F474665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 327 | 678 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300041494|Ga0451837_0630977|Ga0451837_0630977_3483_3977 |
| Length | 164 |
| Sequence | MAISATLATNRGDIIIELFPDHAPKTVDNFVDLAEGTKGPSGKPFYDGLTFHRVIDGFMIQGGCPEGTGTGGPGYTFEDEFHPDLQFDRPYLLAMANAGPGTNGSQFFITAGPADWLNRRHTIFGEVKDAASRAVVDEIGTTATGPGDRPVDPVVIDQVTITRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 94 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 95 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 216 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.44 |
| Nodule | 0 |
| Rhizoplane | 11.65 |
| Rhizosphere | 87.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10045478 | 3300002075 | Bacteria | 893 |
| 2 | JGI24742J22300_10009173 | 3300002244 | Bacteria | 1631 |
| 3 | Ga0070676_10229085 | 3300005328 | Bacteria | 1231 |
| 4 | Ga0070690_100015622 | 3300005330 | Bacteria | 4534 |
| 5 | Ga0070690_100422036 | 3300005330 | Bacteria | 983 |
| 6 | Ga0068869_100394738 | 3300005334 | Bacteria | 1136 |
| 7 | Ga0070666_10036962 | 3300005335 | Bacteria | 3245 |
| 8 | Ga0070666_10964423 | 3300005335 | Bacteria | 632 |
| 9 | Ga0070680_100041033 | 3300005336 | Bacteria | 3752 |
| 10 | Ga0070680_100553936 | 3300005336 | Bacteria | 986 |
| 11 | Ga0070682_100003314 | 3300005337 | Bacteria | 8928 |
| 12 | Ga0070682_100462031 | 3300005337 | Bacteria | 975 |
| 13 | Ga0068868_100118276 | 3300005338 | Bacteria | 2160 |
| 14 | Ga0068868_100226790 | 3300005338 | Bacteria | 1566 |
| 15 | Ga0068868_100787376 | 3300005338 | Bacteria | 857 |
| 16 | Ga0070660_100121303 | 3300005339 | Bacteria | 2086 |
| 17 | Ga0070689_100005870 | 3300005340 | Bacteria | 8436 |
| 18 | Ga0070689_100370615 | 3300005340 | Bacteria | 1205 |
| 19 | Ga0070691_10103802 | 3300005341 | Bacteria | 1414 |
| 20 | Ga0070687_100039689 | 3300005343 | Bacteria | 2367 |
| 21 | Ga0070692_10000439 | 3300005345 | Bacteria | 12673 |
| 22 | Ga0070692_10115921 | 3300005345 | Bacteria | 1488 |
| 23 | Ga0070668_100018041 | 3300005347 | Bacteria | 5294 |
| 24 | Ga0070668_100083638 | 3300005347 | Bacteria | 2505 |
| 25 | Ga0070668_100105834 | 3300005347 | Bacteria | 2235 |
| 26 | Ga0070669_100237244 | 3300005353 | Bacteria | 1447 |
| 27 | Ga0070675_100275415 | 3300005354 | Bacteria | 1478 |
| 28 | Ga0070675_100409400 | 3300005354 | Bacteria | 1211 |
| 29 | Ga0070674_100002226 | 3300005356 | Bacteria | 10669 |
| 30 | Ga0070674_100004454 | 3300005356 | Bacteria | 7992 |
| 31 | Ga0070674_100073229 | 3300005356 | Bacteria | 2428 |
| 32 | Ga0070674_100143669 | 3300005356 | Bacteria | 1794 |
| 33 | Ga0070673_100016796 | 3300005364 | Bacteria | 5186 |
| 34 | Ga0070673_100360266 | 3300005364 | Bacteria | 1293 |
| 35 | Ga0070673_101125842 | 3300005364 | Bacteria | 734 |
| 36 | Ga0070688_100024686 | 3300005365 | Bacteria | 3551 |
| 37 | Ga0070688_101559163 | 3300005365 | Bacteria | 539 |
| 38 | Ga0070659_100065382 | 3300005366 | Bacteria | 2880 |
| 39 | Ga0070667_101727423 | 3300005367 | Bacteria | 589 |
| 40 | Ga0070703_10003330 | 3300005406 | Bacteria | 4584 |
| 41 | Ga0070703_10111078 | 3300005406 | Bacteria | 981 |
| 42 | Ga0070709_10007555 | 3300005434 | Bacteria | 5966 |
| 43 | Ga0070709_10983293 | 3300005434 | Bacteria | 671 |
| 44 | Ga0070714_100043623 | 3300005435 | Bacteria | 3794 |
| 45 | Ga0070714_100062239 | 3300005435 | Bacteria | 3207 |
| 46 | Ga0070714_100076035 | 3300005435 | Bacteria | 2914 |
| 47 | Ga0070713_100069633 | 3300005436 | Bacteria | 2967 |
| 48 | Ga0070713_100255590 | 3300005436 | Bacteria | 1600 |
| 49 | Ga0070710_10009273 | 3300005437 | Bacteria | 4809 |
| 50 | Ga0070710_10087276 | 3300005437 | Bacteria | 1833 |
| 51 | Ga0070701_10032276 | 3300005438 | Bacteria | 2606 |
| 52 | Ga0070701_10156909 | 3300005438 | Bacteria | 1315 |
| 53 | Ga0070711_100012825 | 3300005439 | Bacteria | 5248 |
| 54 | Ga0070711_100049931 | 3300005439 | Bacteria | 2866 |
| 55 | Ga0070711_100256668 | 3300005439 | Bacteria | 1373 |
| 56 | Ga0070705_100034721 | 3300005440 | Bacteria | 2821 |
| 57 | Ga0070705_100050528 | 3300005440 | Bacteria | 2419 |
| 58 | Ga0070705_100093044 | 3300005440 | Bacteria | 1883 |
| 59 | Ga0070705_100119316 | 3300005440 | Bacteria | 1700 |
| 60 | Ga0070700_100005568 | 3300005441 | Bacteria | 6676 |
| 61 | Ga0070700_100034572 | 3300005441 | Bacteria | 3053 |
| 62 | Ga0070700_100169157 | 3300005441 | Bacteria | 1512 |
| 63 | Ga0070694_100018563 | 3300005444 | Bacteria | 4415 |
| 64 | Ga0070694_100018723 | 3300005444 | Bacteria | 4398 |
| 65 | Ga0070694_100179067 | 3300005444 | Bacteria | 1567 |
| 66 | Ga0070694_101028327 | 3300005444 | Bacteria | 685 |
| 67 | Ga0070708_100081904 | 3300005445 | Bacteria | 2923 |
| 68 | Ga0070708_100082457 | 3300005445 | Bacteria | 2913 |
| 69 | Ga0070708_100317525 | 3300005445 | Bacteria | 1467 |
| 70 | Ga0070708_100447592 | 3300005445 | Bacteria | 1218 |
| 71 | Ga0070663_100012552 | 3300005455 | Bacteria | 5364 |
| 72 | Ga0070663_100356863 | 3300005455 | Bacteria | 1185 |
| 73 | Ga0070678_100038757 | 3300005456 | Bacteria | 3357 |
| 74 | Ga0070662_100051825 | 3300005457 | Bacteria | 2965 |
| 75 | Ga0070681_10011124 | 3300005458 | Bacteria | 8906 |
| 76 | Ga0070681_10362466 | 3300005458 | Bacteria | 1360 |
| 77 | Ga0068867_100004976 | 3300005459 | Bacteria | 9362 |
| 78 | Ga0070685_10003021 | 3300005466 | Bacteria | 8576 |
| 79 | Ga0070706_100005687 | 3300005467 | Bacteria | 11853 |
| 80 | Ga0070706_100185114 | 3300005467 | Bacteria | 1946 |
| 81 | Ga0070706_100235264 | 3300005467 | Bacteria | 1710 |
| 82 | Ga0070706_100274519 | 3300005467 | Bacteria | 1573 |
| 83 | Ga0070706_100409191 | 3300005467 | Bacteria | 1263 |
| 84 | Ga0070707_100006504 | 3300005468 | Bacteria | 10851 |
| 85 | Ga0070707_100007253 | 3300005468 | Bacteria | 10293 |
| 86 | Ga0070707_100119191 | 3300005468 | Bacteria | 2562 |
| 87 | Ga0070707_101431808 | 3300005468 | Bacteria | 658 |
| 88 | Ga0070698_100005934 | 3300005471 | Bacteria | 13322 |
| 89 | Ga0070698_100052260 | 3300005471 | Bacteria | 4158 |
| 90 | Ga0070698_100334595 | 3300005471 | Bacteria | 1445 |
| 91 | Ga0070698_101830277 | 3300005471 | Bacteria | 560 |
| 92 | Ga0070699_100011279 | 3300005518 | Bacteria | 7720 |
| 93 | Ga0070699_100028457 | 3300005518 | Bacteria | 4819 |
| 94 | Ga0070699_100029006 | 3300005518 | Bacteria | 4771 |
| 95 | Ga0070699_100056202 | 3300005518 | Bacteria | 3407 |
| 96 | Ga0070699_100375543 | 3300005518 | Bacteria | 1283 |
| 97 | Ga0070699_101036285 | 3300005518 | Bacteria | 752 |
| 98 | Ga0070679_100027608 | 3300005530 | Bacteria | 5588 |
| 99 | Ga0070679_100180252 | 3300005530 | Bacteria | 2085 |
| 100 | Ga0070679_100241510 | 3300005530 | Bacteria | 1763 |
| 101 | Ga0070684_100574792 | 3300005535 | Bacteria | 1047 |
| 102 | Ga0070697_100379406 | 3300005536 | Bacteria | 1224 |
| 103 | Ga0070697_100456782 | 3300005536 | Bacteria | 1113 |
| 104 | Ga0068853_100017405 | 3300005539 | Bacteria | 5935 |
| 105 | Ga0068853_100042148 | 3300005539 | Bacteria | 3902 |
| 106 | Ga0068853_100287994 | 3300005539 | Bacteria | 1516 |
| 107 | Ga0068853_100437892 | 3300005539 | Bacteria | 1228 |
| 108 | Ga0070672_100248156 | 3300005543 | Bacteria | 1499 |
| 109 | Ga0070686_100001866 | 3300005544 | Bacteria | 11748 |
| 110 | Ga0070686_100070726 | 3300005544 | Bacteria | 2282 |
| 111 | Ga0070695_100009953 | 3300005545 | Bacteria | 5669 |
| 112 | Ga0070695_100092594 | 3300005545 | Bacteria | 2021 |
| 113 | Ga0070695_100132289 | 3300005545 | Bacteria | 1721 |
| 114 | Ga0070695_100233849 | 3300005545 | Bacteria | 1330 |
| 115 | Ga0070696_100008980 | 3300005546 | Bacteria | 6688 |
| 116 | Ga0070696_100022074 | 3300005546 | Bacteria | 4322 |
| 117 | Ga0070696_100244913 | 3300005546 | Bacteria | 1353 |
| 118 | Ga0070696_101073038 | 3300005546 | Bacteria | 676 |
| 119 | Ga0070693_100028041 | 3300005547 | Bacteria | 3058 |
| 120 | Ga0070693_100051595 | 3300005547 | Bacteria | 2356 |
| 121 | Ga0070693_100108152 | 3300005547 | Bacteria | 1706 |
| 122 | Ga0070665_100007677 | 3300005548 | Bacteria | 10958 |
| 123 | Ga0070704_100013469 | 3300005549 | Bacteria | 5076 |
| 124 | Ga0070704_100039799 | 3300005549 | Bacteria | 3229 |
| 125 | Ga0070704_100077259 | 3300005549 | Bacteria | 2438 |
| 126 | Ga0070704_100145511 | 3300005549 | Bacteria | 1856 |
| 127 | Ga0068855_100423606 | 3300005563 | Bacteria | 1456 |
| 128 | Ga0068854_100058798 | 3300005578 | Bacteria | 2776 |
| 129 | Ga0068856_100012093 | 3300005614 | Bacteria | 8360 |
| 130 | Ga0068856_102401466 | 3300005614 | Bacteria | 534 |
| 131 | Ga0070702_100001552 | 3300005615 | Bacteria | 9458 |
| 132 | Ga0070702_100008536 | 3300005615 | Bacteria | 4967 |
| 133 | Ga0070702_100015668 | 3300005615 | Bacteria | 3875 |
| 134 | Ga0070702_100071348 | 3300005615 | Bacteria | 2053 |
| 135 | Ga0068859_100155364 | 3300005617 | Bacteria | 2365 |
| 136 | Ga0068864_100099597 | 3300005618 | Bacteria | 2575 |
| 137 | Ga0068866_10074411 | 3300005718 | Bacteria | 1806 |
| 138 | Ga0068866_10091606 | 3300005718 | Bacteria | 1657 |
| 139 | Ga0068866_10306999 | 3300005718 | Bacteria | 993 |
| 140 | Ga0068866_11040518 | 3300005718 | Bacteria | 584 |
| 141 | Ga0068861_100108882 | 3300005719 | Bacteria | 2217 |
| 142 | Ga0068861_100235900 | 3300005719 | Bacteria | 1553 |
| 143 | Ga0068858_100052385 | 3300005842 | Bacteria | 3776 |
| 144 | Ga0068858_100053837 | 3300005842 | Bacteria | 3721 |
| 145 | Ga0068858_100313295 | 3300005842 | Bacteria | 1499 |
| 146 | Ga0068860_100190503 | 3300005843 | Bacteria | 1985 |
| 147 | Ga0068862_100211695 | 3300005844 | Bacteria | 1752 |
| 148 | Ga0068862_100302832 | 3300005844 | Bacteria | 1471 |
| 149 | Ga0081538_10019400 | 3300005981 | Bacteria | 5055 |
| 150 | Ga0081538_10060176 | 3300005981 | Bacteria | 2187 |
| 151 | Ga0081540_1002420 | 3300005983 | Bacteria | 15208 |
| 152 | Ga0081539_10002641 | 3300005985 | Bacteria | 24476 |
| 153 | Ga0081539_10037946 | 3300005985 | Bacteria | 2862 |
| 154 | Ga0081539_10128753 | 3300005985 | Bacteria | 1246 |
| 155 | Ga0070717_10015770 | 3300006028 | Bacteria | 5841 |
| 156 | Ga0070717_10466164 | 3300006028 | Bacteria | 1140 |
| 157 | Ga0075365_10007075 | 3300006038 | Bacteria | 6251 |
| 158 | Ga0075365_10491300 | 3300006038 | Bacteria | 867 |
| 159 | Ga0070712_100002885 | 3300006175 | Bacteria | 10660 |
| 160 | Ga0070712_100005922 | 3300006175 | Bacteria | 7567 |
| 161 | Ga0070712_100027500 | 3300006175 | Bacteria | 3798 |
| 162 | Ga0070712_100434150 | 3300006175 | Bacteria | 1091 |
| 163 | Ga0070712_100531750 | 3300006175 | Bacteria | 989 |
| 164 | Ga0097621_100129237 | 3300006237 | Bacteria | 2149 |
| 165 | Ga0097621_100314158 | 3300006237 | Bacteria | 1386 |
| 166 | Ga0068871_100039536 | 3300006358 | Bacteria | 3775 |
| 167 | Ga0075434_100211706 | 3300006871 | Bacteria | 1958 |
| 168 | Ga0068865_100019162 | 3300006881 | Bacteria | 4426 |
| 169 | Ga0075436_100081851 | 3300006914 | Bacteria | 2239 |
| 170 | Ga0075436_100464899 | 3300006914 | Bacteria | 922 |
| 171 | Ga0097620_100155362 | 3300006931 | Bacteria | 2365 |
| 172 | Ga0075435_100012673 | 3300007076 | Bacteria | 6248 |
| 173 | Ga0075435_100117412 | 3300007076 | Bacteria | 2217 |
| 174 | Ga0105250_10061532 | 3300009092 | Bacteria | 1510 |
| 175 | Ga0105240_10040877 | 3300009093 | Bacteria | 5925 |
| 176 | Ga0111539_10015227 | 3300009094 | Bacteria | 9582 |
| 177 | Ga0105245_10003129 | 3300009098 | Bacteria | 14807 |
| 178 | Ga0105245_10045513 | 3300009098 | Bacteria | 3919 |
| 179 | Ga0105245_10068781 | 3300009098 | Bacteria | 3210 |
| 180 | Ga0105245_10209227 | 3300009098 | Bacteria | 1877 |
| 181 | Ga0105245_10426569 | 3300009098 | Bacteria | 1330 |
