664_100291214 152
427 3300025929 Ga0207664_11402195 Ga0207664_114021951 152
428 3300025932 Ga0207690_10125225 Ga0207690_101252253 152
429 3300025933 Ga0207706_10006238 Ga0207706_100062386 152
430 3300025933 Ga0207706_10018859 Ga0207706_100188596 152
431 3300025934 Ga0207686_10301968 Ga0207686_103019682 152
432 3300025935 Ga0207709_10024643 Ga0207709_100246433 152
433 3300025935 Ga0207709_10055694 Ga0207709_100556942 152
434 3300025937 Ga0207669_10093582 Ga0207669_100935824 152
435 3300025937 Ga0207669_10112375 Ga0207669_101123753 152
436 3300025938 Ga0207704_11148046 Ga0207704_111480461 152
437 3300025939 Ga0207665_10409793 Ga0207665_104097932 152
438 3300025940 Ga0207691_10396458 Ga0207691_103964582 152
439 3300025941 Ga0207711_10349892 Ga0207711_103498922 152
440 3300025941 Ga0207711_10562889 Ga0207711_105628892 152
441 3300025961 Ga0207712_10006034 Ga0207712_100060347 152
442 3300025972 Ga0207668_10032218 Ga0207668_100322184 152
443 3300025972 Ga0207668_10328534 Ga0207668_103285341 152
444 3300025981 Ga0207640_10316622 Ga0207640_103166222 152
445 3300026023 Ga0207677_10197016 Ga0207677_101970162 152
446 3300026023 Ga0207677_10355351 Ga0207677_103553512 152
447 3300026023 Ga0207677_11701104 Ga0207677_117011041 152
448 3300026023 Ga0207677_11719793 Ga0207677_117197931 152
449 3300026035 Ga0207703_10034712 Ga0207703_100347122 152
450 3300026035 Ga0207703_10150195 Ga0207703_101501952 152
451 3300026041 Ga0207639_10563307 Ga0207639_105633072 152
452 3300026075 Ga0207708_10005998 Ga0207708_100059989 152
453 3300026075 Ga0207708_10060071 Ga0207708_100600712 152
454 3300026075 Ga0207708_10173934 Ga0207708_101739342 152
455 3300026089 Ga0207648_10028628 Ga0207648_100286287 152
456 3300026089 Ga0207648_10078870 Ga0207648_100788704 152
457 3300026095 Ga0207676_10026117 Ga0207676_100261172 152
458 3300026095 Ga0207676_10365294 Ga0207676_103652942 152
459 3300026118 Ga0207675_100001912 Ga0207675_1000019128 152
460 3300026118 Ga0207675_100178849 Ga0207675_1001788492 152
461 3300026118 Ga0207675_100207451 Ga0207675_1002074513 152
462 3300026118 Ga0207675_100265613 Ga0207675_1002656133 152
463 3300026142 Ga0207698_10095551 Ga0207698_100955512 152
464 3300027907 Ga0207428_10002883 Ga0207428_100028836 152
465 3300028380 Ga0268265_10319433 Ga0268265_103194332 152
466 3300028380 Ga0268265_10520187 Ga0268265_105201872 152
467 3300028381 Ga0268264_11576849 Ga0268264_115768491 152
468 3300028563 Ga0265319_1004631 Ga0265319_100463111 152
469 3300028573 Ga0265334_10118695 Ga0265334_101186952 152
470 3300028654 Ga0265322_10012031 Ga0265322_100120312 152
471 3300028666 Ga0265336_10025764 Ga0265336_100257642 152
472 3300028800 Ga0265338_10098477 Ga0265338_100984773 152
473 3300031238 Ga0265332_10000830 Ga0265332_100008304 152
474 3300031240 Ga0265320_10038881 Ga0265320_100388812 152
475 3300031242 Ga0265329_10030443 Ga0265329_100304432 152
476 3300031249 Ga0265339_10002754 Ga0265339_1000275413 152