| 182 | Ga0105245_11142114 | 3300009098 | Bacteria | 826 |
| 183 | Ga0105245_11692550 | 3300009098 | Bacteria | 685 |
| 184 | Ga0105247_10053950 | 3300009101 | Bacteria | 2480 |
| 185 | Ga0105247_10228655 | 3300009101 | Bacteria | 1262 |
| 186 | Ga0114129_10119515 | 3300009147 | Bacteria | 3630 |
| 187 | Ga0114129_10141619 | 3300009147 | Bacteria | 3295 |
| 188 | Ga0105243_10014995 | 3300009148 | Bacteria | 5866 |
| 189 | Ga0105243_10083842 | 3300009148 | Bacteria | 2608 |
| 190 | Ga0105243_10125712 | 3300009148 | Bacteria | 2169 |
| 191 | Ga0105243_10315303 | 3300009148 | Bacteria | 1423 |
| 192 | Ga0105242_10054559 | 3300009176 | Bacteria | 3267 |
| 193 | Ga0105242_10073289 | 3300009176 | Bacteria | 2846 |
| 194 | Ga0105242_10290667 | 3300009176 | Bacteria | 1488 |
| 195 | Ga0105242_10432258 | 3300009176 | Bacteria | 1236 |
| 196 | Ga0105248_10035208 | 3300009177 | Bacteria | 5601 |
| 197 | Ga0105248_10291150 | 3300009177 | Bacteria | 1839 |
| 198 | Ga0105248_10474976 | 3300009177 | Bacteria | 1409 |
| 199 | Ga0105248_10534168 | 3300009177 | Bacteria | 1323 |
| 200 | Ga0105237_10020791 | 3300009545 | Bacteria | 6760 |
| 201 | Ga0105238_10373015 | 3300009551 | Bacteria | 1417 |
| 202 | Ga0105238_11075008 | 3300009551 | Bacteria | 827 |
| 203 | Ga0105249_10000681 | 3300009553 | Bacteria | 30940 |
| 204 | Ga0105249_10003025 | 3300009553 | Bacteria | 14507 |
| 205 | Ga0105249_10137439 | 3300009553 | Bacteria | 2340 |
| 206 | Ga0105239_10015186 | 3300010375 | Bacteria | 8535 |
| 207 | Ga0105239_10040817 | 3300010375 | Bacteria | 5085 |
| 208 | Ga0105239_10267233 | 3300010375 | Bacteria | 1923 |
| 209 | Ga0105239_10574081 | 3300010375 | Bacteria | 1285 |
| 210 | Ga0105239_11239073 | 3300010375 | Bacteria | 860 |
| 211 | Ga0105246_10018607 | 3300011119 | Bacteria | 4430 |
| 212 | Ga0105246_10116830 | 3300011119 | Bacteria | 1970 |
| 213 | Ga0105246_10235245 | 3300011119 | Bacteria | 1445 |
| 214 | Ga0105246_10648326 | 3300011119 | Bacteria | 919 |
| 215 | Ga0157340_1014888 | 3300012473 | Bacteria | 599 |
| 216 | Ga0157346_1019523 | 3300012480 | Bacteria | 580 |
| 217 | Ga0157323_1005420 | 3300012495 | Bacteria | 853 |
| 218 | Ga0157370_10734678 | 3300013104 | Bacteria | 900 |
| 219 | Ga0157370_11284123 | 3300013104 | Bacteria | 660 |
| 220 | Ga0157369_10425098 | 3300013105 | Bacteria | 1377 |
| 221 | Ga0157369_10618170 | 3300013105 | Bacteria | 1118 |
| 222 | Ga0157374_10128922 | 3300013296 | Bacteria | 2447 |
| 223 | Ga0157378_10573757 | 3300013297 | Bacteria | 1136 |
| 224 | Ga0157378_10589535 | 3300013297 | Bacteria | 1121 |
| 225 | Ga0157378_10773746 | 3300013297 | Bacteria | 984 |
| 226 | Ga0163162_10021273 | 3300013306 | Bacteria | 6385 |
| 227 | Ga0163162_10037767 | 3300013306 | Bacteria | 4820 |
| 228 | Ga0163162_10236358 | 3300013306 | Bacteria | 1958 |
| 229 | Ga0157372_10326715 | 3300013307 | Bacteria | 1786 |
| 230 | Ga0157375_10039284 | 3300013308 | Bacteria | 4554 |
| 231 | Ga0157375_10081214 | 3300013308 | Bacteria | 3282 |
| 232 | Ga0157375_10110329 | 3300013308 | Bacteria | 2848 |
| 233 | Ga0163163_10063106 | 3300014325 | Bacteria | 3672 |
| 234 | Ga0163163_11015296 | 3300014325 | Bacteria | 893 |
| 235 | Ga0157380_10382078 | 3300014326 | Bacteria | 1329 |
| 236 | Ga0157380_10992272 | 3300014326 | Bacteria | 873 |
| 237 | Ga0182008_10127695 | 3300014497 | Bacteria | 1267 |
| 238 | Ga0157377_10012642 | 3300014745 | Bacteria | 4249 |
| 239 | Ga0157377_10025935 | 3300014745 | Bacteria | 3130 |
| 240 | Ga0157377_10044924 | 3300014745 | Bacteria | 2465 |
| 241 | Ga0157379_10100029 | 3300014968 | Bacteria | 2603 |
| 242 | Ga0157376_10613019 | 3300014969 | Bacteria | 1085 |
| 243 | Ga0182006_1221637 | 3300015261 | Bacteria | 623 |
| 244 | Ga0182006_1232102 | 3300015261 | Bacteria | 607 |
| 245 | Ga0182007_10030115 | 3300015262 | Bacteria | 1856 |
| 246 | Ga0163161_10018850 | 3300017792 | Bacteria | 4836 |
| 247 | Ga0206356_11642986 | 3300020070 | Bacteria | 2061 |
| 248 | Ga0206350_10394142 | 3300020080 | Bacteria | 955 |
| 249 | Ga0206353_10708315 | 3300020082 | Bacteria | 2101 |
| 250 | Ga0206353_12030080 | 3300020082 | Bacteria | 6381 |
| 251 | Ga0207692_10008402 | 3300025898 | Bacteria | 4270 |
| 252 | Ga0207692_10346127 | 3300025898 | Bacteria | 915 |
| 253 | Ga0207642_10019387 | 3300025899 | Bacteria | 2633 |
| 254 | Ga0207710_10043800 | 3300025900 | Bacteria | 1992 |
| 255 | Ga0207710_10060015 | 3300025900 | Bacteria | 1723 |
| 256 | Ga0207710_10106421 | 3300025900 | Bacteria | 1328 |
| 257 | Ga0207688_10011869 | 3300025901 | Bacteria | 4741 |
| 258 | Ga0207688_10026672 | 3300025901 | Bacteria | 3178 |
| 259 | Ga0207680_10020622 | 3300025903 | Bacteria | 3552 |
| 260 | Ga0207685_10062827 | 3300025905 | Bacteria | 1477 |
| 261 | Ga0207699_10016790 | 3300025906 | Bacteria | 3838 |
| 262 | Ga0207699_10812044 | 3300025906 | Bacteria | 688 |
| 263 | Ga0207645_10008858 | 3300025907 | Bacteria | 6991 |
| 264 | Ga0207684_10044770 | 3300025910 | Bacteria | 3753 |
| 265 | Ga0207684_10475803 | 3300025910 | Bacteria | 1072 |
| 266 | Ga0207707_10012654 | 3300025912 | Bacteria | 7332 |
| 267 | Ga0207695_10737638 | 3300025913 | Bacteria | 865 |
| 268 | Ga0207671_10814953 | 3300025914 | Bacteria | 740 |
| 269 | Ga0207693_10015719 | 3300025915 | Bacteria | 6065 |
| 270 | Ga0207693_10026600 | 3300025915 | Bacteria | 4578 |
| 271 | Ga0207663_10013249 | 3300025916 | Bacteria | 4479 |
| 272 | Ga0207663_10159872 | 3300025916 | Bacteria | 1589 |
| 273 | Ga0207663_11274383 | 3300025916 | Bacteria | 592 |
| 274 | Ga0207660_10077408 | 3300025917 | Bacteria | 2435 |
| 275 | Ga0207662_10048306 | 3300025918 | Bacteria | 2520 |
| 276 | Ga0207662_10056980 | 3300025918 | Bacteria | 2335 |
| 277 | Ga0207657_10223630 | 3300025919 | Bacteria | 1507 |
| 278 | Ga0207649_10637080 | 3300025920 | Bacteria | 823 |
| 279 | Ga0207652_10061109 | 3300025921 | Bacteria | 3253 |
| 280 | Ga0207652_10183293 | 3300025921 | Bacteria | 1882 |
| 281 | Ga0207646_10003525 | 3300025922 | Bacteria | 17627 |
| 282 | Ga0207646_10005850 | 3300025922 | Bacteria | 12856 |
| 283 | Ga0207646_10076566 | 3300025922 | Bacteria | 2990 |
| 284 | Ga0207681_10279969 | 3300025923 | Bacteria | 1313 |
| 285 | Ga0207694_10721796 | 3300025924 | Bacteria | 841 |
| 286 | Ga0207650_11016956 | 3300025925 | Bacteria | 705 |
| 287 | Ga0207659_11925323 | 3300025926 | Bacteria | 501 |
| 288 | Ga0207687_10040312 | 3300025927 | Bacteria | 3201 |
| 289 | Ga0207687_10045878 | 3300025927 | Bacteria | 3023 |
| 290 | Ga0207687_10195103 | 3300025927 | Bacteria | 1579 |
| 291 | Ga0207687_10239978 | 3300025927 | Bacteria | 1436 |
| 292 | Ga0207664_10029121 | 3300025929 | Bacteria | 4204 |
| 293 | Ga0207664_11402195 | 3300025929 | Bacteria | 619 |
| 294 | Ga0207690_10125225 | 3300025932 | Bacteria | 1873 |
| 295 | Ga0207706_10006238 | 3300025933 | Bacteria | 11081 |
| 296 | Ga0207706_10018859 | 3300025933 | Bacteria | 6205 |
| 297 | Ga0207686_10026482 | 3300025934 | Bacteria | 3383 |
| 298 | Ga0207686_10190406 | 3300025934 | Bacteria | 1462 |
| 299 | Ga0207686_10301968 | 3300025934 | Bacteria | 1189 |
| 300 | Ga0207709_10000823 | 3300025935 | Bacteria | 23946 |
| 301 | Ga0207709_10024643 | 3300025935 | Bacteria | 3437 |
| 302 | Ga0207709_10055694 | 3300025935 | Bacteria | 2444 |
| 303 | Ga0207670_10004122 | 3300025936 | Bacteria | 7782 |
| 304 | Ga0207670_10363004 | 3300025936 | Bacteria | 1150 |
| 305 | Ga0207669_10028357 | 3300025937 | Bacteria | 3079 |
| 306 | Ga0207669_10093582 | 3300025937 | Bacteria | 1964 |
| 307 | Ga0207669_10112375 | 3300025937 | Bacteria | 1829 |
| 308 | Ga0207704_10003551 | 3300025938 | Bacteria | 7089 |
| 309 | Ga0207704_11148046 | 3300025938 | Bacteria | 661 |
| 310 | Ga0207665_10041945 | 3300025939 | Bacteria | 3057 |
| 311 | Ga0207665_10409793 | 3300025939 | Bacteria | 1034 |
| 312 | Ga0207691_10296727 | 3300025940 | Bacteria | 1389 |
| 313 | Ga0207691_10396458 | 3300025940 | Bacteria | 1177 |
| 314 | Ga0207711_10026268 | 3300025941 | Bacteria | 4885 |
| 315 | Ga0207711_10344723 | 3300025941 | Bacteria | 1379 |
| 316 | Ga0207711_10349892 | 3300025941 | Bacteria | 1368 |
| 317 | Ga0207711_10562889 | 3300025941 | Bacteria | 1063 |
| 318 | Ga0207661_10001998 | 3300025944 | Bacteria | 14033 |
| 319 | Ga0207661_10581755 | 3300025944 | Bacteria | 1027 |
| 320 | Ga0207712_10001535 | 3300025961 | Bacteria | 15634 |
| 321 | Ga0207712_10006034 | 3300025961 | Bacteria | 7642 |
| 322 | Ga0207668_10001571 | 3300025972 | Bacteria | 13367 |
| 323 | Ga0207668_10032218 | 3300025972 | Bacteria | 3461 |
| 324 | Ga0207668_10328534 | 3300025972 | Bacteria | 1271 |
| 325 | Ga0207640_10316622 | 3300025981 | Bacteria | 1240 |
| 326 | Ga0207677_10197016 | 3300026023 | Bacteria | 1598 |
| 327 | Ga0207677_10355351 | 3300026023 | Bacteria | 1229 |
| 328 | Ga0207677_10790570 | 3300026023 | Bacteria | 849 |
| 329 | Ga0207677_11701104 | 3300026023 | Bacteria | 585 |
| 330 | Ga0207677_11719793 | 3300026023 | Bacteria | 582 |
| 331 | Ga0207703_10034712 | 3300026035 | Bacteria | 4004 |
| 332 | Ga0207703_10150195 | 3300026035 | Bacteria | 2031 |
| 333 | Ga0207639_10042782 | 3300026041 | Bacteria | 3397 |
| 334 | Ga0207639_10563307 | 3300026041 | Bacteria | 1047 |
| 335 | Ga0207678_10251455 | 3300026067 | Bacteria | 1514 |
| 336 | Ga0207708_10005998 | 3300026075 | Bacteria | 9002 |
| 337 | Ga0207708_10010501 | 3300026075 | Bacteria | 6874 |
| 338 | Ga0207708_10060071 | 3300026075 | Bacteria | 2902 |
| 339 | Ga0207708_10173934 | 3300026075 | Bacteria | 1707 |
| 340 | Ga0207702_10065832 | 3300026078 | Bacteria | 3104 |
| 341 | Ga0207648_10000097 | 3300026089 | Bacteria | 83554 |
| 342 | Ga0207648_10028628 | 3300026089 | Bacteria | 4938 |
| 343 | Ga0207648_10078870 | 3300026089 | Bacteria | 2873 |
| 344 | Ga0207676_10026117 | 3300026095 | Bacteria | 4341 |
| 345 | Ga0207676_10266658 | 3300026095 | Bacteria | 1549 |
| 346 | Ga0207676_10365294 | 3300026095 | Bacteria | 1339 |
| 347 | Ga0207675_100001912 | 3300026118 | Bacteria | 20780 |
| 348 | Ga0207675_100178849 | 3300026118 | Bacteria | 2031 |
| 349 | Ga0207675_100207451 | 3300026118 | Bacteria | 1883 |
| 350 | Ga0207675_100265613 | 3300026118 | Bacteria | 1664 |
| 351 | Ga0207683_10000038 | 3300026121 | Bacteria | 100875 |
| 352 | Ga0207698_10095551 | 3300026142 | Bacteria | 2447 |
| 353 | Ga0207428_10002883 | 3300027907 | Bacteria | 17042 |
| 354 | Ga0268266_10091365 | 3300028379 | Bacteria | 2669 |
| 355 | Ga0268265_10094966 | 3300028380 | Bacteria | 2393 |
| 356 | Ga0268265_10319433 | 3300028380 | Bacteria | 1405 |
| 357 | Ga0268265_10520187 | 3300028380 | Bacteria | 1125 |
| 358 | Ga0268264_11576849 | 3300028381 | Bacteria | 667 |
| 359 | Ga0265319_1004631 | 3300028563 | Bacteria | 6761 |
| 360 | Ga0265334_10118695 | 3300028573 | Bacteria | 946 |
| 361 | Ga0265322_10012031 | 3300028654 | Bacteria | 2503 |
| 362 | Ga0265336_10025764 | 3300028666 | Bacteria | 1851 |
| 363 | Ga0265338_10098477 | 3300028800 | Bacteria | 2392 |
| 364 | Ga0265332_10000830 | 3300031238 | Bacteria | 18745 |
| 365 | Ga0265320_10038881 | 3300031240 | Bacteria | 2382 |
| 366 | Ga0265329_10030443 | 3300031242 | Bacteria | 1758 |
| 367 | Ga0265339_10002754 | 3300031249 | Bacteria | 12482 |
| 368 | Ga0265331_10157106 | 3300031250 | Bacteria | 1031 |
| 369 | Ga0265314_10039431 | 3300031711 | Bacteria | 3402 |
| 370 | Ga0307413_10039275 | 3300031824 | Bacteria | 2751 |
| 371 | Ga0307413_10305559 | 3300031824 | Bacteria | 1208 |
| 372 | Ga0307413_10970779 | 3300031824 | Bacteria | 726 |
| 373 | Ga0307410_11517676 | 3300031852 | Bacteria | 590 |
| 374 | Ga0307406_10055297 | 3300031901 | Bacteria | 2536 |
| 375 | Ga0307409_100106705 | 3300031995 | Bacteria | 2338 |
| 376 | Ga0307416_100373303 | 3300032002 | Bacteria | 1453 |
| 377 | Ga0307416_102131483 | 3300032002 | Bacteria | 662 |
| 378 | Ga0307416_102552427 | 3300032002 | Bacteria | 609 |
| 379 | Ga0307411_10024445 | 3300032005 | Bacteria | 3602 |
| 380 | Ga0307411_10129185 | 3300032005 | Bacteria | 1844 |
| 381 | Ga0307415_100017115 | 3300032126 | Bacteria | 4339 |
| 382 | Ga0373930_0006042 | 3300034816 | Bacteria | 2031 |
| 383 | Ga0373948_0019024 | 3300034817 | Bacteria | 1295 |
| 384 | Ga0373959_0214727 | 3300034820 | Bacteria | 513 |
| 385 | Ga0373938_0229262 | 3300034957 | Bacteria | 524 |
| 386 | Ga0373929_0037821 | 3300035085 | Bacteria | 1059 |
| 387 | Ga0373944_0272644 | 3300035089 | Bacteria | 629 |
| 388 | Ga0373949_0003557 | 3300035090 | Bacteria | 3681 |
| 389 | Ga0373951_0001825 | 3300035091 | Bacteria | 5525 |
| 390 | Ga0373952_0006760 | 3300035092 | Bacteria | 2131 |
| 391 | Ga0373932_0008867 | 3300035112 | Bacteria | 2408 |
| 392 | Ga0373936_0388656 | 3300035113 | Bacteria | 639 |
| 393 | Ga0373939_0017759 | 3300035114 | Bacteria | 1894 |
| 394 | Ga0373941_0001105 | 3300035115 | Bacteria | 5625 |
| 395 | Ga0373943_0487315 | 3300035170 | Bacteria | 719 |
| 396 | Ga0373946_0011487 | 3300035171 | Bacteria | 3306 |
| 397 | Ga0373942_0054474 | 3300035207 | Bacteria | 1130 |
| 398 | Ga0373962_0002255 | 3300035242 | Bacteria | 4608 |
| 399 | Ga0316574_0015191 | 3300035398 | Bacteria | 4467 |
| 400 | Ga0373931_0015842 | 3300035691 | Bacteria | 3701 |
| 401 | Ga0373947_0046859 | 3300035725 | Bacteria | 2589 |
| 402 | Ga0373947_0073117 | 3300035725 | Bacteria | 2107 |
| 403 | Ga0373947_0141698 | 3300035725 | Bacteria | 1542 |
| 404 | Ga0373937_0005831 | 3300036401 | Bacteria | 10589 |
| 405 | Ga0373925_0109745 | 3300037068 | Bacteria | 2130 |
| 406 | Ga0395899_0007102 | 3300037312 | Bacteria | 8668 |
| 407 | Ga0395899_0012461 | 3300037312 | Bacteria | 6515 |
| 408 | Ga0395899_0022426 | 3300037312 | Bacteria | 4788 |
| 409 | Ga0395899_0036492 | 3300037312 | Bacteria | 3687 |
| 410 | Ga0395899_0043610 | 3300037312 | Bacteria | 3345 |
| 411 | Ga0395899_0553088 | 3300037312 | Bacteria | 739 |
| 412 | Ga0395900_0001661 | 3300037418 | Bacteria | 26033 |
| 413 | Ga0395900_0005716 | 3300037418 | Bacteria | 12997 |
| 414 | Ga0395900_0016989 | 3300037418 | Bacteria | 7427 |
| 415 | Ga0395900_0019506 | 3300037418 | Bacteria | 6913 |
| 416 | Ga0395900_0023789 | 3300037418 | Bacteria | 6268 |
| 417 | Ga0395900_0026222 | 3300037418 | Bacteria | 5968 |
| 418 | Ga0395900_0072861 | 3300037418 | Bacteria | 3530 |
| 419 | Ga0395900_0084667 | 3300037418 | Bacteria | 3258 |
| 420 | Ga0395900_0106543 | 3300037418 | Bacteria | 2879 |
| 421 | Ga0395900_0142244 | 3300037418 | Bacteria | 2456 |
| 422 | Ga0395900_0182653 | 3300037418 | Bacteria | 2130 |
| 423 | Ga0395900_0392784 | 3300037418 | Bacteria | 1353 |
| 424 | Ga0395900_0897263 | 3300037418 | Bacteria | 810 |
| 425 | Ga0395898_0003643 | 3300037466 | Bacteria | 17125 |
| 426 | Ga0395898_0004328 | 3300037466 | Bacteria | 15549 |
| 427 | Ga0395898_0006068 | 3300037466 | Bacteria | 12973 |
| 428 | Ga0395898_0025504 | 3300037466 | Bacteria | 5956 |
| 429 | Ga0395898_0031445 | 3300037466 | Bacteria | 5303 |
| 430 | Ga0395898_0072722 | 3300037466 | Bacteria | 3321 |
| 431 | Ga0395898_0140998 | 3300037466 | Bacteria | 2307 |
| 432 | Ga0395898_0469159 | 3300037466 | Bacteria | 1198 |
| 433 | Ga0395898_0990406 | 3300037466 | Bacteria | 777 |
| 434 | Ga0395905_0003336 | 3300037471 | Bacteria | 17229 |
| 435 | Ga0395905_0008963 | 3300037471 | Bacteria | 9817 |
| 436 | Ga0395905_0014334 | 3300037471 | Bacteria | 7576 |
| 437 | Ga0395905_0019447 | 3300037471 | Bacteria | 6438 |
| 438 | Ga0395905_0052189 | 3300037471 | Bacteria | 3828 |
| 439 | Ga0395905_0062176 | 3300037471 | Bacteria | 3492 |
| 440 | Ga0395905_0154775 | 3300037471 | Bacteria | 2156 |
| 441 | Ga0395905_0181051 | 3300037471 | Bacteria | 1978 |
| 442 | Ga0395905_0305381 | 3300037471 | Archaea | 1479 |
| 443 | Ga0395905_0397142 | 3300037471 | Bacteria | 1273 |
| 444 | Ga0395905_0585997 | 3300037471 | Bacteria | 1017 |
| 445 | Ga0395901_0000956 | 3300038443 | Bacteria | 31448 |
| 446 | Ga0395901_0004995 | 3300038443 | Bacteria | 13391 |
| 447 | Ga0395901_0013042 | 3300038443 | Bacteria | 8434 |
| 448 | Ga0395901_0046765 | 3300038443 | Bacteria | 4495 |
| 449 | Ga0395901_0047097 | 3300038443 | Bacteria | 4477 |
| 450 | Ga0395901_0070904 | 3300038443 | Bacteria | 3630 |
| 451 | Ga0395901_0162730 | 3300038443 | Bacteria | 2343 |
| 452 | Ga0395901_0174570 | 3300038443 | Bacteria | 2254 |
| 453 | Ga0395901_0368885 | 3300038443 | Bacteria | 1479 |
| 454 | Ga0395901_0488894 | 3300038443 | Bacteria | 1254 |
| 455 | Ga0395901_0524070 | 3300038443 | Bacteria | 1203 |
| 456 | Ga0395901_0539897 | 3300038443 | Bacteria | 1183 |
| 457 | Ga0395901_0550367 | 3300038443 | Bacteria | 1169 |
| 458 | Ga0395901_1067842 | 3300038443 | Bacteria | 779 |
| 459 | Ga0242422_09518 | 3300038699 | Bacteria | 565 |
| 460 | Ga0242420_068899 | 3300038996 | Bacteria | 716 |
| 461 | Ga0436365_0209504 | 3300039437 | Bacteria | 793 |
| 462 | Ga0436363_1175972 | 3300039450 | Bacteria | 569 |
| 463 | Ga0451793_0184281 | 3300041452 | Bacteria | 5752 |
| 464 | Ga0451807_0422792 | 3300041486 | Bacteria | 721 |
| 465 | Ga0451837_0630977 | 3300041494 | Bacteria | 5127 |
| 466 | Ga0451851_0168620 | 3300041507 | Bacteria | 540 |
| 467 | Ga0439437_021989 | 3300042000 | Bacteria | 775 |
| 468 | Ga0439448_0007952 | 3300042005 | Bacteria | 3090 |
| 469 | Ga0450907_004419 | 3300042146 | Bacteria | 2428 |
| 470 | Ga0466963_0008599 | 3300044694 | Bacteria | 6128 |
| 471 | Ga0466963_0294336 | 3300044694 | Bacteria | 1141 |
| 472 | Ga0466963_0561411 | 3300044694 | Bacteria | 806 |
| 473 | Ga0466971_0012510 | 3300044719 | Bacteria | 3721 |
| 474 | Ga0466957_0012714 | 3300044842 | Bacteria | 4878 |
| 475 | Ga0466957_0013907 | 3300044842 | Bacteria | 4679 |
| 476 | Ga0466960_0028499 | 3300044901 | Bacteria | 2556 |
| 477 | Ga0466960_0048693 | 3300044901 | Bacteria | 2037 |
| 478 | Ga0451576_0021703 | 3300045051 | Bacteria | 6974 |
| 479 | Ga0466958_0069980 | 3300045836 | Bacteria | 2146 |
| 480 | Ga0466958_1033685 | 3300045836 | Bacteria | 536 |
| 481 | Ga0466967_0001385 | 3300045976 | Bacteria | 13992 |
| 482 | Ga0466967_0031189 | 3300045976 | Bacteria | 4484 |
| 483 | Ga0466967_0066356 | 3300045976 | Bacteria | 3215 |
| 484 | Ga0466967_0829781 | 3300045976 | Bacteria | 918 |
| 485 | Ga0466967_0830639 | 3300045976 | Bacteria | 918 |
| 486 | Ga0495603_0000394 | 3300046455 | Bacteria | 23982 |
| 487 | Ga0495603_0082422 | 3300046455 | Bacteria | 1884 |
| 488 | Ga0495641_0005687 | 3300046461 | Bacteria | 8308 |
| 489 | Ga0495641_0034890 | 3300046461 | Bacteria | 2375 |
| 490 | Ga0495653_0556184 | 3300046463 | Bacteria | 709 |
| 491 | Ga0495580_0294289 | 3300046472 | Bacteria | 1106 |
| 492 | Ga0495582_0141729 | 3300046473 | Bacteria | 1362 |
| 493 | Ga0495582_0345785 | 3300046473 | Bacteria | 856 |
| 494 | Ga0495605_0047235 | 3300046474 | Bacteria | 2112 |
| 495 | Ga0495605_0229456 | 3300046474 | Bacteria | 800 |
| 496 | Ga0495639_0063801 | 3300046475 | Bacteria | 1692 |
| 497 | Ga0495584_0059027 | 3300046491 | Bacteria | 1930 |
| 498 | Ga0495584_0198873 | 3300046491 | Bacteria | 1019 |
| 499 | Ga0495584_0226184 | 3300046491 | Bacteria | 951 |
| 500 | Ga0495585_0230603 | 3300046492 | Bacteria | 931 |
| 501 | Ga0495594_0000597 | 3300046499 | Bacteria | 18592 |
| 502 | Ga0495596_0042160 | 3300046500 | Bacteria | 1799 |
| 503 | Ga0495596_0148737 | 3300046500 | Bacteria | 910 |
| 504 | Ga0495607_0253021 | 3300046501 | Bacteria | 847 |
| 505 | Ga0495630_0153833 | 3300046517 | Bacteria | 1750 |
| 506 | Ga0495631_0107917 | 3300046518 | Bacteria | 1197 |
| 507 | Ga0495631_0170337 | 3300046518 | Bacteria | 934 |
| 508 | Ga0495637_0181445 | 3300046520 | Bacteria | 780 |
| 509 | Ga0495644_0088788 | 3300046523 | Bacteria | 1166 |
| 510 | Ga0495663_0032625 | 3300046525 | Bacteria | 1552 |
| 511 | Ga0495666_0152732 | 3300046526 | Bacteria | 1073 |
| 512 | Ga0495666_0159231 | 3300046526 | Bacteria | 1047 |
| 513 | Ga0495652_0426054 | 3300046529 | Bacteria | 934 |
| 514 | Ga0495665_0097452 | 3300046531 | Bacteria | 1544 |
| 515 | Ga0495665_0421653 | 3300046531 | Bacteria | 676 |
| 516 | Ga0495640_0284474 | 3300046533 | Bacteria | 1029 |
| 517 | Ga0495609_0062602 | 3300046538 | Bacteria | 1643 |
| 518 | Ga0495622_0090480 | 3300046557 | Bacteria | 1406 |
| 519 | Ga0495667_0084055 | 3300046559 | Bacteria | 2067 |
| 520 | Ga0495656_0084713 | 3300046615 | Bacteria | 1438 |
| 521 | Ga0495656_0350189 | 3300046615 | Bacteria | 765 |
| 522 | Ga0495634_0732201 | 3300046642 | Bacteria | 567 |
| 523 | Ga0495611_0535936 | 3300046648 | Bacteria | 531 |
| 524 | Ga0495659_0028483 | 3300046664 | Bacteria | 1934 |
| 525 | Ga0495661_0160590 | 3300046665 | Bacteria | 1207 |
| 526 | Ga0495588_0000483 | 3300046674 | Bacteria | 19736 |
| 527 | Ga0495588_0077991 | 3300046674 | Bacteria | 1728 |
| 528 | Ga0495647_0038652 | 3300046681 | Bacteria | 1805 |
| 529 | Ga0495647_0348723 | 3300046681 | Bacteria | 674 |
| 530 | Ga0495658_0137338 | 3300046683 | Bacteria | 1493 |
| 531 | Ga0495658_0386356 | 3300046683 | Bacteria | 892 |
| 532 | Ga0495669_0370449 | 3300046684 | Bacteria | 693 |
| 533 | Ga0495624_0311657 | 3300046690 | Bacteria | 948 |
| 534 | Ga0495670_0276311 | 3300046691 | Bacteria | 898 |
| 535 | Ga0495670_0489786 | 3300046691 | Bacteria | 667 |
| 536 | Ga0495671_0570904 | 3300046692 | Bacteria | 538 |
| 537 | Ga0495589_0054689 | 3300046794 | Bacteria | 1968 |
| 538 | Ga0495581_0093423 | 3300047315 | Bacteria | 1746 |
| 539 | Ga0495581_0099929 | 3300047315 | Bacteria | 1685 |
| 540 | Ga0495636_0389521 | 3300047318 | Bacteria | 662 |
| 541 | Ga0495674_0245018 | 3300047319 | Bacteria | 1476 |
| 542 | Ga0495676_0010528 | 3300047321 | Bacteria | 8381 |
| 543 | Ga0495676_0017024 | 3300047321 | Bacteria | 6434 |
| 544 | Ga0495676_0046204 | 3300047321 | Bacteria | 3537 |
| 545 | Ga0495676_0647141 | 3300047321 | Bacteria | 686 |
| 546 | Ga0495683_0127503 | 3300047323 | Bacteria | 1203 |
| 547 | Ga0495677_0067000 | 3300047445 | Bacteria | 1336 |
| 548 | Ga0495614_0417762 | 3300048089 | Bacteria | 632 |
| 549 | Ga0495615_0135201 | 3300048090 | Bacteria | 724 |
| 550 | Ga0496100_0025684 | 3300048903 | Bacteria | 3603 |
| 551 | Ga0496100_0413035 | 3300048903 | Bacteria | 1030 |
| 552 | Ga0496100_0877137 | 3300048903 | Bacteria | 704 |
| 553 | Ga0496101_0035677 | 3300048904 | Bacteria | 3519 |
| 554 | Ga0496101_0039743 | 3300048904 | Bacteria | 3347 |
| 555 | Ga0496101_0075309 | 3300048904 | Bacteria | 2484 |
| 556 | Ga0496101_0290977 | 3300048904 | Bacteria | 1278 |
| 557 | Ga0496101_0437689 | 3300048904 | Bacteria | 1031 |
| 558 | Ga0496102_0046636 | 3300048905 | Bacteria | 3936 |
| 559 | Ga0496102_0070848 | 3300048905 | Bacteria | 3201 |
| 560 | Ga0496102_0122382 | 3300048905 | Bacteria | 2430 |
| 561 | Ga0496102_0170273 | 3300048905 | Bacteria | 2050 |
| 562 | Ga0496102_0197236 | 3300048905 | Bacteria | 1897 |
| 563 | Ga0496102_0312581 | 3300048905 | Bacteria | 1481 |
| 564 | Ga0496102_0696783 | 3300048905 | Bacteria | 939 |
| 565 | Ga0496102_1310810 | 3300048905 | Bacteria | 643 |
| 566 | Ga0496102_1521808 | 3300048905 | Bacteria | 588 |
| 567 | Ga0496103_0002524 | 3300048906 | Bacteria | 11471 |
| 568 | Ga0496103_0079911 | 3300048906 | Bacteria | 2055 |
| 569 | Ga0496103_0839874 | 3300048906 | Bacteria | 578 |
| 570 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 571 | Ga0496104_0000432 | 3300048907 | Bacteria | 36339 |