477 3300031250 Ga0265331_10157106 Ga0265331_101571061 152
478 3300031711 Ga0265314_10039431 Ga0265314_100394312 152
479 3300031824 Ga0307413_10305559 Ga0307413_103055592 152
480 3300031824 Ga0307413_10970779 Ga0307413_109707791 152
481 3300031995 Ga0307409_100106705 Ga0307409_1001067051 152
482 3300032002 Ga0307416_100373303 Ga0307416_1003733032 152
483 3300032002 Ga0307416_102131483 Ga0307416_1021314832 152
484 3300032002 Ga0307416_102552427 Ga0307416_1025524271 152
485 3300032005 Ga0307411_10129185 Ga0307411_101291852 152
486 3300034816 Ga0373930_0006042 Ga0373930_0006042_324_782 152
487 3300034817 Ga0373948_0019024 Ga0373948_0019024_640_1098 152
488 3300034820 Ga0373959_0214727 Ga0373959_0214727_16_477 152
489 3300034957 Ga0373938_0229262 Ga0373938_0229262_47_508 152
490 3300035085 Ga0373929_0037821 Ga0373929_0037821_85_543 152
491 3300035089 Ga0373944_0272644 Ga0373944_0272644_10_471 152
492 3300035090 Ga0373949_0003557 Ga0373949_0003557_672_1130 152
493 3300035091 Ga0373951_0001825 Ga0373951_0001825_3852_4310 152
494 3300035092 Ga0373952_0006760 Ga0373952_0006760_783_1241 152
495 3300035112 Ga0373932_0008867 Ga0373932_0008867_406_864 152
496 3300035114 Ga0373939_0017759 Ga0373939_0017759_249_707 152
497 3300035115 Ga0373941_0001105 Ga0373941_0001105_1802_2260 152
498 3300035170 Ga0373943_0487315 Ga0373943_0487315_110_571 152
499 3300035171 Ga0373946_0011487 Ga0373946_0011487_1540_2001 152
500 3300035207 Ga0373942_0054474 Ga0373942_0054474_278_736 152
501 3300035242 Ga0373962_0002255 Ga0373962_0002255_4081_4539 152
502 3300035398 Ga0316574_0015191 Ga0316574_0015191_999_1457 152
503 3300035691 Ga0373931_0015842 Ga0373931_0015842_2135_2593 152
504 3300035725 Ga0373947_0046859 Ga0373947_0046859_1930_2391 152
505 3300036401 Ga0373937_0005831 Ga0373937_0005831_7122_7580 152
506 3300037312 Ga0395899_0007102 Ga0395899_0007102_3934_4395 152
507 3300037312 Ga0395899_0036492 Ga0395899_0036492_385_843 152
508 3300037312 Ga0395899_0553088 Ga0395899_0553088_37_498 152
509 3300037418 Ga0395900_0016989 Ga0395900_0016989_6907_7365 152
510 3300037418 Ga0395900_0019506 Ga0395900_0019506_1138_1605 152
511 3300037418 Ga0395900_0023789 Ga0395900_0023789_3136_3597 152
512 3300037418 Ga0395900_0072861 Ga0395900_0072861_2764_3222 152
513 3300037418 Ga0395900_0142244 Ga0395900_0142244_1733_2200 152
514 3300037418 Ga0395900_0182653 Ga0395900_0182653_1653_2114 152
515 3300037418 Ga0395900_0392784 Ga0395900_0392784_782_1240 152
516 3300037466 Ga0395898_0003643 Ga0395898_0003643_8331_8789 152
517 3300037466 Ga0395898_0006068 Ga0395898_0006068_9486_9947 152
518 3300037466 Ga0395898_0031445 Ga0395898_0031445_291_758 152
519 3300037466 Ga0395898_0990406 Ga0395898_0990406_292_753 152
520 3300037471 Ga0395905_0008963 Ga0395905_0008963_7175_7633 152
521 3300037471 Ga0395905_0014334 Ga0395905_0014334_969_1427 152
522 3300037471 Ga0395905_0154775 Ga0395905_0154775_1468_1935 152
523 3300037471 Ga0395905_0397142 Ga0395905_0397142_684_1142 152