| 572 | Ga0496104_0018643 | 3300048907 | Bacteria | 6334 |
| 573 | Ga0496104_0018678 | 3300048907 | Bacteria | 6329 |
| 574 | Ga0496104_0122252 | 3300048907 | Bacteria | 2499 |
| 575 | Ga0496104_0459018 | 3300048907 | Bacteria | 1185 |
| 576 | Ga0496104_1198745 | 3300048907 | Bacteria | 662 |
| 577 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 578 | Ga0496105_0000348 | 3300048908 | Bacteria | 30485 |
| 579 | Ga0496105_0004665 | 3300048908 | Bacteria | 10331 |
| 580 | Ga0496105_0027494 | 3300048908 | Bacteria | 4648 |
| 581 | Ga0496105_0052739 | 3300048908 | Bacteria | 3359 |
| 582 | Ga0496105_0135018 | 3300048908 | Bacteria | 2033 |
| 583 | Ga0496106_0001818 | 3300048909 | Bacteria | 15953 |
| 584 | Ga0496106_0026958 | 3300048909 | Bacteria | 4278 |
| 585 | Ga0496106_0296337 | 3300048909 | Bacteria | 1297 |
| 586 | Ga0496107_0000389 | 3300048910 | Bacteria | 23869 |
| 587 | Ga0496107_0007441 | 3300048910 | Bacteria | 7548 |
| 588 | Ga0496107_0042096 | 3300048910 | Bacteria | 3281 |
| 589 | Ga0496107_1177120 | 3300048910 | Bacteria | 552 |
| 590 | Ga0496108_0005047 | 3300048911 | Bacteria | 10662 |
| 591 | Ga0496108_0022292 | 3300048911 | Bacteria | 5206 |
| 592 | Ga0496108_0055960 | 3300048911 | Bacteria | 3313 |
| 593 | Ga0496108_0075704 | 3300048911 | Bacteria | 2844 |
| 594 | Ga0496108_0714008 | 3300048911 | Bacteria | 869 |
| 595 | Ga0496109_0037547 | 3300048912 | Bacteria | 4376 |
| 596 | Ga0496109_0050242 | 3300048912 | Bacteria | 3798 |
| 597 | Ga0496109_0065498 | 3300048912 | Bacteria | 3326 |
| 598 | Ga0496109_0170351 | 3300048912 | Bacteria | 2042 |
| 599 | Ga0496109_0180199 | 3300048912 | Bacteria | 1984 |
| 600 | Ga0496109_0297769 | 3300048912 | Bacteria | 1521 |
| 601 | Ga0496109_0356725 | 3300048912 | Bacteria | 1381 |
| 602 | Ga0496110_0000944 | 3300048913 | Bacteria | 20341 |
| 603 | Ga0496110_0067296 | 3300048913 | Bacteria | 3169 |
| 604 | Ga0496110_0111139 | 3300048913 | Bacteria | 2463 |
| 605 | Ga0496110_0309694 | 3300048913 | Bacteria | 1438 |
| 606 | Ga0496110_0382812 | 3300048913 | Bacteria | 1282 |
| 607 | Ga0496110_1034925 | 3300048913 | Bacteria | 729 |
| 608 | Ga0496111_0000045 | 3300048914 | Bacteria | 48903 |
| 609 | Ga0496111_0091733 | 3300048914 | Bacteria | 2226 |
| 610 | Ga0496111_0516167 | 3300048914 | Bacteria | 879 |
| 611 | Ga0496112_0014277 | 3300048915 | Bacteria | 7360 |
| 612 | Ga0496112_0085852 | 3300048915 | Bacteria | 3113 |
| 613 | Ga0496112_0174562 | 3300048915 | Bacteria | 2114 |
| 614 | Ga0496112_0836085 | 3300048915 | Bacteria | 844 |
| 615 | Ga0496112_0894273 | 3300048915 | Bacteria | 810 |
| 616 | Ga0496112_0965235 | 3300048915 | Bacteria | 773 |
| 617 | Ga0496113_0000076 | 3300048916 | Bacteria | 42925 |
| 618 | Ga0496113_0171876 | 3300048916 | Bacteria | 1716 |
| 619 | Ga0496113_0190448 | 3300048916 | Bacteria | 1628 |
| 620 | Ga0496114_0018856 | 3300048917 | Bacteria | 5586 |
| 621 | Ga0496114_0028495 | 3300048917 | Bacteria | 4583 |
| 622 | Ga0496114_0041150 | 3300048917 | Bacteria | 3829 |
| 623 | Ga0496114_0399487 | 3300048917 | Bacteria | 1217 |
| 624 | Ga0496114_0441732 | 3300048917 | Bacteria | 1152 |
| 625 | Ga0496115_0008731 | 3300048918 | Bacteria | 7512 |
| 626 | Ga0496115_0017633 | 3300048918 | Bacteria | 5465 |
| 627 | Ga0496122_0205098 | 3300048925 | Bacteria | 1148 |
| 628 | Ga0496126_0014963 | 3300048929 | Bacteria | 7821 |
| 629 | Ga0501032_0106529 | 3300049569 | Bacteria | 1857 |
| 630 | Ga0501038_1336247 | 3300049574 | Bacteria | 517 |
| 631 | Ga0501042_0378920 | 3300049578 | Unclassified | 1024 |
| 632 | Ga0501043_0041324 | 3300049579 | Bacteria | 3623 |
| 633 | Ga0501046_0102715 | 3300049580 | Bacteria | 2192 |
| 634 | Ga0501047_0237422 | 3300049581 | Bacteria | 1674 |
| 635 | Ga0501067_0009040 | 3300049583 | Bacteria | 5518 |
| 636 | Ga0501067_0022007 | 3300049583 | Bacteria | 3527 |
| 637 | Ga0501067_0101540 | 3300049583 | Bacteria | 1598 |
| 638 | Ga0501068_0182180 | 3300049584 | Bacteria | 1328 |
| 639 | Ga0501069_0009379 | 3300049585 | Bacteria | 5166 |
| 640 | Ga0501069_0032720 | 3300049585 | Bacteria | 2862 |
| 641 | Ga0501069_0041169 | 3300049585 | Bacteria | 2553 |
| 642 | Ga0501069_0060706 | 3300049585 | Bacteria | 2111 |
| 643 | Ga0501069_0179267 | 3300049585 | Bacteria | 1224 |
| 644 | Ga0501070_0010946 | 3300049586 | Bacteria | 7658 |
| 645 | Ga0501072_0319992 | 3300049588 | Unclassified | 1233 |
| 646 | Ga0501072_0873341 | 3300049588 | Bacteria | 703 |
| 647 | Ga0501073_0067037 | 3300049589 | Bacteria | 2502 |
| 648 | Ga0501074_0026101 | 3300049590 | Bacteria | 4236 |
| 649 | Ga0501079_0005310 | 3300049741 | Bacteria | 9588 |
| 650 | Ga0501080_0001819 | 3300049742 | Bacteria | 18282 |
| 651 | Ga0501080_0084696 | 3300049742 | Bacteria | 2945 |
| 652 | Ga0501080_0118671 | 3300049742 | Bacteria | 2452 |
| 653 | Ga0501083_0016753 | 3300049744 | Bacteria | 5119 |
| 654 | Ga0501083_0426098 | 3300049744 | Bacteria | 863 |
| 655 | Ga0501044_0055236 | 3300049823 | Bacteria | 4079 |
| 656 | Ga0501045_0129363 | 3300049824 | Unclassified | 1877 |
| 657 | nmdc:mga0yw44_13283_c1 | 3300050492 | Bacteria | 4330 |
| 658 | nmdc:mga05p37_304803_c1 | 3300050507 | Bacteria | 1891 |
| 659 | nmdc:mga05p37_455627_c1 | 3300050507 | Bacteria | 1479 |
| 660 | nmdc:mga05p37_758028_c1 | 3300050507 | Bacteria | 1069 |
| 661 | nmdc:mga06r32_59004_c1 | 3300050510 | Bacteria | 3689 |
| 662 | nmdc:mga06r32_607861_c1 | 3300050510 | Bacteria | 1064 |
| 663 | nmdc:mga08y16_20136_c1 | 3300050511 | Bacteria | 7041 |
| 664 | nmdc:mga0n895_5243_c1 | 3300050512 | Bacteria | 10802 |
| 665 | nmdc:mga0rr50_294503_c1 | 3300050513 | Bacteria | 1357 |
| 666 | nmdc:mga0rr50_62604_c1 | 3300050513 | Bacteria | 2808 |
| 667 | nmdc:mga08x19_29306_c1 | 3300050514 | Bacteria | 3452 |
| 668 | nmdc:mga08x19_77019_c1 | 3300050514 | Bacteria | 2184 |
| 669 | nmdc:mga0a205_174868_c1 | 3300050515 | Bacteria | 2043 |
| 670 | nmdc:mga0a205_46736_c1 | 3300050515 | Bacteria | 4175 |
| 671 | Ga0495601_0026997 | 3300053077 | Bacteria | 3548 |
| 672 | Ga0495612_0532307 | 3300053078 | Bacteria | 540 |
| 673 | Ga0495595_0394799 | 3300053084 | Bacteria | 701 |
| 674 | Ga0587066_142228 | 3300059490 | Bacteria | 587 |
| 675 | Ga0466962_0010804 | 3300061719 | Bacteria | 4389 |
| 676 | Ga0530510_0087539 | 3300061734 | Bacteria | 2269 |
| 677 | Ga0530510_0194326 | 3300061734 | Bacteria | 1506 |
| 678 | Ga0530510_1041787 | 3300061734 | Bacteria | 626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10007075 | Ga0075365_100070752 | 150 |
| 2 | 3300006038 | Ga0075365_10491300 | Ga0075365_104913001 | 150 |
| 3 | 3300037418 | Ga0395900_0897263 | Ga0395900_0897263_27_488 | 150 |
| 4 | 3300038443 | Ga0395901_0488894 | Ga0395901_0488894_268_768 | 150 |
| 5 | 3300050492 | nmdc:mga0yw44_13283_c1 | nmdc:mga0yw44_13283_c1_900_1400 | 150 |
| 6 | 3300002244 | JGI24742J22300_10009173 | JGI24742J22300_100091731 | 151 |
| 7 | 3300005330 | Ga0070690_100015622 | Ga0070690_1000156223 | 151 |
| 8 | 3300005335 | Ga0070666_10036962 | Ga0070666_100369625 | 151 |
| 9 | 3300005336 | Ga0070680_100553936 | Ga0070680_1005539362 | 151 |
| 10 | 3300005337 | Ga0070682_100003314 | Ga0070682_10000331413 | 151 |
| 11 | 3300005337 | Ga0070682_100462031 | Ga0070682_1004620311 | 151 |
| 12 | 3300005338 | Ga0068868_100787376 | Ga0068868_1007873762 | 151 |
| 13 | 3300005340 | Ga0070689_100005870 | Ga0070689_1000058704 | 151 |
| 14 | 3300005343 | Ga0070687_100039689 | Ga0070687_1000396894 | 151 |
| 15 | 3300005345 | Ga0070692_10000439 | Ga0070692_1000043917 | 151 |
| 16 | 3300005347 | Ga0070668_100018041 | Ga0070668_1000180413 | 151 |
| 17 | 3300005354 | Ga0070675_100275415 | Ga0070675_1002754152 | 151 |
| 18 | 3300005354 | Ga0070675_100409400 | Ga0070675_1004094001 | 151 |
| 19 | 3300005356 | Ga0070674_100002226 | Ga0070674_1000022266 | 151 |
| 20 | 3300005364 | Ga0070673_100016796 | Ga0070673_1000167967 | 151 |
| 21 | 3300005365 | Ga0070688_100024686 | Ga0070688_1000246862 | 151 |
| 22 | 3300005366 | Ga0070659_100065382 | Ga0070659_1000653823 | 151 |
| 23 | 3300005406 | Ga0070703_10111078 | Ga0070703_101110782 | 151 |
| 24 | 3300005434 | Ga0070709_10007555 | Ga0070709_100075558 | 151 |
| 25 | 3300005435 | Ga0070714_100076035 | Ga0070714_1000760355 | 151 |
| 26 | 3300005436 | Ga0070713_100069633 | Ga0070713_1000696331 | 151 |
| 27 | 3300005436 | Ga0070713_100255590 | Ga0070713_1002555902 | 151 |
| 28 | 3300005437 | Ga0070710_10009273 | Ga0070710_100092733 | 151 |
| 29 | 3300005438 | Ga0070701_10032276 | Ga0070701_100322762 | 151 |
| 30 | 3300005439 | Ga0070711_100012825 | Ga0070711_1000128255 | 151 |
| 31 | 3300005441 | Ga0070700_100005568 | Ga0070700_1000055688 | 151 |
| 32 | 3300005444 | Ga0070694_100179067 | Ga0070694_1001790672 | 151 |
| 33 | 3300005444 | Ga0070694_101028327 | Ga0070694_1010283272 | 151 |
| 34 | 3300005445 | Ga0070708_100082457 | Ga0070708_1000824575 | 151 |
| 35 | 3300005445 | Ga0070708_100447592 | Ga0070708_1004475922 | 151 |
| 36 | 3300005455 | Ga0070663_100012552 | Ga0070663_10001255210 | 151 |
| 37 | 3300005455 | Ga0070663_100356863 | Ga0070663_1003568632 | 151 |
| 38 | 3300005456 | Ga0070678_100038757 | Ga0070678_1000387574 | 151 |
| 39 | 3300005458 | Ga0070681_10362466 | Ga0070681_103624662 | 151 |
| 40 | 3300005459 | Ga0068867_100004976 | Ga0068867_1000049763 | 151 |
| 41 | 3300005466 | Ga0070685_10003021 | Ga0070685_100030218 | 151 |
| 42 | 3300005467 | Ga0070706_100005687 | Ga0070706_10000568712 | 151 |
| 43 | 3300005467 | Ga0070706_100185114 | Ga0070706_1001851142 | 151 |
| 44 | 3300005468 | Ga0070707_100006504 | Ga0070707_10000650410 | 151 |
| 45 | 3300005471 | Ga0070698_100005934 | Ga0070698_1000059349 | 151 |
| 46 | 3300005471 | Ga0070698_100334595 | Ga0070698_1003345952 | 151 |
| 47 | 3300005471 | Ga0070698_101830277 | Ga0070698_1018302771 | 151 |
| 48 | 3300005518 | Ga0070699_100011279 | Ga0070699_1000112792 | 151 |
| 49 | 3300005518 | Ga0070699_100028457 | Ga0070699_1000284573 | 151 |
| 50 | 3300005518 | Ga0070699_100056202 | Ga0070699_1000562022 | 151 |
| 51 | 3300005518 | Ga0070699_100375543 | Ga0070699_1003755432 | 151 |
| 52 | 3300005530 | Ga0070679_100027608 | Ga0070679_1000276082 | 151 |
| 53 | 3300005530 | Ga0070679_100180252 | Ga0070679_1001802523 | 151 |
| 54 | 3300005536 | Ga0070697_100379406 | Ga0070697_1003794062 | 151 |
| 55 | 3300005536 | Ga0070697_100456782 | Ga0070697_1004567822 | 151 |
| 56 | 3300005539 | Ga0068853_100017405 | Ga0068853_1000174056 | 151 |
| 57 | 3300005544 | Ga0070686_100001866 | Ga0070686_10000186613 | 151 |
| 58 | 3300005545 | Ga0070695_100092594 | Ga0070695_1000925941 | 151 |
| 59 | 3300005546 | Ga0070696_100022074 | Ga0070696_1000220744 | 151 |
| 60 | 3300005546 | Ga0070696_100244913 | Ga0070696_1002449132 | 151 |
| 61 | 3300005547 | Ga0070693_100108152 | Ga0070693_1001081523 | 151 |
| 62 | 3300005548 | Ga0070665_100007677 | Ga0070665_1000076775 | 151 |
| 63 | 3300005549 | Ga0070704_100013469 | Ga0070704_1000134694 | 151 |
| 64 | 3300005563 | Ga0068855_100423606 | Ga0068855_1004236063 | 151 |
| 65 | 3300005614 | Ga0068856_100012093 | Ga0068856_10001209313 | 151 |
| 66 | 3300005614 | Ga0068856_102401466 | Ga0068856_1024014661 | 151 |
| 67 | 3300005615 | Ga0070702_100008536 | Ga0070702_1000085369 | 151 |
| 68 | 3300005718 | Ga0068866_10074411 | Ga0068866_100744112 | 151 |
| 69 | 3300005842 | Ga0068858_100053837 | Ga0068858_1000538376 | 151 |
| 70 | 3300005844 | Ga0068862_100302832 | Ga0068862_1003028322 | 151 |
| 71 | 3300005985 | Ga0081539_10002641 | Ga0081539_100026417 | 151 |
| 72 | 3300005985 | Ga0081539_10128753 | Ga0081539_101287531 | 151 |
| 73 | 3300006028 | Ga0070717_10015770 | Ga0070717_100157706 | 151 |
| 74 | 3300006028 | Ga0070717_10466164 | Ga0070717_104661643 | 151 |
| 75 | 3300006175 | Ga0070712_100005922 | Ga0070712_1000059222 | 151 |
| 76 | 3300006175 | Ga0070712_100027500 | Ga0070712_1000275006 | 151 |
| 77 | 3300006175 | Ga0070712_100434150 | Ga0070712_1004341503 | 151 |
| 78 | 3300006175 | Ga0070712_100531750 | Ga0070712_1005317502 | 151 |
| 79 | 3300006237 | Ga0097621_100129237 | Ga0097621_1001292372 | 151 |
| 80 | 3300006358 | Ga0068871_100039536 | Ga0068871_1000395363 | 151 |
| 81 | 3300006881 | Ga0068865_100019162 | Ga0068865_1000191621 | 151 |
| 82 | 3300006914 | Ga0075436_100081851 | Ga0075436_1000818514 | 151 |
| 83 | 3300009093 | Ga0105240_10040877 | Ga0105240_100408777 | 151 |
| 84 | 3300009094 | Ga0111539_10015227 | Ga0111539_100152277 | 151 |
| 85 | 3300009098 | Ga0105245_10003129 | Ga0105245_1000312911 | 151 |
| 86 | 3300009098 | Ga0105245_11692550 | Ga0105245_116925501 | 151 |
| 87 | 3300009101 | Ga0105247_10053950 | Ga0105247_100539504 | 151 |
| 88 | 3300009147 | Ga0114129_10141619 | Ga0114129_101416192 | 151 |
| 89 | 3300009148 | Ga0105243_10014995 | Ga0105243_100149952 | 151 |
| 90 | 3300009176 | Ga0105242_10054559 | Ga0105242_100545596 | 151 |
| 91 | 3300009176 | Ga0105242_10432258 | Ga0105242_104322582 | 151 |
| 92 | 3300009177 | Ga0105248_10035208 | Ga0105248_100352086 | 151 |
| 93 | 3300009177 | Ga0105248_10291150 | Ga0105248_102911502 | 151 |
| 94 | 3300009545 | Ga0105237_10020791 | Ga0105237_100207912 | 151 |
| 95 | 3300009551 | Ga0105238_10373015 | Ga0105238_103730152 | 151 |
| 96 | 3300009551 | Ga0105238_11075008 | Ga0105238_110750082 | 151 |
| 97 | 3300009553 | Ga0105249_10000681 | Ga0105249_1000068122 | 151 |
| 98 | 3300010375 | Ga0105239_10015186 | Ga0105239_100151865 | 151 |
| 99 | 3300011119 | Ga0105246_10018607 | Ga0105246_100186076 | 151 |
| 100 | 3300011119 | Ga0105246_10235245 | Ga0105246_102352452 | 151 |
| 101 | 3300011119 | Ga0105246_10648326 | Ga0105246_106483262 | 151 |
| 102 | 3300013104 | Ga0157370_10734678 | Ga0157370_107346782 | 151 |
| 103 | 3300013296 | Ga0157374_10128922 | Ga0157374_101289223 | 151 |
| 104 | 3300013306 | Ga0163162_10037767 | Ga0163162_100377674 | 151 |
| 105 | 3300013308 | Ga0157375_10039284 | Ga0157375_100392844 | 151 |
| 106 | 3300013308 | Ga0157375_10081214 | Ga0157375_100812145 | 151 |
| 107 | 3300014325 | Ga0163163_11015296 | Ga0163163_110152962 | 151 |
| 108 | 3300014745 | Ga0157377_10012642 | Ga0157377_100126424 | 151 |
| 109 | 3300014968 | Ga0157379_10100029 | Ga0157379_101000292 | 151 |
| 110 | 3300015261 | Ga0182006_1221637 | Ga0182006_12216371 | 151 |
| 111 | 3300017792 | Ga0163161_10018850 | Ga0163161_100188509 | 151 |
| 112 | 3300020080 | Ga0206350_10394142 | Ga0206350_103941422 | 151 |
| 113 | 3300020082 | Ga0206353_10708315 | Ga0206353_107083152 | 151 |
| 114 | 3300025898 | Ga0207692_10008402 | Ga0207692_100084024 | 151 |
| 115 | 3300025899 | Ga0207642_10019387 | Ga0207642_100193874 | 151 |
| 116 | 3300025900 | Ga0207710_10060015 | Ga0207710_100600153 | 151 |
| 117 | 3300025901 | Ga0207688_10026672 | Ga0207688_100266727 | 151 |
| 118 | 3300025903 | Ga0207680_10020622 | Ga0207680_100206226 | 151 |
| 119 | 3300025905 | Ga0207685_10062827 | Ga0207685_100628272 | 151 |
| 120 | 3300025906 | Ga0207699_10016790 | Ga0207699_100167902 | 151 |
| 121 | 3300025910 | Ga0207684_10044770 | Ga0207684_100447707 | 151 |
| 122 | 3300025915 | Ga0207693_10015719 | Ga0207693_100157194 | 151 |
| 123 | 3300025915 | Ga0207693_10026600 | Ga0207693_100266006 | 151 |
| 124 | 3300025916 | Ga0207663_10013249 | Ga0207663_100132492 | 151 |
| 125 | 3300025916 | Ga0207663_10159872 | Ga0207663_101598724 | 151 |
| 126 | 3300025917 | Ga0207660_10077408 | Ga0207660_100774081 | 151 |
| 127 | 3300025918 | Ga0207662_10048306 | Ga0207662_100483062 | 151 |
| 128 | 3300025921 | Ga0207652_10183293 | Ga0207652_101832932 | 151 |
| 129 | 3300025922 | Ga0207646_10003525 | Ga0207646_1000352518 | 151 |
| 130 | 3300025925 | Ga0207650_11016956 | Ga0207650_110169561 | 151 |
| 131 | 3300025927 | Ga0207687_10045878 | Ga0207687_100458783 | 151 |
| 132 | 3300025934 | Ga0207686_10026482 | Ga0207686_100264823 | 151 |
| 133 | 3300025934 | Ga0207686_10190406 | Ga0207686_101904062 | 151 |
| 134 | 3300025935 | Ga0207709_10000823 | Ga0207709_100008238 | 151 |
| 135 | 3300025936 | Ga0207670_10004122 | Ga0207670_100041224 | 151 |
| 136 | 3300025936 | Ga0207670_10363004 | Ga0207670_103630042 | 151 |
| 137 | 3300025937 | Ga0207669_10028357 | Ga0207669_100283572 | 151 |
| 138 | 3300025938 | Ga0207704_10003551 | Ga0207704_100035515 | 151 |
| 139 | 3300025939 | Ga0207665_10041945 | Ga0207665_100419452 | 151 |
| 140 | 3300025940 | Ga0207691_10296727 | Ga0207691_102967272 | 151 |
| 141 | 3300025941 | Ga0207711_10026268 | Ga0207711_100262685 | 151 |
| 142 | 3300025941 | Ga0207711_10344723 | Ga0207711_103447233 | 151 |
| 143 | 3300025944 | Ga0207661_10001998 | Ga0207661_1000199816 | 151 |
| 144 | 3300025944 | Ga0207661_10581755 | Ga0207661_105817552 | 151 |
| 145 | 3300025961 | Ga0207712_10001535 | Ga0207712_1000153516 | 151 |
| 146 | 3300025972 | Ga0207668_10001571 | Ga0207668_100015715 | 151 |
| 147 | 3300026023 | Ga0207677_10790570 | Ga0207677_107905701 | 151 |
| 148 | 3300026041 | Ga0207639_10042782 | Ga0207639_100427826 | 151 |
| 149 | 3300026067 | Ga0207678_10251455 | Ga0207678_102514552 | 151 |
| 150 | 3300026075 | Ga0207708_10010501 | Ga0207708_100105012 | 151 |
| 151 | 3300026078 | Ga0207702_10065832 | Ga0207702_100658324 | 151 |
| 152 | 3300026089 | Ga0207648_10000097 | Ga0207648_1000009720 | 151 |
| 153 | 3300026095 | Ga0207676_10266658 | Ga0207676_102666582 | 151 |
| 154 | 3300026121 | Ga0207683_10000038 | Ga0207683_1000003888 | 151 |
| 155 | 3300028379 | Ga0268266_10091365 | Ga0268266_100913652 | 151 |
| 156 | 3300028380 | Ga0268265_10094966 | Ga0268265_100949661 | 151 |
| 157 | 3300031824 | Ga0307413_10039275 | Ga0307413_100392752 | 151 |
| 158 | 3300031852 | Ga0307410_11517676 | Ga0307410_115176761 | 151 |
| 159 | 3300031901 | Ga0307406_10055297 | Ga0307406_100552972 | 151 |
| 160 | 3300032005 | Ga0307411_10024445 | Ga0307411_100244452 | 151 |
| 161 | 3300032126 | Ga0307415_100017115 | Ga0307415_1000171154 | 151 |
| 162 | 3300035113 | Ga0373936_0388656 | Ga0373936_0388656_63_527 | 151 |
| 163 | 3300035725 | Ga0373947_0073117 | Ga0373947_0073117_778_1242 | 151 |
| 164 | 3300035725 | Ga0373947_0141698 | Ga0373947_0141698_307_771 | 151 |
| 165 | 3300037068 | Ga0373925_0109745 | Ga0373925_0109745_796_1260 | 151 |
| 166 | 3300037312 | Ga0395899_0012461 | Ga0395899_0012461_5877_6341 | 151 |
| 167 | 3300037312 | Ga0395899_0022426 | Ga0395899_0022426_2891_3352 | 151 |
| 168 | 3300037312 | Ga0395899_0043610 | Ga0395899_0043610_2267_2731 | 151 |
| 169 | 3300037418 | Ga0395900_0001661 | Ga0395900_0001661_259_720 | 151 |
| 170 | 3300037418 | Ga0395900_0005716 | Ga0395900_0005716_1652_2116 | 151 |
| 171 | 3300037418 | Ga0395900_0026222 | Ga0395900_0026222_2643_3107 | 151 |
| 172 | 3300037418 | Ga0395900_0084667 | Ga0395900_0084667_1296_1760 | 151 |
| 173 | 3300037418 | Ga0395900_0106543 | Ga0395900_0106543_1802_2266 | 151 |
| 174 | 3300037466 | Ga0395898_0004328 | Ga0395898_0004328_9310_9771 | 151 |
| 175 | 3300037466 | Ga0395898_0025504 | Ga0395898_0025504_2107_2571 | 151 |
| 176 | 3300037466 | Ga0395898_0072722 | Ga0395898_0072722_1123_1587 | 151 |
| 177 | 3300037466 | Ga0395898_0140998 | Ga0395898_0140998_1044_1508 | 151 |
| 178 | 3300037466 | Ga0395898_0469159 | Ga0395898_0469159_189_647 | 151 |
| 179 | 3300037471 | Ga0395905_0003336 | Ga0395905_0003336_15415_15876 | 151 |
| 180 | 3300037471 | Ga0395905_0019447 | Ga0395905_0019447_3361_3825 | 151 |
| 181 | 3300037471 | Ga0395905_0052189 | Ga0395905_0052189_881_1345 | 151 |
| 182 | 3300037471 | Ga0395905_0062176 | Ga0395905_0062176_1642_2106 | 151 |
| 183 | 3300037471 | Ga0395905_0181051 | Ga0395905_0181051_715_1179 | 151 |
| 184 | 3300037471 | Ga0395905_0305381 | Ga0395905_0305381_423_887 | 151 |
| 185 | 3300038443 | Ga0395901_0004995 | Ga0395901_0004995_212_676 | 151 |
| 186 | 3300038443 | Ga0395901_0013042 | Ga0395901_0013042_3468_3929 | 151 |
| 187 | 3300038443 | Ga0395901_0046765 | Ga0395901_0046765_622_1086 | 151 |
| 188 | 3300038443 | Ga0395901_0047097 | Ga0395901_0047097_2728_3192 | 151 |
| 189 | 3300038443 | Ga0395901_0368885 | Ga0395901_0368885_849_1313 | 151 |
| 190 | 3300038443 | Ga0395901_1067842 | Ga0395901_1067842_136_600 | 151 |
| 191 | 3300041452 | Ga0451793_0184281 | Ga0451793_0184281_1552_2046 | 151 |
| 192 | 3300041486 | Ga0451807_0422792 | Ga0451807_0422792_15_479 | 151 |
| 193 | 3300041494 | Ga0451837_0630977 | Ga0451837_0630977_3483_3977 | 151 |
| 194 | 3300041507 | Ga0451851_0168620 | Ga0451851_0168620_24_485 | 151 |
| 195 | 3300044694 | Ga0466963_0561411 | Ga0466963_0561411_168_626 | 151 |
| 196 | 3300045976 | Ga0466967_0066356 | Ga0466967_0066356_2442_2900 | 151 |
| 197 | 3300045976 | Ga0466967_0830639 | Ga0466967_0830639_158_616 | 151 |
| 198 | 3300046473 | Ga0495582_0141729 | Ga0495582_0141729_751_1215 | 151 |
| 199 | 3300046474 | Ga0495605_0047235 | Ga0495605_0047235_1179_1643 | 151 |
| 200 | 3300046475 | Ga0495639_0063801 | Ga0495639_0063801_29_493 | 151 |
| 201 | 3300046491 | Ga0495584_0059027 | Ga0495584_0059027_1159_1623 | 151 |
| 202 | 3300046491 | Ga0495584_0198873 | Ga0495584_0198873_51_515 | 151 |
| 203 | 3300046491 | Ga0495584_0226184 | Ga0495584_0226184_156_620 | 151 |
| 204 | 3300046492 | Ga0495585_0230603 | Ga0495585_0230603_279_743 | 151 |
| 205 | 3300046500 | Ga0495596_0042160 | Ga0495596_0042160_877_1341 | 151 |
| 206 | 3300046501 | Ga0495607_0253021 | Ga0495607_0253021_197_661 | 151 |
| 207 | 3300046517 | Ga0495630_0153833 | Ga0495630_0153833_1131_1595 | 151 |
| 208 | 3300046518 | Ga0495631_0107917 | Ga0495631_0107917_540_1004 | 151 |
| 209 | 3300046520 | Ga0495637_0181445 | Ga0495637_0181445_27_491 | 151 |
| 210 | 3300046523 | Ga0495644_0088788 | Ga0495644_0088788_344_808 | 151 |
| 211 | 3300046525 | Ga0495663_0032625 | Ga0495663_0032625_555_1019 | 151 |
| 212 | 3300046526 | Ga0495666_0152732 | Ga0495666_0152732_168_632 | 151 |
| 213 | 3300046529 | Ga0495652_0426054 | Ga0495652_0426054_34_495 | 151 |
| 214 | 3300046538 | Ga0495609_0062602 | Ga0495609_0062602_370_834 | 151 |
| 215 | 3300046615 | Ga0495656_0084713 | Ga0495656_0084713_552_1016 | 151 |
| 216 | 3300046664 | Ga0495659_0028483 | Ga0495659_0028483_116_580 | 151 |
| 217 | 3300046665 | Ga0495661_0160590 | Ga0495661_0160590_142_606 | 151 |
| 218 | 3300046674 | Ga0495588_0077991 | Ga0495588_0077991_49_513 | 151 |
| 219 | 3300046683 | Ga0495658_0137338 | Ga0495658_0137338_61_525 | 151 |
| 220 | 3300046684 | Ga0495669_0370449 | Ga0495669_0370449_18_482 | 151 |
| 221 | 3300046690 | Ga0495624_0311657 | Ga0495624_0311657_403_867 | 151 |
| 222 | 3300046691 | Ga0495670_0489786 | Ga0495670_0489786_22_486 | 151 |
| 223 | 3300046794 | Ga0495589_0054689 | Ga0495589_0054689_1146_1610 | 151 |
| 224 | 3300047315 | Ga0495581_0099929 | Ga0495581_0099929_197_661 | 151 |
| 225 | 3300047318 | Ga0495636_0389521 | Ga0495636_0389521_10_474 | 151 |
| 226 | 3300047321 | Ga0495676_0017024 | Ga0495676_0017024_1503_1967 | 151 |
| 227 | 3300047321 | Ga0495676_0647141 | Ga0495676_0647141_171_635 | 151 |
| 228 | 3300047323 | Ga0495683_0127503 | Ga0495683_0127503_358_822 | 151 |
| 229 | 3300047445 | Ga0495677_0067000 | Ga0495677_0067000_318_782 | 151 |
| 230 | 3300048903 | Ga0496100_0025684 | Ga0496100_0025684_1341_1805 | 151 |
| 231 | 3300048904 | Ga0496101_0039743 | Ga0496101_0039743_1637_2101 | 151 |