524 3300037471 Ga0395905_0585997 Ga0395905_0585997_337_798 152
525 3300038443 Ga0395901_0000956 Ga0395901_0000956_16760_17227 152
526 3300038443 Ga0395901_0070904 Ga0395901_0070904_3025_3486 152
527 3300038443 Ga0395901_0162730 Ga0395901_0162730_1359_1820 152
528 3300038443 Ga0395901_0174570 Ga0395901_0174570_970_1428 152
529 3300038443 Ga0395901_0524070 Ga0395901_0524070_153_611 152
530 3300038443 Ga0395901_0539897 Ga0395901_0539897_178_636 152
531 3300038443 Ga0395901_0550367 Ga0395901_0550367_23_481 152
532 3300038699 Ga0242422_09518 Ga0242422_09518_12_473 152
533 3300038996 Ga0242420_068899 Ga0242420_068899_126_587 152
534 3300039437 Ga0436365_0209504 Ga0436365_0209504_181_639 152
535 3300039450 Ga0436363_1175972 Ga0436363_1175972_24_485 152
536 3300042000 Ga0439437_021989 Ga0439437_021989_193_654 152
537 3300042005 Ga0439448_0007952 Ga0439448_0007952_1052_1513 152
538 3300042146 Ga0450907_004419 Ga0450907_004419_1738_2196 152
539 3300044694 Ga0466963_0008599 Ga0466963_0008599_4268_4726 152
540 3300044694 Ga0466963_0294336 Ga0466963_0294336_212_670 152
541 3300044719 Ga0466971_0012510 Ga0466971_0012510_2827_3285 152
542 3300044842 Ga0466957_0012714 Ga0466957_0012714_1730_2188 152
543 3300044842 Ga0466957_0013907 Ga0466957_0013907_2381_2839 152
544 3300044901 Ga0466960_0028499 Ga0466960_0028499_1488_1946 152
545 3300044901 Ga0466960_0048693 Ga0466960_0048693_457_915 152
546 3300045051 Ga0451576_0021703 Ga0451576_0021703_5130_5588 152
547 3300045836 Ga0466958_0069980 Ga0466958_0069980_1556_2014 152
548 3300045836 Ga0466958_1033685 Ga0466958_1033685_22_483 152
549 3300045976 Ga0466967_0001385 Ga0466967_0001385_9646_10104 152
550 3300045976 Ga0466967_0031189 Ga0466967_0031189_2102_2560 152
551 3300045976 Ga0466967_0829781 Ga0466967_0829781_448_906 152
552 3300046455 Ga0495603_0000394 Ga0495603_0000394_21443_21904 152
553 3300046455 Ga0495603_0082422 Ga0495603_0082422_769_1227 152
554 3300046461 Ga0495641_0005687 Ga0495641_0005687_1655_2116 152
555 3300046461 Ga0495641_0034890 Ga0495641_0034890_1071_1529 152
556 3300046463 Ga0495653_0556184 Ga0495653_0556184_114_572 152
557 3300046472 Ga0495580_0294289 Ga0495580_0294289_495_956 152
558 3300046473 Ga0495582_0345785 Ga0495582_0345785_106_567 152
559 3300046474 Ga0495605_0229456 Ga0495605_0229456_263_721 152
560 3300046499 Ga0495594_0000597 Ga0495594_0000597_15925_16386 152
561 3300046500 Ga0495596_0148737 Ga0495596_0148737_219_680 152
562 3300046518 Ga0495631_0170337 Ga0495631_0170337_421_882 152
563 3300046526 Ga0495666_0159231 Ga0495666_0159231_414_875 152
564 3300046531 Ga0495665_0097452 Ga0495665_0097452_206_664 152
565 3300046531 Ga0495665_0421653 Ga0495665_0421653_32_517 152
566 3300046533 Ga0495640_0284474 Ga0495640_0284474_177_662 152
567 3300046557 Ga0495622_0090480 Ga0495622_0090480_740_1201 152
568 3300046559 Ga0495667_0084055 Ga0495667_0084055_585_1043 152
569 3300046615 Ga0495656_0350189 Ga0495656_0350189_160_630 152