| 232 | 3300048904 | Ga0496101_0075309 | Ga0496101_0075309_324_788 | 151 |
| 233 | 3300048905 | Ga0496102_0170273 | Ga0496102_0170273_1201_1665 | 151 |
| 234 | 3300048905 | Ga0496102_1310810 | Ga0496102_1310810_114_578 | 151 |
| 235 | 3300048906 | Ga0496103_0002524 | Ga0496103_0002524_7169_7633 | 151 |
| 236 | 3300048906 | Ga0496103_0839874 | Ga0496103_0839874_51_515 | 151 |
| 237 | 3300048907 | Ga0496104_0018643 | Ga0496104_0018643_329_787 | 151 |
| 238 | 3300048907 | Ga0496104_0122252 | Ga0496104_0122252_649_1113 | 151 |
| 239 | 3300048907 | Ga0496104_0459018 | Ga0496104_0459018_469_933 | 151 |
| 240 | 3300048908 | Ga0496105_0004665 | Ga0496105_0004665_3820_4278 | 151 |
| 241 | 3300048908 | Ga0496105_0052739 | Ga0496105_0052739_921_1385 | 151 |
| 242 | 3300048909 | Ga0496106_0001818 | Ga0496106_0001818_2499_2963 | 151 |
| 243 | 3300048910 | Ga0496107_0000389 | Ga0496107_0000389_11246_11710 | 151 |
| 244 | 3300048911 | Ga0496108_0055960 | Ga0496108_0055960_41_505 | 151 |
| 245 | 3300048911 | Ga0496108_0075704 | Ga0496108_0075704_1450_1914 | 151 |
| 246 | 3300048912 | Ga0496109_0050242 | Ga0496109_0050242_3125_3583 | 151 |
| 247 | 3300048912 | Ga0496109_0065498 | Ga0496109_0065498_2066_2530 | 151 |
| 248 | 3300048912 | Ga0496109_0170351 | Ga0496109_0170351_913_1377 | 151 |
| 249 | 3300048913 | Ga0496110_0067296 | Ga0496110_0067296_902_1366 | 151 |
| 250 | 3300048914 | Ga0496111_0091733 | Ga0496111_0091733_730_1194 | 151 |
| 251 | 3300048915 | Ga0496112_0085852 | Ga0496112_0085852_227_691 | 151 |
| 252 | 3300048915 | Ga0496112_0174562 | Ga0496112_0174562_315_773 | 151 |
| 253 | 3300048915 | Ga0496112_0965235 | Ga0496112_0965235_68_532 | 151 |
| 254 | 3300048916 | Ga0496113_0171876 | Ga0496113_0171876_333_797 | 151 |
| 255 | 3300048916 | Ga0496113_0190448 | Ga0496113_0190448_630_1094 | 151 |
| 256 | 3300048917 | Ga0496114_0018856 | Ga0496114_0018856_2803_3267 | 151 |
| 257 | 3300048917 | Ga0496114_0399487 | Ga0496114_0399487_31_495 | 151 |
| 258 | 3300048917 | Ga0496114_0441732 | Ga0496114_0441732_369_833 | 151 |
| 259 | 3300048918 | Ga0496115_0017633 | Ga0496115_0017633_2636_3100 | 151 |
| 260 | 3300049742 | Ga0501080_0084696 | Ga0501080_0084696_878_1339 | 151 |
| 261 | 3300050507 | nmdc:mga05p37_455627_c1 | nmdc:mga05p37_455627_c1_486_950 | 151 |
| 262 | 3300050510 | nmdc:mga06r32_607861_c1 | nmdc:mga06r32_607861_c1_173_637 | 151 |
| 263 | 3300002075 | JGI24738J21930_10045478 | JGI24738J21930_100454782 | 152 |
| 264 | 3300005328 | Ga0070676_10229085 | Ga0070676_102290852 | 152 |
| 265 | 3300005330 | Ga0070690_100422036 | Ga0070690_1004220362 | 152 |
| 266 | 3300005334 | Ga0068869_100394738 | Ga0068869_1003947381 | 152 |
| 267 | 3300005335 | Ga0070666_10964423 | Ga0070666_109644231 | 152 |
| 268 | 3300005336 | Ga0070680_100041033 | Ga0070680_1000410332 | 152 |
| 269 | 3300005338 | Ga0068868_100118276 | Ga0068868_1001182762 | 152 |
| 270 | 3300005338 | Ga0068868_100226790 | Ga0068868_1002267902 | 152 |
| 271 | 3300005339 | Ga0070660_100121303 | Ga0070660_1001213033 | 152 |
| 272 | 3300005340 | Ga0070689_100370615 | Ga0070689_1003706152 | 152 |
| 273 | 3300005341 | Ga0070691_10103802 | Ga0070691_101038022 | 152 |
| 274 | 3300005345 | Ga0070692_10115921 | Ga0070692_101159212 | 152 |
| 275 | 3300005347 | Ga0070668_100083638 | Ga0070668_1000836382 | 152 |
| 276 | 3300005347 | Ga0070668_100105834 | Ga0070668_1001058343 | 152 |
| 277 | 3300005353 | Ga0070669_100237244 | Ga0070669_1002372442 | 152 |
| 278 | 3300005356 | Ga0070674_100004454 | Ga0070674_1000044541 | 152 |
| 279 | 3300005356 | Ga0070674_100073229 | Ga0070674_1000732293 | 152 |
| 280 | 3300005356 | Ga0070674_100143669 | Ga0070674_1001436693 | 152 |
| 281 | 3300005364 | Ga0070673_100360266 | Ga0070673_1003602662 | 152 |
| 282 | 3300005364 | Ga0070673_101125842 | Ga0070673_1011258421 | 152 |
| 283 | 3300005365 | Ga0070688_101559163 | Ga0070688_1015591631 | 152 |
| 284 | 3300005367 | Ga0070667_101727423 | Ga0070667_1017274231 | 152 |
| 285 | 3300005406 | Ga0070703_10003330 | Ga0070703_100033305 | 152 |
| 286 | 3300005434 | Ga0070709_10983293 | Ga0070709_109832931 | 152 |
| 287 | 3300005435 | Ga0070714_100043623 | Ga0070714_1000436233 | 152 |
| 288 | 3300005435 | Ga0070714_100062239 | Ga0070714_1000622393 | 152 |
| 289 | 3300005437 | Ga0070710_10087276 | Ga0070710_100872763 | 152 |
| 290 | 3300005438 | Ga0070701_10156909 | Ga0070701_101569092 | 152 |
| 291 | 3300005439 | Ga0070711_100049931 | Ga0070711_1000499312 | 152 |
| 292 | 3300005439 | Ga0070711_100256668 | Ga0070711_1002566682 | 152 |
| 293 | 3300005440 | Ga0070705_100034721 | Ga0070705_1000347212 | 152 |
| 294 | 3300005440 | Ga0070705_100050528 | Ga0070705_1000505281 | 152 |
| 295 | 3300005440 | Ga0070705_100093044 | Ga0070705_1000930441 | 152 |
| 296 | 3300005440 | Ga0070705_100119316 | Ga0070705_1001193163 | 152 |
| 297 | 3300005441 | Ga0070700_100034572 | Ga0070700_1000345724 | 152 |
| 298 | 3300005441 | Ga0070700_100169157 | Ga0070700_1001691572 | 152 |
| 299 | 3300005444 | Ga0070694_100018563 | Ga0070694_1000185634 | 152 |
| 300 | 3300005444 | Ga0070694_100018723 | Ga0070694_1000187232 | 152 |
| 301 | 3300005445 | Ga0070708_100081904 | Ga0070708_1000819042 | 152 |
| 302 | 3300005445 | Ga0070708_100317525 | Ga0070708_1003175252 | 152 |
| 303 | 3300005457 | Ga0070662_100051825 | Ga0070662_1000518254 | 152 |
| 304 | 3300005458 | Ga0070681_10011124 | Ga0070681_100111243 | 152 |
| 305 | 3300005467 | Ga0070706_100235264 | Ga0070706_1002352642 | 152 |
| 306 | 3300005467 | Ga0070706_100274519 | Ga0070706_1002745191 | 152 |
| 307 | 3300005467 | Ga0070706_100409191 | Ga0070706_1004091912 | 152 |
| 308 | 3300005468 | Ga0070707_100007253 | Ga0070707_10000725313 | 152 |
| 309 | 3300005468 | Ga0070707_100119191 | Ga0070707_1001191914 | 152 |
| 310 | 3300005468 | Ga0070707_101431808 | Ga0070707_1014318081 | 152 |
| 311 | 3300005471 | Ga0070698_100052260 | Ga0070698_1000522602 | 152 |
| 312 | 3300005518 | Ga0070699_100029006 | Ga0070699_1000290063 | 152 |
| 313 | 3300005518 | Ga0070699_101036285 | Ga0070699_1010362851 | 152 |
| 314 | 3300005530 | Ga0070679_100241510 | Ga0070679_1002415103 | 152 |
| 315 | 3300005535 | Ga0070684_100574792 | Ga0070684_1005747921 | 152 |
| 316 | 3300005539 | Ga0068853_100042148 | Ga0068853_1000421482 | 152 |
| 317 | 3300005539 | Ga0068853_100287994 | Ga0068853_1002879943 | 152 |
| 318 | 3300005539 | Ga0068853_100437892 | Ga0068853_1004378922 | 152 |
| 319 | 3300005543 | Ga0070672_100248156 | Ga0070672_1002481562 | 152 |
| 320 | 3300005544 | Ga0070686_100070726 | Ga0070686_1000707261 | 152 |
| 321 | 3300005545 | Ga0070695_100009953 | Ga0070695_1000099535 | 152 |
| 322 | 3300005545 | Ga0070695_100132289 | Ga0070695_1001322892 | 152 |
| 323 | 3300005545 | Ga0070695_100233849 | Ga0070695_1002338492 | 152 |
| 324 | 3300005546 | Ga0070696_100008980 | Ga0070696_1000089802 | 152 |
| 325 | 3300005546 | Ga0070696_101073038 | Ga0070696_1010730381 | 152 |
| 326 | 3300005547 | Ga0070693_100028041 | Ga0070693_1000280414 | 152 |
| 327 | 3300005547 | Ga0070693_100051595 | Ga0070693_1000515953 | 152 |
| 328 | 3300005549 | Ga0070704_100039799 | Ga0070704_1000397993 | 152 |
| 329 | 3300005549 | Ga0070704_100077259 | Ga0070704_1000772593 | 152 |
| 330 | 3300005549 | Ga0070704_100145511 | Ga0070704_1001455112 | 152 |
| 331 | 3300005578 | Ga0068854_100058798 | Ga0068854_1000587984 | 152 |
| 332 | 3300005615 | Ga0070702_100001552 | Ga0070702_1000015522 | 152 |
| 333 | 3300005615 | Ga0070702_100015668 | Ga0070702_1000156681 | 152 |
| 334 | 3300005615 | Ga0070702_100071348 | Ga0070702_1000713481 | 152 |
| 335 | 3300005617 | Ga0068859_100155364 | Ga0068859_1001553642 | 152 |
| 336 | 3300005618 | Ga0068864_100099597 | Ga0068864_1000995973 | 152 |
| 337 | 3300005718 | Ga0068866_10091606 | Ga0068866_100916062 | 152 |
| 338 | 3300005718 | Ga0068866_10306999 | Ga0068866_103069992 | 152 |
| 339 | 3300005718 | Ga0068866_11040518 | Ga0068866_110405182 | 152 |
| 340 | 3300005719 | Ga0068861_100108882 | Ga0068861_1001088822 | 152 |
| 341 | 3300005719 | Ga0068861_100235900 | Ga0068861_1002359002 | 152 |
| 342 | 3300005842 | Ga0068858_100052385 | Ga0068858_1000523852 | 152 |
| 343 | 3300005842 | Ga0068858_100313295 | Ga0068858_1003132953 | 152 |
| 344 | 3300005843 | Ga0068860_100190503 | Ga0068860_1001905033 | 152 |
| 345 | 3300005844 | Ga0068862_100211695 | Ga0068862_1002116952 | 152 |
| 346 | 3300005981 | Ga0081538_10019400 | Ga0081538_100194003 | 152 |
| 347 | 3300005981 | Ga0081538_10060176 | Ga0081538_100601763 | 152 |
| 348 | 3300005983 | Ga0081540_1002420 | Ga0081540_100242014 | 152 |
| 349 | 3300005985 | Ga0081539_10037946 | Ga0081539_100379463 | 152 |
| 350 | 3300006175 | Ga0070712_100002885 | Ga0070712_1000028859 | 152 |
| 351 | 3300006237 | Ga0097621_100314158 | Ga0097621_1003141582 | 152 |
| 352 | 3300006871 | Ga0075434_100211706 | Ga0075434_1002117063 | 152 |
| 353 | 3300006914 | Ga0075436_100464899 | Ga0075436_1004648992 | 152 |
| 354 | 3300006931 | Ga0097620_100155362 | Ga0097620_1001553622 | 152 |
| 355 | 3300007076 | Ga0075435_100012673 | Ga0075435_1000126734 | 152 |
| 356 | 3300007076 | Ga0075435_100117412 | Ga0075435_1001174123 | 152 |
| 357 | 3300009092 | Ga0105250_10061532 | Ga0105250_100615322 | 152 |
| 358 | 3300009098 | Ga0105245_10045513 | Ga0105245_100455133 | 152 |
| 359 | 3300009098 | Ga0105245_10068781 | Ga0105245_100687813 | 152 |
| 360 | 3300009098 | Ga0105245_10209227 | Ga0105245_102092272 | 152 |
| 361 | 3300009098 | Ga0105245_10426569 | Ga0105245_104265692 | 152 |
| 362 | 3300009098 | Ga0105245_11142114 | Ga0105245_111421142 | 152 |
| 363 | 3300009101 | Ga0105247_10228655 | Ga0105247_102286552 | 152 |
| 364 | 3300009147 | Ga0114129_10119515 | Ga0114129_101195153 | 152 |
| 365 | 3300009148 | Ga0105243_10083842 | Ga0105243_100838422 | 152 |
| 366 | 3300009148 | Ga0105243_10125712 | Ga0105243_101257122 | 152 |
| 367 | 3300009148 | Ga0105243_10315303 | Ga0105243_103153032 | 152 |
| 368 | 3300009176 | Ga0105242_10073289 | Ga0105242_100732894 | 152 |
| 369 | 3300009176 | Ga0105242_10290667 | Ga0105242_102906672 | 152 |
| 370 | 3300009177 | Ga0105248_10474976 | Ga0105248_104749762 | 152 |
| 371 | 3300009177 | Ga0105248_10534168 | Ga0105248_105341682 | 152 |
| 372 | 3300009553 | Ga0105249_10003025 | Ga0105249_100030255 | 152 |
| 373 | 3300009553 | Ga0105249_10137439 | Ga0105249_101374392 | 152 |
| 374 | 3300010375 | Ga0105239_10040817 | Ga0105239_100408175 | 152 |
| 375 | 3300010375 | Ga0105239_10267233 | Ga0105239_102672332 | 152 |
| 376 | 3300010375 | Ga0105239_10574081 | Ga0105239_105740812 | 152 |
| 377 | 3300010375 | Ga0105239_11239073 | Ga0105239_112390731 | 152 |
| 378 | 3300011119 | Ga0105246_10116830 | Ga0105246_101168302 | 152 |
| 379 | 3300012473 | Ga0157340_1014888 | Ga0157340_10148881 | 152 |
| 380 | 3300012480 | Ga0157346_1019523 | Ga0157346_10195231 | 152 |
| 381 | 3300012495 | Ga0157323_1005420 | Ga0157323_10054202 | 152 |
| 382 | 3300013104 | Ga0157370_11284123 | Ga0157370_112841231 | 152 |
| 383 | 3300013105 | Ga0157369_10425098 | Ga0157369_104250983 | 152 |
| 384 | 3300013105 | Ga0157369_10618170 | Ga0157369_106181702 | 152 |
| 385 | 3300013297 | Ga0157378_10573757 | Ga0157378_105737572 | 152 |
| 386 | 3300013297 | Ga0157378_10589535 | Ga0157378_105895352 | 152 |
| 387 | 3300013297 | Ga0157378_10773746 | Ga0157378_107737462 | 152 |
| 388 | 3300013306 | Ga0163162_10021273 | Ga0163162_100212734 | 152 |
| 389 | 3300013306 | Ga0163162_10236358 | Ga0163162_102363583 | 152 |
| 390 | 3300013307 | Ga0157372_10326715 | Ga0157372_103267153 | 152 |
| 391 | 3300013308 | Ga0157375_10110329 | Ga0157375_101103292 | 152 |
| 392 | 3300014325 | Ga0163163_10063106 | Ga0163163_100631063 | 152 |
| 393 | 3300014326 | Ga0157380_10382078 | Ga0157380_103820782 | 152 |
| 394 | 3300014326 | Ga0157380_10992272 | Ga0157380_109922722 | 152 |
| 395 | 3300014497 | Ga0182008_10127695 | Ga0182008_101276951 | 152 |
| 396 | 3300014745 | Ga0157377_10025935 | Ga0157377_100259352 | 152 |
| 397 | 3300014745 | Ga0157377_10044924 | Ga0157377_100449243 | 152 |
| 398 | 3300014969 | Ga0157376_10613019 | Ga0157376_106130192 | 152 |
| 399 | 3300015261 | Ga0182006_1232102 | Ga0182006_12321022 | 152 |
| 400 | 3300015262 | Ga0182007_10030115 | Ga0182007_100301153 | 152 |
| 401 | 3300020070 | Ga0206356_11642986 | Ga0206356_116429861 | 152 |
| 402 | 3300020082 | Ga0206353_12030080 | Ga0206353_120300806 | 152 |
| 403 | 3300025898 | Ga0207692_10346127 | Ga0207692_103461272 | 152 |
| 404 | 3300025900 | Ga0207710_10043800 | Ga0207710_100438002 | 152 |
| 405 | 3300025900 | Ga0207710_10106421 | Ga0207710_101064211 | 152 |
| 406 | 3300025901 | Ga0207688_10011869 | Ga0207688_100118692 | 152 |
| 407 | 3300025906 | Ga0207699_10812044 | Ga0207699_108120442 | 152 |
| 408 | 3300025907 | Ga0207645_10008858 | Ga0207645_100088582 | 152 |
| 409 | 3300025910 | Ga0207684_10475803 | Ga0207684_104758032 | 152 |
| 410 | 3300025912 | Ga0207707_10012654 | Ga0207707_100126546 | 152 |
| 411 | 3300025913 | Ga0207695_10737638 | Ga0207695_107376381 | 152 |
| 412 | 3300025914 | Ga0207671_10814953 | Ga0207671_108149531 | 152 |
| 413 | 3300025916 | Ga0207663_11274383 | Ga0207663_112743831 | 152 |
| 414 | 3300025918 | Ga0207662_10056980 | Ga0207662_100569802 | 152 |
| 415 | 3300025919 | Ga0207657_10223630 | Ga0207657_102236303 | 152 |
| 416 | 3300025920 | Ga0207649_10637080 | Ga0207649_106370802 | 152 |
| 417 | 3300025921 | Ga0207652_10061109 | Ga0207652_100611094 | 152 |
| 418 | 3300025922 | Ga0207646_10005850 | Ga0207646_1000585015 | 152 |
| 419 | 3300025922 | Ga0207646_10076566 | Ga0207646_100765666 | 152 |
| 420 | 3300025923 | Ga0207681_10279969 | Ga0207681_102799692 | 152 |
| 421 | 3300025924 | Ga0207694_10721796 | Ga0207694_107217962 | 152 |
| 422 | 3300025926 | Ga0207659_11925323 | Ga0207659_119253231 | 152 |
| 423 | 3300025927 | Ga0207687_10040312 | Ga0207687_100403124 | 152 |
| 424 | 3300025927 | Ga0207687_10195103 | Ga0207687_101951032 | 152 |
| 425 | 3300025927 | Ga0207687_10239978 | Ga0207687_102399783 | 152 |
| 426 | 3300025929 | Ga0207664_10029121 | Ga0207664_100291214 | 152 |
| 427 | 3300025929 | Ga0207664_11402195 | Ga0207664_114021951 | 152 |
| 428 | 3300025932 | Ga0207690_10125225 | Ga0207690_101252253 | 152 |
| 429 | 3300025933 | Ga0207706_10006238 | Ga0207706_100062386 | 152 |
| 430 | 3300025933 | Ga0207706_10018859 | Ga0207706_100188596 | 152 |
| 431 | 3300025934 | Ga0207686_10301968 | Ga0207686_103019682 | 152 |
| 432 | 3300025935 | Ga0207709_10024643 | Ga0207709_100246433 | 152 |
| 433 | 3300025935 | Ga0207709_10055694 | Ga0207709_100556942 | 152 |
| 434 | 3300025937 | Ga0207669_10093582 | Ga0207669_100935824 | 152 |
| 435 | 3300025937 | Ga0207669_10112375 | Ga0207669_101123753 | 152 |
| 436 | 3300025938 | Ga0207704_11148046 | Ga0207704_111480461 | 152 |
| 437 | 3300025939 | Ga0207665_10409793 | Ga0207665_104097932 | 152 |
| 438 | 3300025940 | Ga0207691_10396458 | Ga0207691_103964582 | 152 |
| 439 | 3300025941 | Ga0207711_10349892 | Ga0207711_103498922 | 152 |
| 440 | 3300025941 | Ga0207711_10562889 | Ga0207711_105628892 | 152 |
| 441 | 3300025961 | Ga0207712_10006034 | Ga0207712_100060347 | 152 |
| 442 | 3300025972 | Ga0207668_10032218 | Ga0207668_100322184 | 152 |
| 443 | 3300025972 | Ga0207668_10328534 | Ga0207668_103285341 | 152 |
| 444 | 3300025981 | Ga0207640_10316622 | Ga0207640_103166222 | 152 |
| 445 | 3300026023 | Ga0207677_10197016 | Ga0207677_101970162 | 152 |
| 446 | 3300026023 | Ga0207677_10355351 | Ga0207677_103553512 | 152 |
| 447 | 3300026023 | Ga0207677_11701104 | Ga0207677_117011041 | 152 |
| 448 | 3300026023 | Ga0207677_11719793 | Ga0207677_117197931 | 152 |
| 449 | 3300026035 | Ga0207703_10034712 | Ga0207703_100347122 | 152 |
| 450 | 3300026035 | Ga0207703_10150195 | Ga0207703_101501952 | 152 |
| 451 | 3300026041 | Ga0207639_10563307 | Ga0207639_105633072 | 152 |
| 452 | 3300026075 | Ga0207708_10005998 | Ga0207708_100059989 | 152 |
| 453 | 3300026075 | Ga0207708_10060071 | Ga0207708_100600712 | 152 |
| 454 | 3300026075 | Ga0207708_10173934 | Ga0207708_101739342 | 152 |
| 455 | 3300026089 | Ga0207648_10028628 | Ga0207648_100286287 | 152 |
| 456 | 3300026089 | Ga0207648_10078870 | Ga0207648_100788704 | 152 |
| 457 | 3300026095 | Ga0207676_10026117 | Ga0207676_100261172 | 152 |
| 458 | 3300026095 | Ga0207676_10365294 | Ga0207676_103652942 | 152 |
| 459 | 3300026118 | Ga0207675_100001912 | Ga0207675_1000019128 | 152 |
| 460 | 3300026118 | Ga0207675_100178849 | Ga0207675_1001788492 | 152 |
| 461 | 3300026118 | Ga0207675_100207451 | Ga0207675_1002074513 | 152 |
| 462 | 3300026118 | Ga0207675_100265613 | Ga0207675_1002656133 | 152 |
| 463 | 3300026142 | Ga0207698_10095551 | Ga0207698_100955512 | 152 |
| 464 | 3300027907 | Ga0207428_10002883 | Ga0207428_100028836 | 152 |
| 465 | 3300028380 | Ga0268265_10319433 | Ga0268265_103194332 | 152 |
| 466 | 3300028380 | Ga0268265_10520187 | Ga0268265_105201872 | 152 |
| 467 | 3300028381 | Ga0268264_11576849 | Ga0268264_115768491 | 152 |
| 468 | 3300028563 | Ga0265319_1004631 | Ga0265319_100463111 | 152 |
| 469 | 3300028573 | Ga0265334_10118695 | Ga0265334_101186952 | 152 |
| 470 | 3300028654 | Ga0265322_10012031 | Ga0265322_100120312 | 152 |
| 471 | 3300028666 | Ga0265336_10025764 | Ga0265336_100257642 | 152 |
| 472 | 3300028800 | Ga0265338_10098477 | Ga0265338_100984773 | 152 |
| 473 | 3300031238 | Ga0265332_10000830 | Ga0265332_100008304 | 152 |
| 474 | 3300031240 | Ga0265320_10038881 | Ga0265320_100388812 | 152 |
| 475 | 3300031242 | Ga0265329_10030443 | Ga0265329_100304432 | 152 |
| 476 | 3300031249 | Ga0265339_10002754 | Ga0265339_1000275413 | 152 |
| 477 | 3300031250 | Ga0265331_10157106 | Ga0265331_101571061 | 152 |
| 478 | 3300031711 | Ga0265314_10039431 | Ga0265314_100394312 | 152 |
| 479 | 3300031824 | Ga0307413_10305559 | Ga0307413_103055592 | 152 |
| 480 | 3300031824 | Ga0307413_10970779 | Ga0307413_109707791 | 152 |
| 481 | 3300031995 | Ga0307409_100106705 | Ga0307409_1001067051 | 152 |
| 482 | 3300032002 | Ga0307416_100373303 | Ga0307416_1003733032 | 152 |
| 483 | 3300032002 | Ga0307416_102131483 | Ga0307416_1021314832 | 152 |
| 484 | 3300032002 | Ga0307416_102552427 | Ga0307416_1025524271 | 152 |
| 485 | 3300032005 | Ga0307411_10129185 | Ga0307411_101291852 | 152 |
| 486 | 3300034816 | Ga0373930_0006042 | Ga0373930_0006042_324_782 | 152 |
| 487 | 3300034817 | Ga0373948_0019024 | Ga0373948_0019024_640_1098 | 152 |
| 488 | 3300034820 | Ga0373959_0214727 | Ga0373959_0214727_16_477 | 152 |
| 489 | 3300034957 | Ga0373938_0229262 | Ga0373938_0229262_47_508 | 152 |
| 490 | 3300035085 | Ga0373929_0037821 | Ga0373929_0037821_85_543 | 152 |
| 491 | 3300035089 | Ga0373944_0272644 | Ga0373944_0272644_10_471 | 152 |
| 492 | 3300035090 | Ga0373949_0003557 | Ga0373949_0003557_672_1130 | 152 |
| 493 | 3300035091 | Ga0373951_0001825 | Ga0373951_0001825_3852_4310 | 152 |
| 494 | 3300035092 | Ga0373952_0006760 | Ga0373952_0006760_783_1241 | 152 |
| 495 | 3300035112 | Ga0373932_0008867 | Ga0373932_0008867_406_864 | 152 |
| 496 | 3300035114 | Ga0373939_0017759 | Ga0373939_0017759_249_707 | 152 |
| 497 | 3300035115 | Ga0373941_0001105 | Ga0373941_0001105_1802_2260 | 152 |
| 498 | 3300035170 | Ga0373943_0487315 | Ga0373943_0487315_110_571 | 152 |
| 499 | 3300035171 | Ga0373946_0011487 | Ga0373946_0011487_1540_2001 | 152 |
| 500 | 3300035207 | Ga0373942_0054474 | Ga0373942_0054474_278_736 | 152 |
| 501 | 3300035242 | Ga0373962_0002255 | Ga0373962_0002255_4081_4539 | 152 |
| 502 | 3300035398 | Ga0316574_0015191 | Ga0316574_0015191_999_1457 | 152 |
| 503 | 3300035691 | Ga0373931_0015842 | Ga0373931_0015842_2135_2593 | 152 |
| 504 | 3300035725 | Ga0373947_0046859 | Ga0373947_0046859_1930_2391 | 152 |
| 505 | 3300036401 | Ga0373937_0005831 | Ga0373937_0005831_7122_7580 | 152 |
| 506 | 3300037312 | Ga0395899_0007102 | Ga0395899_0007102_3934_4395 | 152 |
| 507 | 3300037312 | Ga0395899_0036492 | Ga0395899_0036492_385_843 | 152 |
| 508 | 3300037312 | Ga0395899_0553088 | Ga0395899_0553088_37_498 | 152 |
| 509 | 3300037418 | Ga0395900_0016989 | Ga0395900_0016989_6907_7365 | 152 |
| 510 | 3300037418 | Ga0395900_0019506 | Ga0395900_0019506_1138_1605 | 152 |
| 511 | 3300037418 | Ga0395900_0023789 | Ga0395900_0023789_3136_3597 | 152 |
| 512 | 3300037418 | Ga0395900_0072861 | Ga0395900_0072861_2764_3222 | 152 |
| 513 | 3300037418 | Ga0395900_0142244 | Ga0395900_0142244_1733_2200 | 152 |
| 514 | 3300037418 | Ga0395900_0182653 | Ga0395900_0182653_1653_2114 | 152 |
| 515 | 3300037418 | Ga0395900_0392784 | Ga0395900_0392784_782_1240 | 152 |
| 516 | 3300037466 | Ga0395898_0003643 | Ga0395898_0003643_8331_8789 | 152 |
| 517 | 3300037466 | Ga0395898_0006068 | Ga0395898_0006068_9486_9947 | 152 |
| 518 | 3300037466 | Ga0395898_0031445 | Ga0395898_0031445_291_758 | 152 |
| 519 | 3300037466 | Ga0395898_0990406 | Ga0395898_0990406_292_753 | 152 |
| 520 | 3300037471 | Ga0395905_0008963 | Ga0395905_0008963_7175_7633 | 152 |
| 521 | 3300037471 | Ga0395905_0014334 | Ga0395905_0014334_969_1427 | 152 |
| 522 | 3300037471 | Ga0395905_0154775 | Ga0395905_0154775_1468_1935 | 152 |
| 523 | 3300037471 | Ga0395905_0397142 | Ga0395905_0397142_684_1142 | 152 |
| 524 | 3300037471 | Ga0395905_0585997 | Ga0395905_0585997_337_798 | 152 |
| 525 | 3300038443 | Ga0395901_0000956 | Ga0395901_0000956_16760_17227 | 152 |
| 526 | 3300038443 | Ga0395901_0070904 | Ga0395901_0070904_3025_3486 | 152 |
| 527 | 3300038443 | Ga0395901_0162730 | Ga0395901_0162730_1359_1820 | 152 |
| 528 | 3300038443 | Ga0395901_0174570 | Ga0395901_0174570_970_1428 | 152 |
| 529 | 3300038443 | Ga0395901_0524070 | Ga0395901_0524070_153_611 | 152 |
| 530 | 3300038443 | Ga0395901_0539897 | Ga0395901_0539897_178_636 | 152 |
| 531 | 3300038443 | Ga0395901_0550367 | Ga0395901_0550367_23_481 | 152 |
| 532 | 3300038699 | Ga0242422_09518 | Ga0242422_09518_12_473 | 152 |
| 533 | 3300038996 | Ga0242420_068899 | Ga0242420_068899_126_587 | 152 |
| 534 | 3300039437 | Ga0436365_0209504 | Ga0436365_0209504_181_639 | 152 |
| 535 | 3300039450 | Ga0436363_1175972 | Ga0436363_1175972_24_485 | 152 |
| 536 | 3300042000 | Ga0439437_021989 | Ga0439437_021989_193_654 | 152 |
| 537 | 3300042005 | Ga0439448_0007952 | Ga0439448_0007952_1052_1513 | 152 |
| 538 | 3300042146 | Ga0450907_004419 | Ga0450907_004419_1738_2196 | 152 |
| 539 | 3300044694 | Ga0466963_0008599 | Ga0466963_0008599_4268_4726 | 152 |
| 540 | 3300044694 | Ga0466963_0294336 | Ga0466963_0294336_212_670 | 152 |
| 541 | 3300044719 | Ga0466971_0012510 | Ga0466971_0012510_2827_3285 | 152 |
| 542 | 3300044842 | Ga0466957_0012714 | Ga0466957_0012714_1730_2188 | 152 |
| 543 | 3300044842 | Ga0466957_0013907 | Ga0466957_0013907_2381_2839 | 152 |
| 544 | 3300044901 | Ga0466960_0028499 | Ga0466960_0028499_1488_1946 | 152 |
| 545 | 3300044901 | Ga0466960_0048693 | Ga0466960_0048693_457_915 | 152 |
| 546 | 3300045051 | Ga0451576_0021703 | Ga0451576_0021703_5130_5588 | 152 |
| 547 | 3300045836 | Ga0466958_0069980 | Ga0466958_0069980_1556_2014 | 152 |
| 548 | 3300045836 | Ga0466958_1033685 | Ga0466958_1033685_22_483 | 152 |
| 549 | 3300045976 | Ga0466967_0001385 | Ga0466967_0001385_9646_10104 | 152 |
| 550 | 3300045976 | Ga0466967_0031189 | Ga0466967_0031189_2102_2560 | 152 |
| 551 | 3300045976 | Ga0466967_0829781 | Ga0466967_0829781_448_906 | 152 |