570 3300046642 Ga0495634_0732201 Ga0495634_0732201_79_537 152
571 3300046648 Ga0495611_0535936 Ga0495611_0535936_18_479 152
572 3300046674 Ga0495588_0000483 Ga0495588_0000483_4120_4581 152
573 3300046681 Ga0495647_0038652 Ga0495647_0038652_282_743 152
574 3300046681 Ga0495647_0348723 Ga0495647_0348723_104_565 152
575 3300046683 Ga0495658_0386356 Ga0495658_0386356_266_724 152
576 3300046691 Ga0495670_0276311 Ga0495670_0276311_202_660 152
577 3300046692 Ga0495671_0570904 Ga0495671_0570904_62_520 152
578 3300047315 Ga0495581_0093423 Ga0495581_0093423_614_1075 152
579 3300047319 Ga0495674_0245018 Ga0495674_0245018_284_769 152
580 3300047321 Ga0495676_0010528 Ga0495676_0010528_648_1109 152
581 3300047321 Ga0495676_0046204 Ga0495676_0046204_1943_2404 152
582 3300048089 Ga0495614_0417762 Ga0495614_0417762_39_497 152
583 3300048090 Ga0495615_0135201 Ga0495615_0135201_20_478 152
584 3300048903 Ga0496100_0413035 Ga0496100_0413035_192_650 152
585 3300048903 Ga0496100_0877137 Ga0496100_0877137_86_547 152
586 3300048904 Ga0496101_0035677 Ga0496101_0035677_1320_1781 152
587 3300048904 Ga0496101_0290977 Ga0496101_0290977_42_500 152
588 3300048904 Ga0496101_0437689 Ga0496101_0437689_102_563 152
589 3300048905 Ga0496102_0046636 Ga0496102_0046636_2725_3183 152
590 3300048905 Ga0496102_0070848 Ga0496102_0070848_1637_2098 152
591 3300048905 Ga0496102_0122382 Ga0496102_0122382_407_865 152
592 3300048905 Ga0496102_0197236 Ga0496102_0197236_112_594 152
593 3300048905 Ga0496102_0312581 Ga0496102_0312581_675_1133 152
594 3300048905 Ga0496102_0696783 Ga0496102_0696783_223_681 152
595 3300048905 Ga0496102_1521808 Ga0496102_1521808_21_479 152
596 3300048906 Ga0496103_0079911 Ga0496103_0079911_1399_1857 152
597 3300048907 Ga0496104_0000003 Ga0496104_0000003_493673_494131 152
598 3300048907 Ga0496104_0000432 Ga0496104_0000432_14197_14658 152
599 3300048907 Ga0496104_0018678 Ga0496104_0018678_1982_2440 152
600 3300048907 Ga0496104_1198745 Ga0496104_1198745_187_645 152
601 3300048908 Ga0496105_0000003 Ga0496105_0000003_691990_692448 152
602 3300048908 Ga0496105_0000348 Ga0496105_0000348_25922_26383 152
603 3300048908 Ga0496105_0027494 Ga0496105_0027494_654_1112 152
604 3300048908 Ga0496105_0135018 Ga0496105_0135018_471_938 152
605 3300048909 Ga0496106_0026958 Ga0496106_0026958_162_620 152
606 3300048909 Ga0496106_0296337 Ga0496106_0296337_72_530 152
607 3300048910 Ga0496107_0007441 Ga0496107_0007441_3713_4171 152
608 3300048910 Ga0496107_0042096 Ga0496107_0042096_1485_1946 152
609 3300048910 Ga0496107_1177120 Ga0496107_1177120_34_492 152
610 3300048911 Ga0496108_0005047 Ga0496108_0005047_2654_3115 152
611 3300048911 Ga0496108_0022292 Ga0496108_0022292_1188_1646 152
612 3300048911 Ga0496108_0714008 Ga0496108_0714008_72_530 152
613 3300048912 Ga0496109_0037547 Ga0496109_0037547_2539_2997 152
614 3300048912 Ga0496109_0180199 Ga0496109_0180199_1383_1841 152
615 3300048912 Ga0496109_0297769 Ga0496109_0297769_993_1460 152
616 3300048912 Ga0496109_0356725 Ga0496109_0356725_441_908 152
617 3300048913 Ga0496110_0000944 Ga0496110_0000944_16057_16518 152
618 3300048913 Ga0496110_0111139 Ga0496110_0111139_1962_2420 152
619 3300048913 Ga0496110_0309694 Ga0496110_0309694_198_656 152
620 3300048913 Ga0496110_0382812 Ga0496110_0382812_360_818 152
621 3300048913 Ga0496110_1034925 Ga0496110_1034925_126_584 152
622 3300048914 Ga0496111_0000045 Ga0496111_0000045_39607_40068 152
623 3300048914 Ga0496111_0516167 Ga0496111_0516167_349_816 152
624 3300048915 Ga0496112_0014277 Ga0496112_0014277_208_669 152
625 3300048915 Ga0496112_0836085 Ga0496112_0836085_225_683 152
626 3300048915 Ga0496112_0894273 Ga0496112_0894273_72_533 152
627 3300048916 Ga0496113_0000076 Ga0496113_0000076_40062_40523 152
628 3300048917 Ga0496114_0028495 Ga0496114_0028495_3343_3801 152
629 3300048917 Ga0496114_0041150 Ga0496114_0041150_1952_2413 152
630 3300048918 Ga0496115_0008731 Ga0496115_0008731_1805_2263 152
631 3300048925 Ga0496122_0205098 Ga0496122_0205098_281_739 152
632 3300048929 Ga0496126_0014963 Ga0496126_0014963_5649_6107 152
633 3300049569 Ga0501032_0106529 Ga0501032_0106529_415_873 152
634 3300049574 Ga0501038_1336247 Ga0501038_1336247_40_498 152
635 3300049578 Ga0501042_0378920 Ga0501042_0378920_527_985 152
636 3300049579 Ga0501043_0041324 Ga0501043_0041324_1744_2202 152
637 3300049580 Ga0501046_0102715 Ga0501046_0102715_713_1171 152
638 3300049581 Ga0501047_0237422 Ga0501047_0237422_402_860 152
639 3300049583 Ga0501067_0009040 Ga0501067_0009040_1442_1900 152
640 3300049583 Ga0501067_0022007 Ga0501067_0022007_697_1155 152
641 3300049583 Ga0501067_0101540 Ga0501067_0101540_748_1206 152
642 3300049584 Ga0501068_0182180 Ga0501068_0182180_717_1175 152
643 3300049585 Ga0501069_0009379 Ga0501069_0009379_2866_3324 152
644 3300049585 Ga0501069_0032720 Ga0501069_0032720_1161_1619 152
645 3300049585 Ga0501069_0041169 Ga0501069_0041169_1343_1804 152
646 3300049585 Ga0501069_0060706 Ga0501069_0060706_788_1246 152
647 3300049585 Ga0501069_0179267 Ga0501069_0179267_677_1135 152
648 3300049586 Ga0501070_0010946 Ga0501070_0010946_2716_3174 152
649 3300049588 Ga0501072_0319992 Ga0501072_0319992_299_757 152
650 3300049588 Ga0501072_0873341 Ga0501072_0873341_31_498 152
651 3300049589 Ga0501073_0067037 Ga0501073_0067037_766_1224 152
652 3300049590 Ga0501074_0026101 Ga0501074_0026101_3062_3520 152
653 3300049741 Ga0501079_0005310 Ga0501079_0005310_1473_1931 152
654 3300049742 Ga0501080_0001819 Ga0501080_0001819_4796_5254 152
655 3300049742 Ga0501080_0118671 Ga0501080_0118671_640_1098 152
656 3300049744 Ga0501083_0016753 Ga0501083_0016753_2680_3138 152
657 3300049744 Ga0501083_0426098 Ga0501083_0426098_355_813 152
658 3300049823 Ga0501044_0055236 Ga0501044_0055236_1537_1995 152
659 3300049824 Ga0501045_0129363 Ga0501045_0129363_883_1341 152
660 3300050507 nmdc:mga05p37_304803_c1 nmdc:mga05p37_304803_c1_785_1243 152
661 3300050507 nmdc:mga05p37_758028_c1 nmdc:mga05p37_758028_c1_569_1030 152
662 3300050510 nmdc:mga06r32_59004_c1 nmdc:mga06r32_59004_c1_3125_3586 152
663 3300050511 nmdc:mga08y16_20136_c1 nmdc:mga08y16_20136_c1_1912_2373 152
664 3300050512 nmdc:mga0n895_5243_c1 nmdc:mga0n895_5243_c1_2899_3360 152
665 3300050513 nmdc:mga0rr50_294503_c1 nmdc:mga0rr50_294503_c1_24_482 152
666 3300050513 nmdc:mga0rr50_62604_c1 nmdc:mga0rr50_62604_c1_1859_2320 152
667 3300050514 nmdc:mga08x19_29306_c1 nmdc:mga08x19_29306_c1_512_973 152
668 3300050514 nmdc:mga08x19_77019_c1 nmdc:mga08x19_77019_c1_1169_1627 152
669 3300050515 nmdc:mga0a205_174868_c1 nmdc:mga0a205_174868_c1_900_1358 152
670 3300050515 nmdc:mga0a205_46736_c1 nmdc:mga0a205_46736_c1_3237_3698 152
671 3300053077 Ga0495601_0026997 Ga0495601_0026997_2712_3197 152
672 3300053078 Ga0495612_0532307 Ga0495612_0532307_24_509 152
673 3300053084 Ga0495595_0394799 Ga0495595_0394799_22_507 152
674 3300059490 Ga0587066_142228 Ga0587066_142228_46_507 152
675 3300061719 Ga0466962_0010804 Ga0466962_0010804_2261_2719 152
676 3300061734 Ga0530510_0087539 Ga0530510_0087539_895_1353 152
677 3300061734 Ga0530510_0194326 Ga0530510_0194326_176_634 152
678 3300061734 Ga0530510_1041787 Ga0530510_1041787_89_547 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

4

161

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l6z-assembly2.cif.gz_B crystal structure of peptidyl-prolyl cis-trans isomerasefrom (ppib) streptococcus pneumoniae r6 0.9414 2 150
1xyh-assembly1.cif.gz_A crystal structure of recombinant human cyclophilin j 0.9377 3 152
2fu0-assembly1.cif.gz_A plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain 0.936 3 149
7abi-assembly1.cif.gz_t human pre-bact-2 spliceosome 0.9358 3 149
1zkc-assembly2.cif.gz_B crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b 0.9351 2 150
ID Description Score Start End Superfamily
af_I1MI74_1_173_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9438 3 149 2.40.100.10
af_Q9FJX0_326_510_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9434 2 151 2.40.100.10
af_Q2FZU9_3_197_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9385 2 152 2.40.100.10
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9377 3 152 2.40.100.10
af_P52012_262_474_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9372 2 151 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A7W0Z7N9-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9658 1 151 GO:0003755
GO:0006457
AF-A0A1G2PES9-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9641 2 151 GO:0006457
GO:0140839
GO:0140840
AF-A0A1F4USQ5-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9639 2 151 GO:0006457
GO:0140839
GO:0140840
AF-K2FXM5-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9633 2 151 GO:0006457
GO:0140839
GO:0140840
AF-A0A0G0TD74-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9628 2 152 GO:0006457
GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
90.74 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map