| 552 | 3300046455 | Ga0495603_0000394 | Ga0495603_0000394_21443_21904 | 152 |
| 553 | 3300046455 | Ga0495603_0082422 | Ga0495603_0082422_769_1227 | 152 |
| 554 | 3300046461 | Ga0495641_0005687 | Ga0495641_0005687_1655_2116 | 152 |
| 555 | 3300046461 | Ga0495641_0034890 | Ga0495641_0034890_1071_1529 | 152 |
| 556 | 3300046463 | Ga0495653_0556184 | Ga0495653_0556184_114_572 | 152 |
| 557 | 3300046472 | Ga0495580_0294289 | Ga0495580_0294289_495_956 | 152 |
| 558 | 3300046473 | Ga0495582_0345785 | Ga0495582_0345785_106_567 | 152 |
| 559 | 3300046474 | Ga0495605_0229456 | Ga0495605_0229456_263_721 | 152 |
| 560 | 3300046499 | Ga0495594_0000597 | Ga0495594_0000597_15925_16386 | 152 |
| 561 | 3300046500 | Ga0495596_0148737 | Ga0495596_0148737_219_680 | 152 |
| 562 | 3300046518 | Ga0495631_0170337 | Ga0495631_0170337_421_882 | 152 |
| 563 | 3300046526 | Ga0495666_0159231 | Ga0495666_0159231_414_875 | 152 |
| 564 | 3300046531 | Ga0495665_0097452 | Ga0495665_0097452_206_664 | 152 |
| 565 | 3300046531 | Ga0495665_0421653 | Ga0495665_0421653_32_517 | 152 |
| 566 | 3300046533 | Ga0495640_0284474 | Ga0495640_0284474_177_662 | 152 |
| 567 | 3300046557 | Ga0495622_0090480 | Ga0495622_0090480_740_1201 | 152 |
| 568 | 3300046559 | Ga0495667_0084055 | Ga0495667_0084055_585_1043 | 152 |
| 569 | 3300046615 | Ga0495656_0350189 | Ga0495656_0350189_160_630 | 152 |
| 570 | 3300046642 | Ga0495634_0732201 | Ga0495634_0732201_79_537 | 152 |
| 571 | 3300046648 | Ga0495611_0535936 | Ga0495611_0535936_18_479 | 152 |
| 572 | 3300046674 | Ga0495588_0000483 | Ga0495588_0000483_4120_4581 | 152 |
| 573 | 3300046681 | Ga0495647_0038652 | Ga0495647_0038652_282_743 | 152 |
| 574 | 3300046681 | Ga0495647_0348723 | Ga0495647_0348723_104_565 | 152 |
| 575 | 3300046683 | Ga0495658_0386356 | Ga0495658_0386356_266_724 | 152 |
| 576 | 3300046691 | Ga0495670_0276311 | Ga0495670_0276311_202_660 | 152 |
| 577 | 3300046692 | Ga0495671_0570904 | Ga0495671_0570904_62_520 | 152 |
| 578 | 3300047315 | Ga0495581_0093423 | Ga0495581_0093423_614_1075 | 152 |
| 579 | 3300047319 | Ga0495674_0245018 | Ga0495674_0245018_284_769 | 152 |
| 580 | 3300047321 | Ga0495676_0010528 | Ga0495676_0010528_648_1109 | 152 |
| 581 | 3300047321 | Ga0495676_0046204 | Ga0495676_0046204_1943_2404 | 152 |
| 582 | 3300048089 | Ga0495614_0417762 | Ga0495614_0417762_39_497 | 152 |
| 583 | 3300048090 | Ga0495615_0135201 | Ga0495615_0135201_20_478 | 152 |
| 584 | 3300048903 | Ga0496100_0413035 | Ga0496100_0413035_192_650 | 152 |
| 585 | 3300048903 | Ga0496100_0877137 | Ga0496100_0877137_86_547 | 152 |
| 586 | 3300048904 | Ga0496101_0035677 | Ga0496101_0035677_1320_1781 | 152 |
| 587 | 3300048904 | Ga0496101_0290977 | Ga0496101_0290977_42_500 | 152 |
| 588 | 3300048904 | Ga0496101_0437689 | Ga0496101_0437689_102_563 | 152 |
| 589 | 3300048905 | Ga0496102_0046636 | Ga0496102_0046636_2725_3183 | 152 |
| 590 | 3300048905 | Ga0496102_0070848 | Ga0496102_0070848_1637_2098 | 152 |
| 591 | 3300048905 | Ga0496102_0122382 | Ga0496102_0122382_407_865 | 152 |
| 592 | 3300048905 | Ga0496102_0197236 | Ga0496102_0197236_112_594 | 152 |
| 593 | 3300048905 | Ga0496102_0312581 | Ga0496102_0312581_675_1133 | 152 |
| 594 | 3300048905 | Ga0496102_0696783 | Ga0496102_0696783_223_681 | 152 |
| 595 | 3300048905 | Ga0496102_1521808 | Ga0496102_1521808_21_479 | 152 |
| 596 | 3300048906 | Ga0496103_0079911 | Ga0496103_0079911_1399_1857 | 152 |
| 597 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_493673_494131 | 152 |
| 598 | 3300048907 | Ga0496104_0000432 | Ga0496104_0000432_14197_14658 | 152 |
| 599 | 3300048907 | Ga0496104_0018678 | Ga0496104_0018678_1982_2440 | 152 |
| 600 | 3300048907 | Ga0496104_1198745 | Ga0496104_1198745_187_645 | 152 |
| 601 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_691990_692448 | 152 |
| 602 | 3300048908 | Ga0496105_0000348 | Ga0496105_0000348_25922_26383 | 152 |
| 603 | 3300048908 | Ga0496105_0027494 | Ga0496105_0027494_654_1112 | 152 |
| 604 | 3300048908 | Ga0496105_0135018 | Ga0496105_0135018_471_938 | 152 |
| 605 | 3300048909 | Ga0496106_0026958 | Ga0496106_0026958_162_620 | 152 |
| 606 | 3300048909 | Ga0496106_0296337 | Ga0496106_0296337_72_530 | 152 |
| 607 | 3300048910 | Ga0496107_0007441 | Ga0496107_0007441_3713_4171 | 152 |
| 608 | 3300048910 | Ga0496107_0042096 | Ga0496107_0042096_1485_1946 | 152 |
| 609 | 3300048910 | Ga0496107_1177120 | Ga0496107_1177120_34_492 | 152 |
| 610 | 3300048911 | Ga0496108_0005047 | Ga0496108_0005047_2654_3115 | 152 |
| 611 | 3300048911 | Ga0496108_0022292 | Ga0496108_0022292_1188_1646 | 152 |
| 612 | 3300048911 | Ga0496108_0714008 | Ga0496108_0714008_72_530 | 152 |
| 613 | 3300048912 | Ga0496109_0037547 | Ga0496109_0037547_2539_2997 | 152 |
| 614 | 3300048912 | Ga0496109_0180199 | Ga0496109_0180199_1383_1841 | 152 |
| 615 | 3300048912 | Ga0496109_0297769 | Ga0496109_0297769_993_1460 | 152 |
| 616 | 3300048912 | Ga0496109_0356725 | Ga0496109_0356725_441_908 | 152 |
| 617 | 3300048913 | Ga0496110_0000944 | Ga0496110_0000944_16057_16518 | 152 |
| 618 | 3300048913 | Ga0496110_0111139 | Ga0496110_0111139_1962_2420 | 152 |
| 619 | 3300048913 | Ga0496110_0309694 | Ga0496110_0309694_198_656 | 152 |
| 620 | 3300048913 | Ga0496110_0382812 | Ga0496110_0382812_360_818 | 152 |
| 621 | 3300048913 | Ga0496110_1034925 | Ga0496110_1034925_126_584 | 152 |
| 622 | 3300048914 | Ga0496111_0000045 | Ga0496111_0000045_39607_40068 | 152 |
| 623 | 3300048914 | Ga0496111_0516167 | Ga0496111_0516167_349_816 | 152 |
| 624 | 3300048915 | Ga0496112_0014277 | Ga0496112_0014277_208_669 | 152 |
| 625 | 3300048915 | Ga0496112_0836085 | Ga0496112_0836085_225_683 | 152 |
| 626 | 3300048915 | Ga0496112_0894273 | Ga0496112_0894273_72_533 | 152 |
| 627 | 3300048916 | Ga0496113_0000076 | Ga0496113_0000076_40062_40523 | 152 |
| 628 | 3300048917 | Ga0496114_0028495 | Ga0496114_0028495_3343_3801 | 152 |
| 629 | 3300048917 | Ga0496114_0041150 | Ga0496114_0041150_1952_2413 | 152 |
| 630 | 3300048918 | Ga0496115_0008731 | Ga0496115_0008731_1805_2263 | 152 |
| 631 | 3300048925 | Ga0496122_0205098 | Ga0496122_0205098_281_739 | 152 |
| 632 | 3300048929 | Ga0496126_0014963 | Ga0496126_0014963_5649_6107 | 152 |
| 633 | 3300049569 | Ga0501032_0106529 | Ga0501032_0106529_415_873 | 152 |
| 634 | 3300049574 | Ga0501038_1336247 | Ga0501038_1336247_40_498 | 152 |
| 635 | 3300049578 | Ga0501042_0378920 | Ga0501042_0378920_527_985 | 152 |
| 636 | 3300049579 | Ga0501043_0041324 | Ga0501043_0041324_1744_2202 | 152 |
| 637 | 3300049580 | Ga0501046_0102715 | Ga0501046_0102715_713_1171 | 152 |
| 638 | 3300049581 | Ga0501047_0237422 | Ga0501047_0237422_402_860 | 152 |
| 639 | 3300049583 | Ga0501067_0009040 | Ga0501067_0009040_1442_1900 | 152 |
| 640 | 3300049583 | Ga0501067_0022007 | Ga0501067_0022007_697_1155 | 152 |
| 641 | 3300049583 | Ga0501067_0101540 | Ga0501067_0101540_748_1206 | 152 |
| 642 | 3300049584 | Ga0501068_0182180 | Ga0501068_0182180_717_1175 | 152 |
| 643 | 3300049585 | Ga0501069_0009379 | Ga0501069_0009379_2866_3324 | 152 |
| 644 | 3300049585 | Ga0501069_0032720 | Ga0501069_0032720_1161_1619 | 152 |
| 645 | 3300049585 | Ga0501069_0041169 | Ga0501069_0041169_1343_1804 | 152 |
| 646 | 3300049585 | Ga0501069_0060706 | Ga0501069_0060706_788_1246 | 152 |
| 647 | 3300049585 | Ga0501069_0179267 | Ga0501069_0179267_677_1135 | 152 |
| 648 | 3300049586 | Ga0501070_0010946 | Ga0501070_0010946_2716_3174 | 152 |
| 649 | 3300049588 | Ga0501072_0319992 | Ga0501072_0319992_299_757 | 152 |
| 650 | 3300049588 | Ga0501072_0873341 | Ga0501072_0873341_31_498 | 152 |
| 651 | 3300049589 | Ga0501073_0067037 | Ga0501073_0067037_766_1224 | 152 |
| 652 | 3300049590 | Ga0501074_0026101 | Ga0501074_0026101_3062_3520 | 152 |
| 653 | 3300049741 | Ga0501079_0005310 | Ga0501079_0005310_1473_1931 | 152 |
| 654 | 3300049742 | Ga0501080_0001819 | Ga0501080_0001819_4796_5254 | 152 |
| 655 | 3300049742 | Ga0501080_0118671 | Ga0501080_0118671_640_1098 | 152 |
| 656 | 3300049744 | Ga0501083_0016753 | Ga0501083_0016753_2680_3138 | 152 |
| 657 | 3300049744 | Ga0501083_0426098 | Ga0501083_0426098_355_813 | 152 |
| 658 | 3300049823 | Ga0501044_0055236 | Ga0501044_0055236_1537_1995 | 152 |
| 659 | 3300049824 | Ga0501045_0129363 | Ga0501045_0129363_883_1341 | 152 |
| 660 | 3300050507 | nmdc:mga05p37_304803_c1 | nmdc:mga05p37_304803_c1_785_1243 | 152 |
| 661 | 3300050507 | nmdc:mga05p37_758028_c1 | nmdc:mga05p37_758028_c1_569_1030 | 152 |
| 662 | 3300050510 | nmdc:mga06r32_59004_c1 | nmdc:mga06r32_59004_c1_3125_3586 | 152 |
| 663 | 3300050511 | nmdc:mga08y16_20136_c1 | nmdc:mga08y16_20136_c1_1912_2373 | 152 |
| 664 | 3300050512 | nmdc:mga0n895_5243_c1 | nmdc:mga0n895_5243_c1_2899_3360 | 152 |
| 665 | 3300050513 | nmdc:mga0rr50_294503_c1 | nmdc:mga0rr50_294503_c1_24_482 | 152 |
| 666 | 3300050513 | nmdc:mga0rr50_62604_c1 | nmdc:mga0rr50_62604_c1_1859_2320 | 152 |
| 667 | 3300050514 | nmdc:mga08x19_29306_c1 | nmdc:mga08x19_29306_c1_512_973 | 152 |
| 668 | 3300050514 | nmdc:mga08x19_77019_c1 | nmdc:mga08x19_77019_c1_1169_1627 | 152 |
| 669 | 3300050515 | nmdc:mga0a205_174868_c1 | nmdc:mga0a205_174868_c1_900_1358 | 152 |
| 670 | 3300050515 | nmdc:mga0a205_46736_c1 | nmdc:mga0a205_46736_c1_3237_3698 | 152 |
| 671 | 3300053077 | Ga0495601_0026997 | Ga0495601_0026997_2712_3197 | 152 |
| 672 | 3300053078 | Ga0495612_0532307 | Ga0495612_0532307_24_509 | 152 |
| 673 | 3300053084 | Ga0495595_0394799 | Ga0495595_0394799_22_507 | 152 |
| 674 | 3300059490 | Ga0587066_142228 | Ga0587066_142228_46_507 | 152 |
| 675 | 3300061719 | Ga0466962_0010804 | Ga0466962_0010804_2261_2719 | 152 |
| 676 | 3300061734 | Ga0530510_0087539 | Ga0530510_0087539_895_1353 | 152 |
| 677 | 3300061734 | Ga0530510_0194326 | Ga0530510_0194326_176_634 | 152 |
| 678 | 3300061734 | Ga0530510_1041787 | Ga0530510_1041787_89_547 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7l6z-assembly2.cif.gz_B | crystal structure of peptidyl-prolyl cis-trans isomerasefrom (ppib) streptococcus pneumoniae r6 | 0.9414 | 2 | 150 |
| 1xyh-assembly1.cif.gz_A | crystal structure of recombinant human cyclophilin j | 0.9377 | 3 | 152 |
| 2fu0-assembly1.cif.gz_A | plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain | 0.936 | 3 | 149 |
| 7abi-assembly1.cif.gz_t | human pre-bact-2 spliceosome | 0.9358 | 3 | 149 |
| 1zkc-assembly2.cif.gz_B | crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b | 0.9351 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MI74_1_173_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9438 | 3 | 149 | 2.40.100.10 |
| af_Q9FJX0_326_510_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9434 | 2 | 151 | 2.40.100.10 |
| af_Q2FZU9_3_197_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9385 | 2 | 152 | 2.40.100.10 |
| 1xyhA00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9377 | 3 | 152 | 2.40.100.10 |
| af_P52012_262_474_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9372 | 2 | 151 | 2.40.100.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0Z7N9-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9658 | 1 | 151 |
GO:0003755
GO:0006457 |
| AF-A0A1G2PES9-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9641 | 2 | 151 |
GO:0006457
GO:0140839 GO:0140840 |
| AF-A0A1F4USQ5-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9639 | 2 | 151 |
GO:0006457
GO:0140839 GO:0140840 |
| AF-K2FXM5-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9633 | 2 | 151 |
GO:0006457
GO:0140839 GO:0140840 |
| AF-A0A0G0TD74-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9628 | 2 | 152 |
GO:0006457
GO:0140839 GO:0140840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar