F474628

General Info

Members Datasets Scaffolds Average Seq Length
678 271 1356 94

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100273950|Ga0070714_1002739501
Length 101
Sequence MPYAPGMPLFILLSTLSQQGVQTLKSNPERLRQVNRDVEELGAKVLHQWATLGEFDFVNVVEAADVETIAKVSVALGARGSTRIETLPALEIEHFLQTLSE

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 2.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 8.11
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 23.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100273950 3300005435 Bacteria 1566
2 Ga0065707_10821782 3300005295 Bacteria 592
3 Ga0070658_10021374 3300005327 Bacteria 5186
4 Ga0070658_10040945 3300005327 Bacteria 3737
5 Ga0070658_10141706 3300005327 Bacteria 2008
6 Ga0070658_10783245 3300005327 Bacteria 828
7 Ga0070658_10843920 3300005327 Unclassified 796
8 Ga0070658_12001161 3300005327 Unclassified 500
9 Ga0070683_100014698 3300005329 Bacteria 6857
10 Ga0070683_100020650 3300005329 Bacteria 5863
11 Ga0070683_100031073 3300005329 Bacteria 4852
12 Ga0070683_100291229 3300005329 Bacteria 1553
13 Ga0070680_100056475 3300005336 Bacteria 3208
14 Ga0070680_100269672 3300005336 Unclassified 1441
15 Ga0070680_100467451 3300005336 Bacteria 1078
16 Ga0070682_100387730 3300005337 Bacteria 1053
17 Ga0068868_100335390 3300005338 Bacteria 1292
18 Ga0070660_100017422 3300005339 Bacteria 5236
19 Ga0070660_100049844 3300005339 Bacteria 3220
20 Ga0070660_101321331 3300005339 Unclassified 612
21 Ga0070660_101794307 3300005339 Bacteria 523
22 Ga0070691_10274037 3300005341 Bacteria 913
23 Ga0070661_100044592 3300005344 Bacteria 3239
24 Ga0070659_101109324 3300005366 Bacteria 697
25 Ga0070667_101174723 3300005367 Unclassified 718
26 Ga0070709_10635926 3300005434 Unclassified 825
27 Ga0070714_100020688 3300005435 Bacteria 5378
28 Ga0070714_100094704 3300005435 Bacteria 2621
29 Ga0070714_100138448 3300005435 Bacteria 2182
30 Ga0070714_100528123 3300005435 Bacteria 1128
31 Ga0070714_100533785 3300005435 Bacteria 1122
32 Ga0070714_100589247 3300005435 Archaea 1067
33 Ga0070714_101516646 3300005435 Bacteria 655
34 Ga0070714_101735191 3300005435 Unclassified 610
35 Ga0070714_101858748 3300005435 Bacteria 588
36 Ga0070714_101889914 3300005435 Unclassified 583
37 Ga0070714_102513187 3300005435 Unclassified 500
38 Ga0070713_100119772 3300005436 Unclassified 2307
39 Ga0070713_102365723 3300005436 Bacteria 514
40 Ga0070710_10175128 3300005437 Unclassified 1339
41 Ga0070710_10593691 3300005437 Bacteria 770
42 Ga0070701_10829418 3300005438 Bacteria 633
43 Ga0070711_100049404 3300005439 Bacteria 2881
44 Ga0070711_100384353 3300005439 Bacteria 1136
45 Ga0070705_100517370 3300005440 Bacteria 909
46 Ga0070708_100397865 3300005445 Bacteria 1299
47 Ga0070708_100653065 3300005445 Bacteria 991
48 Ga0070663_100553450 3300005455 Unclassified 962
49 Ga0070663_101407142 3300005455 Bacteria 618
50 Ga0070678_100262227 3300005456 Bacteria 1454
51 Ga0070678_100664440 3300005456 Bacteria 936
52 Ga0070681_10019900 3300005458 Bacteria 6726
53 Ga0070681_10161994 3300005458 Bacteria 2161
54 Ga0070681_10302264 3300005458 Unclassified 1510
55 Ga0070681_10492540 3300005458 Bacteria 1139
56 Ga0068867_101077209 3300005459 Unclassified 733
57 Ga0070706_100414084 3300005467 Bacteria 1255
58 Ga0070707_100509886 3300005468 Bacteria 1165
59 Ga0070707_100777730 3300005468 Bacteria 921
60 Ga0070707_100888074 3300005468 Bacteria 856
61 Ga0070698_101565635 3300005471 Bacteria 611
62 Ga0070699_100364724 3300005518 Bacteria 1303
63 Ga0070699_101561117 3300005518 Bacteria 605
64 Ga0070679_100065073 3300005530 Bacteria 3634
65 Ga0070679_100109947 3300005530 Bacteria 2742
66 Ga0070679_100167364 3300005530 Bacteria 2171
67 Ga0070679_100895170 3300005530 Unclassified 831
68 Ga0070679_101210101 3300005530 Unclassified 701
69 Ga0070679_101586879 3300005530 Bacteria 602
70 Ga0070684_100058628 3300005535 Bacteria 3365
71 Ga0070684_100059382 3300005535 Bacteria 3343
72 Ga0070684_100410114 3300005535 Bacteria 1250
73 Ga0070684_101738357 3300005535 Bacteria 588
74 Ga0070697_100529133 3300005536 Bacteria 1032
75 Ga0070697_101551672 3300005536 Bacteria 592
76 Ga0068853_101339029 3300005539 Unclassified 692
77 Ga0070695_100534343 3300005545 Bacteria 912
78 Ga0070695_100705813 3300005545 Bacteria 801
79 Ga0068855_100103445 3300005563 Bacteria 3276
80 Ga0068855_100480351 3300005563 Bacteria 1353
81 Ga0068855_102519068 3300005563 Bacteria 512
82 Ga0070664_101260651 3300005564 Unclassified 698
83 Ga0068857_100098496 3300005577 Bacteria 2622
84 Ga0068856_100168136 3300005614 Bacteria 2204
85 Ga0068856_101040788 3300005614 Bacteria 836
86 Ga0068856_101108220 3300005614 Bacteria 809
87 Ga0070702_100557016 3300005615 Bacteria 852
88 Ga0068852_100320733 3300005616 Bacteria 1505
89 Ga0068870_10052226 3300005840 Bacteria 2167
90 Ga0068863_101741703 3300005841 Unclassified 633
91 Ga0081455_10020969 3300005937 Bacteria 6140
92 Ga0070717_10206692 3300006028 Unclassified 1722
93 Ga0070717_10420690 3300006028 Unclassified 1202
94 Ga0070717_10901160 3300006028 Unclassified 805
95 Ga0070717_10989482 3300006028 Bacteria 766
96 Ga0070717_11300949 3300006028 Bacteria 661
97 Ga0070717_11847699 3300006028 Bacteria 546
98 Ga0070717_12024794 3300006028 Bacteria 519
99 Ga0070712_100013377 3300006175 Bacteria 5243
100 Ga0070712_100467619 3300006175 Bacteria 1052
101 Ga0070712_100939653 3300006175 Bacteria 747
102 Ga0097621_102391097 3300006237 Bacteria 506
103 Ga0068871_100981371 3300006358 Bacteria 786
104 Ga0075434_100256343 3300006871 Bacteria 1768
105 Ga0075434_101123386 3300006871 Bacteria 799
106 Ga0068865_100498195 3300006881 Unclassified 1015
107 Ga0099795_10381309 3300007788 Archaea 636
108 Ga0105240_10255691 3300009093 Bacteria 2023
109 Ga0105240_10488401 3300009093 Bacteria 1371
110 Ga0105245_10883840 3300009098 Unclassified 935
111 Ga0105245_11363227 3300009098 Bacteria 759
112 Ga0105245_11435914 3300009098 Bacteria 740
113 Ga0114129_12987954 3300009147 Unclassified 556
114 Ga0105241_11386207 3300009174 Unclassified 672
115 Ga0105248_10682833 3300009177 Unclassified 1158
116 Ga0105238_11388797 3300009551 Bacteria 729
117 Ga0157373_10182999 3300013100 Bacteria 1475
118 Ga0157373_10411135 3300013100 Bacteria 970
119 Ga0157373_10921079 3300013100 Unclassified 649
120 Ga0157371_10172416 3300013102 Bacteria 1546
121 Ga0157370_10032471 3300013104 Bacteria 5098
122 Ga0157370_10088924 3300013104 Bacteria 2901
123 Ga0157370_10346077 3300013104 Bacteria 1370
124 Ga0157370_10976749 3300013104 Bacteria 767
125 Ga0157370_11142537 3300013104 Bacteria 703
126 Ga0157369_10003200 3300013105 Bacteria 19524
127 Ga0157369_10004869 3300013105 Bacteria 15753
128 Ga0157369_10626808 3300013105 Bacteria 1109
129 Ga0157369_10694822 3300013105 Bacteria 1048
130 Ga0157369_11648417 3300013105 Bacteria 652
131 Ga0157369_11823415 3300013105 Unclassified 618
132 Ga0157369_12403477 3300013105 Unclassified 534
133 Ga0157374_11132829 3300013296 Unclassified 803
134 Ga0157374_12746538 3300013296 Unclassified 520
135 Ga0157378_13046789 3300013297 Bacteria 520
136 Ga0163162_13067028 3300013306 Unclassified 536
137 Ga0157372_10590391 3300013307 Bacteria 1295
138 Ga0157372_11454430 3300013307 Bacteria 790
139 Ga0157372_13460984 3300013307 Unclassified 502
140 Ga0157375_11264911 3300013308 Bacteria 867
141 Ga0163163_10941083 3300014325 Unclassified 927
142 Ga0182008_10005314 3300014497 Bacteria 7353
143 Ga0157376_10140291 3300014969 Bacteria 2167
144 Ga0157376_10305385 3300014969 Archaea 1508
145 Ga0182006_1025671 3300015261 Bacteria 2418
146 Ga0182007_10076073 3300015262 Unclassified 1100
147 Ga0182007_10427022 3300015262 Bacteria 508
148 Ga0197907_10267437 3300020069 Bacteria 1671
149 Ga0197907_10963986 3300020069 Unclassified 1285
150 Ga0197907_11254682 3300020069 Bacteria 608
151 Ga0206356_10174204 3300020070 Unclassified 1090
152 Ga0206356_10701452 3300020070 Bacteria 1493
153 Ga0206356_11028757 3300020070 Bacteria 750
154 Ga0206356_11192081 3300020070 Bacteria 1402
155 Ga0206356_11883155 3300020070 Bacteria 2235
156 Ga0206352_10574231 3300020078 Bacteria 501
157 Ga0206354_10004548 3300020081 Unclassified 1596
158 Ga0206354_10142278 3300020081 Bacteria 5542
159 Ga0206354_10301941 3300020081 Unclassified 1091
160 Ga0206353_10051125 3300020082 Bacteria 4168
161 Ga0206353_10282100 3300020082 Bacteria 584
162 Ga0206353_10317063 3300020082 Bacteria 650
163 Ga0154015_1261422 3300020610 Unclassified 715
164 Ga0224712_10195365 3300022467 Bacteria 918
165 Ga0224712_10275473 3300022467 Unclassified 782
166 Ga0207692_10439431 3300025898 Unclassified 819
167 Ga0207710_10488447 3300025900 Unclassified 638
168 Ga0207680_11176960 3300025903 Bacteria 547
169 Ga0207699_10348603 3300025906 Unclassified 1045
170 Ga0207643_10163680 3300025908 Unclassified 1339
171 Ga0207705_10129920 3300025909 Bacteria 1874
172 Ga0207705_10132690 3300025909 Bacteria 1854
173 Ga0207705_10314570 3300025909 Bacteria 1202
174 Ga0207705_10411764 3300025909 Bacteria 1046
175 Ga0207705_10509120 3300025909 Bacteria 935
176 Ga0207705_11029514 3300025909 Unclassified 636
177 Ga0207705_11339239 3300025909 Bacteria 546
178 Ga0207684_11031966 3300025910 Unclassified 687
179 Ga0207707_10018384 3300025912 Bacteria 6093
180 Ga0207707_10061795 3300025912 Bacteria 3260
181 Ga0207707_10143675 3300025912 Bacteria 2086
182 Ga0207707_10230075 3300025912 Bacteria 1613
183 Ga0207707_10475833 3300025912 Unclassified 1067
184 Ga0207695_10213205 3300025913 Bacteria 1841
185 Ga0207695_10779961 3300025913 Unclassified 836
186 Ga0207693_11117481 3300025915 Bacteria 598
187 Ga0207693_11429629 3300025915 Unclassified 512
188 Ga0207663_10525687 3300025916 Bacteria 922
189 Ga0207663_10885437 3300025916 Unclassified 713
190 Ga0207663_11683109 3300025916 Unclassified 510
191 Ga0207660_10079442 3300025917 Bacteria 2406
192 Ga0207660_10232325 3300025917 Unclassified 1450
193 Ga0207660_11094667 3300025917 Bacteria 649
194 Ga0207657_10001104 3300025919 Bacteria 28627
195 Ga0207657_10002919 3300025919 Bacteria 18353
196 Ga0207657_10014969 3300025919 Bacteria 7536
197 Ga0207657_10017609 3300025919 Bacteria 6845
198 Ga0207657_10968257 3300025919 Bacteria 654
199 Ga0207649_10102721 3300025920 Bacteria 1895
200 Ga0207652_10004470 3300025921 Bacteria 11386
201 Ga0207652_10062411 3300025921 Bacteria 3220
202 Ga0207652_10174843 3300025921 Bacteria 1928
203 Ga0207652_10376325 3300025921 Bacteria 1282
204 Ga0207652_10727539 3300025921 Unclassified 884
205 Ga0207652_11215059 3300025921 Bacteria 656
206 Ga0207652_11478857 3300025921 Unclassified 583
207 Ga0207646_10404079 3300025922 Bacteria 1233
208 Ga0207646_10523944 3300025922 Bacteria 1067
209 Ga0207646_10969086 3300025922 Bacteria 752
210 Ga0207694_10869289 3300025924 Bacteria 762
211 Ga0207687_10166702 3300025927 Unclassified 1695
212 Ga0207687_10866207 3300025927 Unclassified 772
213 Ga0207687_11205473 3300025927 Bacteria 651
214 Ga0207700_10213771 3300025928 Bacteria 1632
215 Ga0207700_10608692 3300025928 Bacteria 973
216 Ga0207700_11740099 3300025928 Bacteria 549
217 Ga0207664_10015703 3300025929 Bacteria 5505
218 Ga0207664_10094534 3300025929 Bacteria 2457
219 Ga0207664_10118480 3300025929 Bacteria 2212
220 Ga0207664_10129785 3300025929 Bacteria 2120
221 Ga0207664_10315288 3300025929 Archaea 1379
222 Ga0207664_10438572 3300025929 Bacteria 1165
223 Ga0207664_10990639 3300025929 Bacteria 753
224 Ga0207644_11295996 3300025931 Bacteria 612
225 Ga0207690_10677409 3300025932 Bacteria 847
226 Ga0207690_11497017 3300025932 Bacteria 564
227 Ga0207711_11105077 3300025941 Bacteria 734
228 Ga0207661_10024364 3300025944 Bacteria 4586
229 Ga0207661_10105571 3300025944 Bacteria 2374
230 Ga0207661_10121159 3300025944 Bacteria 2227
231 Ga0207661_10151018 3300025944 Bacteria 2008
232 Ga0207661_10242465 3300025944 Bacteria 1600
233 Ga0207661_10300026 3300025944 Bacteria 1440
234 Ga0207661_10577904 3300025944 Bacteria 1031
235 Ga0207679_11693600 3300025945 Unclassified 579
236 Ga0207667_10252658 3300025949 Bacteria 1803
237 Ga0207667_10292511 3300025949 Archaea 1664
238 Ga0207667_10765823 3300025949 Bacteria 964
239 Ga0207667_11092245 3300025949 Unclassified 781
240 Ga0207667_11483119 3300025949 Bacteria 650
241 Ga0207667_11630359 3300025949 Unclassified 613
242 Ga0207677_10301787 3300026023 Bacteria 1323
243 Ga0207678_10622041 3300026067 Bacteria 947
244 Ga0207678_11366548 3300026067 Bacteria 626
245 Ga0207702_10038773 3300026078 Bacteria 3991
246 Ga0207702_10133650 3300026078 Bacteria 2236
247 Ga0207702_10157865 3300026078 Bacteria 2069
248 Ga0207702_11954415 3300026078 Unclassified 577
249 Ga0207702_12040999 3300026078 Unclassified 564
250 Ga0207674_10123547 3300026116 Bacteria 2554
251 Ga0207674_10960793 3300026116 Bacteria 823
252 Ga0207683_10704254 3300026121 Bacteria 936
253 Ga0207698_10680292 3300026142 Unclassified 1022
254 Ga0265337_1052546 3300028556 Bacteria 1144
255 Ga0265337_1101504 3300028556 Viruses 783
256 Ga0265326_10158169 3300028558 Unclassified 648
257 Ga0265319_1061665 3300028563 Bacteria 1216
258 Ga0265334_10014296 3300028573 Bacteria 3310
259 Ga0265334_10295814 3300028573 Bacteria 554
260 Ga0265318_10176095 3300028577 Viruses 783
261 Ga0265318_10280087 3300028577 Unclassified 608
262 Ga0265323_10264768 3300028653 Unclassified 534
263 Ga0265322_10129724 3300028654 Bacteria 719
264 Ga0265338_10001061 3300028800 Bacteria 45726
265 Ga0265338_10041024 3300028800 Bacteria 4336
266 Ga0265328_10097393 3300031239 Bacteria 1088
267 Ga0265320_10274347 3300031240 Unclassified 747
268 Ga0265325_10026363 3300031241 Bacteria 3148
269 Ga0265340_10019066 3300031247 Bacteria 3533
270 Ga0265340_10188476 3300031247 Bacteria 931
271 Ga0265331_10045887 3300031250 Unclassified 2108
272 Ga0265327_10009412 3300031251 Bacteria 7052
273 Ga0265314_10438415 3300031711 Bacteria 698
274 Ga0265342_10155564 3300031712 Bacteria 1267
275 Ga0307405_10136991 3300031731 Bacteria 1701
276 Ga0307412_10658301 3300031911 Bacteria 894
277 Ga0307409_100228210 3300031995 Bacteria 1686
278 Ga0307416_100583872 3300032002 Unclassified 1195
279 Ga0307415_100285119 3300032126 Unclassified 1360
280 Ga0316583_10027040 3300032133 Bacteria 2048
281 Ga0373930_0126109 3300034816 Bacteria 627
282 Ga0373926_0064217 3300035083 Unclassified 1341
283 Ga0373926_0335750 3300035083 Bacteria 592
284 Ga0373934_0198865 3300035086 Unclassified 825
285 Ga0373934_0399495 3300035086 Unclassified 574
286 Ga0373944_0417465 3300035089 Bacteria 519
287 Ga0373936_0407129 3300035113 Bacteria 625
288 Ga0373945_0087329 3300035116 Bacteria 1203
289 Ga0373953_0427407 3300035117 Unclassified 584
290 Ga0373956_0027981 3300035119 Bacteria 2451
291 Ga0373956_0208880 3300035119 Bacteria 926
292 Ga0373957_0015440 3300035120 Bacteria 2628
293 Ga0373943_0004151 3300035170 Bacteria 6576
294 Ga0373955_0114068 3300035172 Unclassified 1565
295 Ga0373955_0372242 3300035172 Bacteria 866
296 Ga0373962_0352613 3300035242 Bacteria 532
297 Ga0373924_0065387 3300035410 Bacteria 1527
298 Ga0373924_0169375 3300035410 Unclassified 960
299 Ga0373935_0315059 3300035692 Bacteria 1109
300 Ga0373927_0327335 3300035695 Bacteria 1009
301 Ga0373933_0206893 3300035724 Unclassified 1257
302 Ga0373933_0862788 3300035724 Bacteria 596
303 Ga0373947_1010048 3300035725 Bacteria 567
304 Ga0373937_0029383 3300036401 Bacteria 4978
305 Ga0373937_0251008 3300036401 Bacteria 1668
306 Ga0373937_1988359 3300036401 Unclassified 527
307 Ga0373925_0272133 3300037068 Bacteria 1363
308 Ga0395899_0039816 3300037312 Bacteria 3516
309 Ga0395899_0130952 3300037312 Bacteria 1791
310 Ga0395899_0213646 3300037312 Bacteria 1339
311 Ga0395899_0989986 3300037312 Bacteria 508
312 Ga0395900_0028277 3300037418 Bacteria 5743
313 Ga0395900_0041052 3300037418 Bacteria 4771
314 Ga0395900_0118573 3300037418 Bacteria 2716
315 Ga0395900_0209036 3300037418 Bacteria 1971
316 Ga0395900_0279582 3300037418 Bacteria 1661
317 Ga0395900_0403402 3300037418 Bacteria 1331
318 Ga0395900_0910925 3300037418 Bacteria 802
319 Ga0395900_1357571 3300037418 Unclassified 624
320 Ga0395898_0024624 3300037466 Bacteria 6070
321 Ga0395898_0119584 3300037466 Bacteria 2524
322 Ga0395898_0136399 3300037466 Bacteria 2349
323 Ga0395898_0215187 3300037466 Bacteria 1833
324 Ga0395898_0386307 3300037466 Bacteria 1335
325 Ga0395898_0754136 3300037466 Unclassified 914
326 Ga0395898_0807227 3300037466 Bacteria 878
327 Ga0395898_1276464 3300037466 Bacteria 664
328 Ga0395898_1363730 3300037466 Bacteria 637
329 Ga0395898_1416966 3300037466 Unclassified 622
330 Ga0395905_0042696 3300037471 Bacteria 4254
331 Ga0395905_0102993 3300037471 Bacteria 2680
332 Ga0395905_0181870 3300037471 Bacteria 1974
333 Ga0395905_0232240 3300037471 Bacteria 1725
334 Ga0395905_0543926 3300037471 Unclassified 1062
335 Ga0395905_0991758 3300037471 Unclassified 743
336 Ga0395905_1081152 3300037471 Bacteria 705
337 Ga0395905_1147836 3300037471 Bacteria 680
338 Ga0395901_0004378 3300038443 Bacteria 14246
339 Ga0395901_0031826 3300038443 Bacteria 5439
340 Ga0395901_0135742 3300038443 Bacteria 2586
341 Ga0395901_0164192 3300038443 Unclassified 2332
342 Ga0395901_0354310 3300038443 Bacteria 1514
343 Ga0395901_0364844 3300038443 Bacteria 1488
344 Ga0395901_0376792 3300038443 Bacteria 1461
345 Ga0395901_0856039 3300038443 Unclassified 894
346 Ga0395901_1049632 3300038443 Unclassified 788
347 Ga0395901_1164636 3300038443 Unclassified 738
348 Ga0395901_1816261 3300038443 Bacteria 558
349 Ga0436365_0463966 3300039437 Unclassified 511
350 Ga0436365_1583841 3300039437 Bacteria 897
351 Ga0436365_1619546 3300039437 Bacteria 967
352 Ga0436363_0347133 3300039450 Bacteria 807
353 Ga0436363_0554650 3300039450 Bacteria 816
354 Ga0451807_1951536 3300041486 Bacteria 676
355 Ga0451853_1170030 3300041512 Unclassified 507
356 Ga0451853_1356713 3300041512 Bacteria 2724
357 Ga0439448_0222166 3300042005 Unclassified 664
358 Ga0439464_0084710 3300042439 Unclassified 950
359 Ga0466969_0001587 3300044656 Bacteria 12160
360 Ga0466969_0123031 3300044656 Bacteria 1207
361 Ga0466972_0162836 3300044658 Unclassified 1048
362 Ga0466965_0082941 3300044683 Bacteria 1622
363 Ga0466965_0429404 3300044683 Bacteria 733
364 Ga0466965_0733491 3300044683 Unclassified 569
365 Ga0466966_0005740 3300044684 Bacteria 8169
366 Ga0466966_0084392 3300044684 Bacteria 1975
367 Ga0466966_0105662 3300044684 Bacteria 1738
368 Ga0466966_0118152 3300044684 Bacteria 1631
369 Ga0466966_0361361 3300044684 Unclassified 872
370 Ga0466966_0394803 3300044684 Bacteria 831
371 Ga0466961_0119100 3300044693 Bacteria 1658
372 Ga0466961_0133392 3300044693 Bacteria 1556
373 Ga0466961_0788227 3300044693 Unclassified 567
374 Ga0466961_0908292 3300044693 Unclassified 524
375 Ga0466963_0000045 3300044694 Bacteria 40813
376 Ga0466963_0000742 3300044694 Bacteria 16070
377 Ga0466963_0001619 3300044694 Bacteria 12244
378 Ga0466963_0013627 3300044694 Bacteria 4997
379 Ga0466963_0045262 3300044694 Bacteria 2899
380 Ga0466963_0046621 3300044694 Archaea 2858
381 Ga0466963_0105297 3300044694 Bacteria 1933
382 Ga0466963_0105746 3300044694 Bacteria 1929
383 Ga0466963_0126419 3300044694 Unclassified 1763
384 Ga0466963_0166014 3300044694 Bacteria 1538
385 Ga0466963_0518237 3300044694 Unclassified 842
386 Ga0466963_0927785 3300044694 Bacteria 613
387 Ga0466963_0954305 3300044694 Unclassified 604
388 Ga0466964_0002707 3300044706 Bacteria 6353
389 Ga0466964_0054670 3300044706 Bacteria 1646
390 Ga0466964_0063979 3300044706 Bacteria 1538
391 Ga0466964_0119990 3300044706 Bacteria 1184
392 Ga0466964_0237830 3300044706 Bacteria 892
393 Ga0466964_0384433 3300044706 Unclassified 729
394 Ga0466964_0529508 3300044706 Unclassified 637
395 Ga0466971_0001256 3300044719 Bacteria 10570
396 Ga0466971_0112310 3300044719 Archaea 1258
397 Ga0466971_0144623 3300044719 Bacteria 1108
398 Ga0466968_0015466 3300044735 Bacteria 3024
399 Ga0466968_0021995 3300044735 Bacteria 2588
400 Ga0466968_0035223 3300044735 Bacteria 2094
401 Ga0466968_0054832 3300044735 Bacteria 1709
402 Ga0466968_0059578 3300044735 Unclassified 1645
403 Ga0466968_0091547 3300044735 Unclassified 1348
404 Ga0466968_0176104 3300044735 Unclassified 993
405 Ga0466968_0233547 3300044735 Unclassified 869
406 Ga0466970_0005565 3300044765 Bacteria 6259
407 Ga0466970_0439177 3300044765 Bacteria 747
408 Ga0466957_0000686 3300044842 Bacteria 17266
409 Ga0466957_0020963 3300044842 Bacteria 3846
410 Ga0466957_0036309 3300044842 Bacteria 2962
411 Ga0466957_0050455 3300044842 Bacteria 2532
412 Ga0466957_0195919 3300044842 Bacteria 1325
413 Ga0466957_0248609 3300044842 Bacteria 1182
414 Ga0466957_0256395 3300044842 Bacteria 1164
415 Ga0466957_0347423 3300044842 Unclassified 1006
416 Ga0466957_0491755 3300044842 Bacteria 849
417 Ga0466957_0500599 3300044842 Unclassified 842
418 Ga0466957_1101152 3300044842 Bacteria 573
419 Ga0466957_1113603 3300044842 Unclassified 569
420 Ga0466957_1261760 3300044842 Bacteria 536
421 Ga0466957_1290809 3300044842 Unclassified 530
422 Ga0466960_0113859 3300044901 Bacteria 1409
423 Ga0466960_0274342 3300044901 Unclassified 943
424 Ga0466960_0605554 3300044901 Unclassified 651
425 Ga0466960_0649037 3300044901 Bacteria 630
426 Ga0466959_0006849 3300045049 Bacteria 7944
427 Ga0466959_0030041 3300045049 Bacteria 4024
428 Ga0466959_0054074 3300045049 Bacteria 2934
429 Ga0466959_0115707 3300045049 Bacteria 1910
430 Ga0466959_0132723 3300045049 Bacteria 1764
431 Ga0451576_2402927 3300045051 Bacteria 539
432 Ga0466958_0034458 3300045836 Bacteria 3020
433 Ga0466958_0105168 3300045836 Bacteria 1758
434 Ga0466958_0105506 3300045836 Bacteria 1756
435 Ga0466958_0211272 3300045836 Bacteria 1236
436 Ga0466958_0334296 3300045836 Bacteria 974
437 Ga0466958_0340171 3300045836 Bacteria 965
438 Ga0466967_0000248 3300045976 Bacteria 23755
439 Ga0466967_0005994 3300045976 Bacteria 8536
440 Ga0466967_0006248 3300045976 Bacteria 8402
441 Ga0466967_0013790 3300045976 Bacteria 6263
442 Ga0466967_0028996 3300045976 Bacteria 4627
443 Ga0466967_0030595 3300045976 Bacteria 4520
444 Ga0466967_0044659 3300045976 Bacteria 3845
445 Ga0466967_0046221 3300045976 Bacteria 3789
446 Ga0466967_0061777 3300045976 Bacteria 3324
447 Ga0466967_0062850 3300045976 Bacteria 3297
448 Ga0466967_0071542 3300045976 Bacteria 3106
449 Ga0466967_0101004 3300045976 Bacteria 2636
450 Ga0466967_0144883 3300045976 Bacteria 2215
451 Ga0466967_0145790 3300045976 Unclassified 2208
452 Ga0466967_0179385 3300045976 Bacteria 1997
453 Ga0466967_0212070 3300045976 Bacteria 1837
454 Ga0466967_0226284 3300045976 Unclassified 1779
455 Ga0466967_0229292 3300045976 Unclassified 1768
456 Ga0466967_0362321 3300045976 Unclassified 1405
457 Ga0466967_0363280 3300045976 Unclassified 1403
458 Ga0466967_0404704 3300045976 Unclassified 1328
459 Ga0466967_0460910 3300045976 Bacteria 1243
460 Ga0466967_0465633 3300045976 Bacteria 1237
461 Ga0466967_0487336 3300045976 Bacteria 1208
462 Ga0466967_1005901 3300045976 Unclassified 830
463 Ga0466967_1018814 3300045976 Bacteria 824
464 Ga0466967_1030848 3300045976 Bacteria 819
465 Ga0466967_1167515 3300045976 Bacteria 767
466 Ga0466967_1293313 3300045976 Bacteria 726
467 Ga0466967_1462883 3300045976 Unclassified 680
468 Ga0466967_2342008 3300045976 Unclassified 529
469 Ga0495603_0710429 3300046455 Unclassified 575
470 Ga0495629_0706054 3300046459 Unclassified 669
471 Ga0495641_0042554 3300046461 Bacteria 2104
472 Ga0495641_0387962 3300046461 Bacteria 633
473 Ga0495641_0584335 3300046461 Bacteria 510
474 Ga0495651_0149048 3300046462 Bacteria 1689
475 Ga0495651_0663633 3300046462 Bacteria 652
476 Ga0495653_0036514 3300046463 Bacteria 3870
477 Ga0495653_0106063 3300046463 Bacteria 2027
478 Ga0495653_0514552 3300046463 Bacteria 745
479 Ga0495580_0368292 3300046472 Bacteria 972
480 Ga0495582_0085177 3300046473 Unclassified 1758
481 Ga0495582_0380874 3300046473 Unclassified 813
482 Ga0495664_0052136 3300046477 Bacteria 2430
483 Ga0495584_0085591 3300046491 Bacteria 1588
484 Ga0495584_0108332 3300046491 Bacteria 1405
485 Ga0495585_0601973 3300046492 Unclassified 517
486 Ga0495594_0744507 3300046499 Bacteria 553
487 Ga0495596_0434666 3300046500 Bacteria 512
488 Ga0495608_0005356 3300046511 Bacteria 9167
489 Ga0495608_0013987 3300046511 Bacteria 5567
490 Ga0495608_0394353 3300046511 Bacteria 847
491 Ga0495618_0578049 3300046514 Bacteria 670
492 Ga0495630_0057166 3300046517 Bacteria 2924
493 Ga0495630_0343203 3300046517 Bacteria 1143
494 Ga0495631_0184283 3300046518 Bacteria 894
495 Ga0495637_0351039 3300046520 Bacteria 517
496 Ga0495663_0052050 3300046525 Bacteria 1270
497 Ga0495642_0275254 3300046528 Bacteria 737
498 Ga0495642_0374623 3300046528 Bacteria 627
499 Ga0495652_0065292 3300046529 Bacteria 3058
500 Ga0495652_0138153 3300046529 Bacteria 1920
501 Ga0495652_0184854 3300046529 Unclassified 1596
502 Ga0495665_0132690 3300046531 Bacteria 1304
503 Ga0495587_0010553 3300046536 Bacteria 5875
504 Ga0495587_0098320 3300046536 Bacteria 1687
505 Ga0495667_0091540 3300046559 Bacteria 1970
506 Ga0495667_0154383 3300046559 Unclassified 1477
507 Ga0495656_0115562 3300046615 Bacteria 1261
508 Ga0495656_0203783 3300046615 Bacteria 983
509 Ga0495634_0043312 3300046642 Bacteria 3051
510 Ga0495611_0537664 3300046648 Bacteria 530
511 Ga0495635_0050980 3300046663 Bacteria 2853
512 Ga0495635_0225088 3300046663 Unclassified 1268
513 Ga0495661_0445211 3300046665 Bacteria 624
514 Ga0495588_0753256 3300046674 Bacteria 509
515 Ga0495657_0055341 3300046675 Bacteria 2647
516 Ga0495657_0062744 3300046675 Bacteria 2454
517 Ga0495657_0583008 3300046675 Unclassified 648
518 Ga0495599_0044374 3300046678 Bacteria 2788
519 Ga0495623_0196780 3300046679 Bacteria 1161
520 Ga0495623_0738448 3300046679 Unclassified 502
521 Ga0495646_0097604 3300046680 Bacteria 1688
522 Ga0495647_0158951 3300046681 Unclassified 973
523 Ga0495658_0275868 3300046683 Bacteria 1060
524 Ga0495613_0105338 3300046689 Unclassified 2036
525 Ga0495613_0667181 3300046689 Bacteria 687
526 Ga0495624_0161193 3300046690 Bacteria 1370
527 Ga0495624_0341355 3300046690 Unclassified 901
528 Ga0495600_0392319 3300046809 Unclassified 865
529 Ga0495581_0142491 3300047315 Bacteria 1399
530 Ga0495581_0672075 3300047315 Bacteria 598
531 Ga0495604_0039781 3300047317 Bacteria 3694
532 Ga0495604_0310941 3300047317 Bacteria 1056
533 Ga0495604_0612470 3300047317 Unclassified 697
534 Ga0495674_0039263 3300047319 Bacteria 4245
535 Ga0495674_0125666 3300047319 Bacteria 2164
536 Ga0495674_0901888 3300047319 Bacteria 682
537 Ga0495676_0101779 3300047321 Bacteria 2124
538 Ga0495676_0189501 3300047321 Bacteria 1435
539 Ga0495676_0448008 3300047321 Unclassified 852
540 Ga0495676_0968124 3300047321 Unclassified 544
541 Ga0495676_0995647 3300047321 Bacteria 535
542 Ga0495680_0015306 3300047322 Bacteria 6619
543 Ga0495680_0032766 3300047322 Bacteria 4214
544 Ga0495675_0093843 3300047444 Bacteria 1882
545 Ga0495684_0158496 3300047471 Bacteria 1689
546 Ga0495684_0422982 3300047471 Unclassified 931
547 Ga0495684_1090884 3300047471 Unclassified 501
548 Ga0495602_1090451 3300048088 Bacteria 524
549 Ga0496100_0002873 3300048903 Bacteria 8829
550 Ga0496100_0888328 3300048903 Unclassified 700
551 Ga0496100_1250105 3300048903 Bacteria 586
552 Ga0496101_0213196 3300048904 Bacteria 1496
553 Ga0496101_0491890 3300048904 Unclassified 969
554 Ga0496102_0004411 3300048905 Bacteria 11886
555 Ga0496102_0385265 3300048905 Bacteria 1319
556 Ga0496102_0499160 3300048905 Bacteria 1139
557 Ga0496103_0024537 3300048906 Bacteria 3641
558 Ga0496103_0504314 3300048906 Bacteria 774
559 Ga0496104_0138902 3300048907 Bacteria 2335
560 Ga0496104_0339180 3300048907 Unclassified 1416
561 Ga0496104_0940778 3300048907 Unclassified 769
562 Ga0496105_0026253 3300048908 Bacteria 4750
563 Ga0496105_0066005 3300048908 Bacteria 2986
564 Ga0496105_0100296 3300048908 Bacteria 2391
565 Ga0496105_1401699 3300048908 Unclassified 506
566 Ga0496106_0028830 3300048909 Bacteria 4137
567 Ga0496106_0070831 3300048909 Bacteria 2663
568 Ga0496106_1242738 3300048909 Bacteria 580
569 Ga0496107_0009417 3300048910 Bacteria 6777
570 Ga0496107_0085959 3300048910 Bacteria 2295
571 Ga0496108_0007544 3300048911 Bacteria 8817
572 Ga0496108_0097220 3300048911 Bacteria 2509
573 Ga0496108_0230534 3300048911 Unclassified 1610
574 Ga0496108_0585493 3300048911 Bacteria 973
575 Ga0496109_0044918 3300048912 Bacteria 4009
576 Ga0496109_0047917 3300048912 Bacteria 3887
577 Ga0496109_0053800 3300048912 Bacteria 3672
578 Ga0496109_0124580 3300048912 Bacteria 2402
579 Ga0496109_0336788 3300048912 Bacteria 1425
580 Ga0496109_0598490 3300048912 Bacteria 1039
581 Ga0496110_0399220 3300048913 Unclassified 1253
582 Ga0496111_0153466 3300048914 Bacteria 1709
583 Ga0496111_0340413 3300048914 Unclassified 1110
584 Ga0496111_0647201 3300048914 Bacteria 771
585 Ga0496112_0020070 3300048915 Bacteria 6327
586 Ga0496112_0023014 3300048915 Bacteria 5945
587 Ga0496112_0060683 3300048915 Bacteria 3727
588 Ga0496112_0276705 3300048915 Unclassified 1626
589 Ga0496112_0385125 3300048915 Unclassified 1343
590 Ga0496112_0539462 3300048915 Bacteria 1101
591 Ga0496112_1046476 3300048915 Bacteria 735
592 Ga0496112_1395535 3300048915 Bacteria 615
593 Ga0496113_1049588 3300048916 Bacteria 640
594 Ga0496114_0008800 3300048917 Bacteria 7999
595 Ga0496114_0130695 3300048917 Bacteria 2168
596 Ga0496114_0136277 3300048917 Archaea 2123
597 Ga0496114_0411493 3300048917 Archaea 1198
598 Ga0496114_1038648 3300048917 Bacteria 703
599 Ga0496114_1045240 3300048917 Bacteria 701
600 Ga0496115_0000468 3300048918 Bacteria 32165
601 Ga0496115_0003165 3300048918 Bacteria 11830
602 Ga0496115_0448111 3300048918 Bacteria 1043
603 Ga0501032_0794657 3300049569 Bacteria 598
604 Ga0501034_0065603 3300049571 Bacteria 3643
605 Ga0501037_0606206 3300049573 Bacteria 735
606 Ga0501043_0483196 3300049579 Bacteria 927
607 Ga0501046_0453813 3300049580 Bacteria 922
608 Ga0501047_0020647 3300049581 Bacteria 6324
609 Ga0501047_0030926 3300049581 Bacteria 5162
610 Ga0501047_0089203 3300049581 Bacteria 2961
611 Ga0501047_0114792 3300049581 Bacteria 2575
612 Ga0501047_0251911 3300049581 Bacteria 1614
613 Ga0501048_1191468 3300049582 Unclassified 548
614 Ga0501067_0016225 3300049583 Bacteria 4117
615 Ga0501067_0114053 3300049583 Bacteria 1503
616 Ga0501067_0182860 3300049583 Unclassified 1167
617 Ga0501068_0175729 3300049584 Unclassified 1353
618 Ga0501068_1156162 3300049584 Unclassified 512
619 Ga0501069_0041601 3300049585 Bacteria 2540
620 Ga0501069_0091310 3300049585 Bacteria 1722
621 Ga0501069_0112901 3300049585 Bacteria 1549
622 Ga0501069_0119334 3300049585 Bacteria 1506
623 Ga0501069_0799121 3300049585 Bacteria 572
624 Ga0501070_0000120 3300049586 Bacteria 70354
625 Ga0501070_0007509 3300049586 Bacteria 9263
626 Ga0501070_0026784 3300049586 Bacteria 4835
627 Ga0501070_0218691 3300049586 Bacteria 1562
628 Ga0501072_0007793 3300049588 Bacteria 8135
629 Ga0501072_0833647 3300049588 Bacteria 721
630 Ga0501073_0022897 3300049589 Bacteria 4493
631 Ga0501073_0025754 3300049589 Bacteria 4215
632 Ga0501074_0014259 3300049590 Bacteria 5780
633 Ga0501074_0017916 3300049590 Bacteria 5146
634 Ga0501074_0369585 3300049590 Bacteria 1017
635 Ga0501074_0475047 3300049590 Bacteria 886
636 Ga0501074_0492177 3300049590 Bacteria 869
637 Ga0501079_0103970 3300049741 Bacteria 2203
638 Ga0501079_0790433 3300049741 Bacteria 747
639 Ga0501079_1274216 3300049741 Unclassified 579
640 Ga0501080_0011468 3300049742 Bacteria 8113
641 Ga0501080_0118423 3300049742 Bacteria 2455
642 Ga0501080_0125573 3300049742 Bacteria 2376
643 Ga0501080_0192605 3300049742 Bacteria 1873
644 Ga0501080_0244275 3300049742 Bacteria 1638
645 Ga0501080_0363795 3300049742 Bacteria 1305
646 Ga0501080_1657067 3300049742 Bacteria 540
647 Ga0501083_0002282 3300049744 Bacteria 13123
648 Ga0501083_0948207 3300049744 Bacteria 560
649 Ga0501035_0630558 3300049822 Bacteria 871
650 Ga0501035_1027154 3300049822 Unclassified 647
651 Ga0501044_0247094 3300049823 Bacteria 1727
652 Ga0501045_1353934 3300049824 Unclassified 517
653 nmdc:mga0n895_27853_c1 3300050512 Bacteria 5369
654 nmdc:mga0rr50_115739_c1 3300050513 Bacteria 2128
655 nmdc:mga0rr50_214248_c1 3300050513 Bacteria 1588
656 nmdc:mga0a205_132950_c1 3300050515 Bacteria 2388
657 nmdc:mga0a205_728608_c1 3300050515 Bacteria 841
658 Ga0495601_0016450 3300053077 Unclassified 4482
659 Ga0495612_0212128 3300053078 Bacteria 856
660 Ga0495612_0255566 3300053078 Bacteria 780
661 Ga0500635_0305571 3300053080 Bacteria 628
662 Ga0495595_0007111 3300053084 Bacteria 4574
663 Ga0495595_0129934 3300053084 Bacteria 1231
664 Ga0495619_0004914 3300053085 Bacteria 8487
665 Ga0495619_0212704 3300053085 Bacteria 1339
666 Ga0501084_0124032 3300054114 Bacteria 2172
667 Ga0587106_131742 3300059605 Unclassified 540
668 Ga0587128_134805 3300059630 Bacteria 550
669 Ga0501082_0053269 3300060353 Bacteria 3488
670 Ga0466962_0004936 3300061719 Bacteria 6415
671 Ga0466962_0048060 3300061719 Bacteria 2039
672 Ga0466962_0062341 3300061719 Bacteria 1780
673 Ga0466962_0140435 3300061719 Bacteria 1170
674 Ga0466962_0208401 3300061719 Bacteria 956
675 Ga0530510_0353526 3300061734 Bacteria 1104
676 Ga0530510_0439075 3300061734 Bacteria 986
677 Ga0530510_0506338 3300061734 Bacteria 915
678 Ga0530510_0660382 3300061734 Unclassified 796
679 Ga0070714_100273950
680 Ga0065707_10821782
681 Ga0070658_10021374
682 Ga0070658_10040945
683 Ga0070658_10141706
684 Ga0070658_10783245
685 Ga0070658_10843920
686 Ga0070658_12001161
687 Ga0070683_100014698
688 Ga0070683_100020650
689 Ga0070683_100031073
690 Ga0070683_100291229
691 Ga0070680_100056475
692 Ga0070680_100269672
693 Ga0070680_100467451
694 Ga0070682_100387730
695 Ga0068868_100335390
696 Ga0070660_100017422
697 Ga0070660_100049844
698 Ga0070660_101321331
699 Ga0070660_101794307
700 Ga0070691_10274037
701 Ga0070661_100044592
702 Ga0070659_101109324
703 Ga0070667_101174723
704 Ga0070709_10635926
705 Ga0070714_100020688
706 Ga0070714_100094704
707 Ga0070714_100138448
708 Ga0070714_100528123
709 Ga0070714_100533785
710 Ga0070714_100589247
711 Ga0070714_101516646
712 Ga0070714_101735191
713 Ga0070714_101858748
714 Ga0070714_101889914
715 Ga0070714_102513187
716 Ga0070713_100119772
717 Ga0070713_102365723
718 Ga0070710_10175128
719 Ga0070710_10593691
720 Ga0070701_10829418
721 Ga0070711_100049404
722 Ga0070711_100384353
723 Ga0070705_100517370
724 Ga0070708_100397865
725 Ga0070708_100653065
726 Ga0070663_100553450
727 Ga0070663_101407142
728 Ga0070678_100262227
729 Ga0070678_100664440
730 Ga0070681_10019900
731 Ga0070681_10161994
732 Ga0070681_10302264
733 Ga0070681_10492540
734 Ga0068867_101077209
735 Ga0070706_100414084
736 Ga0070707_100509886
737 Ga0070707_100777730
738 Ga0070707_100888074
739 Ga0070698_101565635
740 Ga0070699_100364724
741 Ga0070699_101561117
742 Ga0070679_100065073
743 Ga0070679_100109947
744 Ga0070679_100167364
745 Ga0070679_100895170
746 Ga0070679_101210101
747 Ga0070679_101586879
748 Ga0070684_100058628
749 Ga0070684_100059382
750 Ga0070684_100410114
751 Ga0070684_101738357
752 Ga0070697_100529133
753 Ga0070697_101551672
754 Ga0068853_101339029
755 Ga0070695_100534343
756 Ga0070695_100705813
757 Ga0068855_100103445
758 Ga0068855_100480351
759 Ga0068855_102519068
760 Ga0070664_101260651
761 Ga0068857_100098496
762 Ga0068856_100168136
763 Ga0068856_101040788
764 Ga0068856_101108220
765 Ga0070702_100557016
766 Ga0068852_100320733
767 Ga0068870_10052226
768 Ga0068863_101741703
769 Ga0081455_10020969
770 Ga0070717_10206692
771 Ga0070717_10420690
772 Ga0070717_10901160
773 Ga0070717_10989482
774 Ga0070717_11300949
775 Ga0070717_11847699
776 Ga0070717_12024794
777 Ga0070712_100013377
778 Ga0070712_100467619
779 Ga0070712_100939653
780 Ga0097621_102391097
781 Ga0068871_100981371
782 Ga0075434_100256343
783 Ga0075434_101123386
784 Ga0068865_100498195
785 Ga0099795_10381309
786 Ga0105240_10255691
787 Ga0105240_10488401
788 Ga0105245_10883840
789 Ga0105245_11363227
790 Ga0105245_11435914
791 Ga0114129_12987954
792 Ga0105241_11386207
793 Ga0105248_10682833
794 Ga0105238_11388797
795 Ga0157373_10182999
796 Ga0157373_10411135
797 Ga0157373_10921079
798 Ga0157371_10172416
799 Ga0157370_10032471
800 Ga0157370_10088924
801 Ga0157370_10346077
802 Ga0157370_10976749
803 Ga0157370_11142537
804 Ga0157369_10003200
805 Ga0157369_10004869
806 Ga0157369_10626808
807 Ga0157369_10694822
808 Ga0157369_11648417
809 Ga0157369_11823415
810 Ga0157369_12403477
811 Ga0157374_11132829
812 Ga0157374_12746538
813 Ga0157378_13046789
814 Ga0163162_13067028
815 Ga0157372_10590391
816 Ga0157372_11454430
817 Ga0157372_13460984
818 Ga0157375_11264911
819 Ga0163163_10941083
820 Ga0182008_10005314
821 Ga0157376_10140291
822 Ga0157376_10305385
823 Ga0182006_1025671
824 Ga0182007_10076073
825 Ga0182007_10427022
826 Ga0197907_10267437
827 Ga0197907_10963986
828 Ga0197907_11254682
829 Ga0206356_10174204
830 Ga0206356_10701452
831 Ga0206356_11028757
832 Ga0206356_11192081
833 Ga0206356_11883155
834 Ga0206352_10574231
835 Ga0206354_10004548
836 Ga0206354_10142278
837 Ga0206354_10301941
838 Ga0206353_10051125
839 Ga0206353_10282100
840 Ga0206353_10317063
841 Ga0154015_1261422
842 Ga0224712_10195365
843 Ga0224712_10275473
844 Ga0207692_10439431
845 Ga0207710_10488447
846 Ga0207680_11176960
847 Ga0207699_10348603
848 Ga0207643_10163680
849 Ga0207705_10129920
850 Ga0207705_10132690
851 Ga0207705_10314570
852 Ga0207705_10411764
853 Ga0207705_10509120
854 Ga0207705_11029514
855 Ga0207705_11339239
856 Ga0207684_11031966
857 Ga0207707_10018384
858 Ga0207707_10061795
859 Ga0207707_10143675
860 Ga0207707_10230075
861 Ga0207707_10475833
862 Ga0207695_10213205
863 Ga0207695_10779961
864 Ga0207693_11117481
865 Ga0207693_11429629
866 Ga0207663_10525687
867 Ga0207663_10885437
868 Ga0207663_11683109
869 Ga0207660_10079442
870 Ga0207660_10232325
871 Ga0207660_11094667
872 Ga0207657_10001104
873 Ga0207657_10002919
874 Ga0207657_10014969
875 Ga0207657_10017609
876 Ga0207657_10968257
877 Ga0207649_10102721
878 Ga0207652_10004470
879 Ga0207652_10062411
880 Ga0207652_10174843
881 Ga0207652_10376325
882 Ga0207652_10727539
883 Ga0207652_11215059
884 Ga0207652_11478857
885 Ga0207646_10404079
886 Ga0207646_10523944
887 Ga0207646_10969086
888 Ga0207694_10869289
889 Ga0207687_10166702
890 Ga0207687_10866207
891 Ga0207687_11205473
892 Ga0207700_10213771
893 Ga0207700_10608692
894 Ga0207700_11740099
895 Ga0207664_10015703
896 Ga0207664_10094534
897 Ga0207664_10118480
898 Ga0207664_10129785
899 Ga0207664_10315288
900 Ga0207664_10438572
901 Ga0207664_10990639
902 Ga0207644_11295996
903 Ga0207690_10677409
904 Ga0207690_11497017
905 Ga0207711_11105077
906 Ga0207661_10024364
907 Ga0207661_10105571
908 Ga0207661_10121159
909 Ga0207661_10151018
910 Ga0207661_10242465
911 Ga0207661_10300026
912 Ga0207661_10577904
913 Ga0207679_11693600
914 Ga0207667_10252658
915 Ga0207667_10292511
916 Ga0207667_10765823
917 Ga0207667_11092245
918 Ga0207667_11483119
919 Ga0207667_11630359
920 Ga0207677_10301787
921 Ga0207678_10622041
922 Ga0207678_11366548
923 Ga0207702_10038773
924 Ga0207702_10133650
925 Ga0207702_10157865
926 Ga0207702_11954415
927 Ga0207702_12040999
928 Ga0207674_10123547
929 Ga0207674_10960793
930 Ga0207683_10704254
931 Ga0207698_10680292
932 Ga0265337_1052546
933 Ga0265337_1101504
934 Ga0265326_10158169
935 Ga0265319_1061665
936 Ga0265334_10014296
937 Ga0265334_10295814
938 Ga0265318_10176095
939 Ga0265318_10280087
940 Ga0265323_10264768
941 Ga0265322_10129724
942 Ga0265338_10001061
943 Ga0265338_10041024
944 Ga0265328_10097393
945 Ga0265320_10274347
946 Ga0265325_10026363
947 Ga0265340_10019066
948 Ga0265340_10188476
949 Ga0265331_10045887
950 Ga0265327_10009412
951 Ga0265314_10438415
952 Ga0265342_10155564
953 Ga0307405_10136991
954 Ga0307412_10658301
955 Ga0307409_100228210
956 Ga0307416_100583872
957 Ga0307415_100285119
958 Ga0316583_10027040
959 Ga0373930_0126109
960 Ga0373926_0064217
961 Ga0373926_0335750
962 Ga0373934_0198865
963 Ga0373934_0399495
964 Ga0373944_0417465
965 Ga0373936_0407129
966 Ga0373945_0087329
967 Ga0373953_0427407
968 Ga0373956_0027981
969 Ga0373956_0208880
970 Ga0373957_0015440
971 Ga0373943_0004151
972 Ga0373955_0114068
973 Ga0373955_0372242
974 Ga0373962_0352613
975 Ga0373924_0065387
976 Ga0373924_0169375
977 Ga0373935_0315059
978 Ga0373927_0327335
979 Ga0373933_0206893
980 Ga0373933_0862788
981 Ga0373947_1010048
982 Ga0373937_0029383
983 Ga0373937_0251008
984 Ga0373937_1988359
985 Ga0373925_0272133
986 Ga0395899_0039816
987 Ga0395899_0130952
988 Ga0395899_0213646
989 Ga0395899_0989986
990 Ga0395900_0028277
991 Ga0395900_0041052
992 Ga0395900_0118573
993 Ga0395900_0209036
994 Ga0395900_0279582
995 Ga0395900_0403402
996 Ga0395900_0910925
997 Ga0395900_1357571
998 Ga0395898_0024624
999 Ga0395898_0119584
1000 Ga0395898_0136399
1001 Ga0395898_0215187
1002 Ga0395898_0386307
1003 Ga0395898_0754136
1004 Ga0395898_0807227
1005 Ga0395898_1276464
1006 Ga0395898_1363730
1007 Ga0395898_1416966
1008 Ga0395905_0042696
1009 Ga0395905_0102993
1010 Ga0395905_0181870
1011 Ga0395905_0232240
1012 Ga0395905_0543926
1013 Ga0395905_0991758
1014 Ga0395905_1081152
1015 Ga0395905_1147836
1016 Ga0395901_0004378
1017 Ga0395901_0031826
1018 Ga0395901_0135742
1019 Ga0395901_0164192
1020 Ga0395901_0354310
1021 Ga0395901_0364844
1022 Ga0395901_0376792
1023 Ga0395901_0856039
1024 Ga0395901_1049632
1025 Ga0395901_1164636
1026 Ga0395901_1816261
1027 Ga0436365_0463966
1028 Ga0436365_1583841
1029 Ga0436365_1619546
1030 Ga0436363_0347133
1031 Ga0436363_0554650
1032 Ga0451807_1951536
1033 Ga0451853_1170030
1034 Ga0451853_1356713
1035 Ga0439448_0222166
1036 Ga0439464_0084710
1037 Ga0466969_0001587
1038 Ga0466969_0123031
1039 Ga0466972_0162836
1040 Ga0466965_0082941
1041 Ga0466965_0429404
1042 Ga0466965_0733491
1043 Ga0466966_0005740
1044 Ga0466966_0084392
1045 Ga0466966_0105662
1046 Ga0466966_0118152
1047 Ga0466966_0361361
1048 Ga0466966_0394803
1049 Ga0466961_0119100
1050 Ga0466961_0133392
1051 Ga0466961_0788227
1052 Ga0466961_0908292
1053 Ga0466963_0000045
1054 Ga0466963_0000742
1055 Ga0466963_0001619
1056 Ga0466963_0013627
1057 Ga0466963_0045262
1058 Ga0466963_0046621
1059 Ga0466963_0105297
1060 Ga0466963_0105746
1061 Ga0466963_0126419
1062 Ga0466963_0166014
1063 Ga0466963_0518237
1064 Ga0466963_0927785
1065 Ga0466963_0954305
1066 Ga0466964_0002707
1067 Ga0466964_0054670
1068 Ga0466964_0063979
1069 Ga0466964_0119990
1070 Ga0466964_0237830
1071 Ga0466964_0384433
1072 Ga0466964_0529508
1073 Ga0466971_0001256
1074 Ga0466971_0112310
1075 Ga0466971_0144623
1076 Ga0466968_0015466
1077 Ga0466968_0021995
1078 Ga0466968_0035223
1079 Ga0466968_0054832
1080 Ga0466968_0059578
1081 Ga0466968_0091547
1082 Ga0466968_0176104
1083 Ga0466968_0233547
1084 Ga0466970_0005565
1085 Ga0466970_0439177
1086 Ga0466957_0000686
1087 Ga0466957_0020963
1088 Ga0466957_0036309
1089 Ga0466957_0050455
1090 Ga0466957_0195919
1091 Ga0466957_0248609
1092 Ga0466957_0256395
1093 Ga0466957_0347423
1094 Ga0466957_0491755
1095 Ga0466957_0500599
1096 Ga0466957_1101152
1097 Ga0466957_1113603
1098 Ga0466957_1261760
1099 Ga0466957_1290809
1100 Ga0466960_0113859
1101 Ga0466960_0274342
1102 Ga0466960_0605554
1103 Ga0466960_0649037
1104 Ga0466959_0006849
1105 Ga0466959_0030041
1106 Ga0466959_0054074
1107 Ga0466959_0115707
1108 Ga0466959_0132723
1109 Ga0451576_2402927
1110 Ga0466958_0034458
1111 Ga0466958_0105168
1112 Ga0466958_0105506
1113 Ga0466958_0211272
1114 Ga0466958_0334296
1115 Ga0466958_0340171
1116 Ga0466967_0000248
1117 Ga0466967_0005994
1118 Ga0466967_0006248
1119 Ga0466967_0013790
1120 Ga0466967_0028996
1121 Ga0466967_0030595
1122 Ga0466967_0044659
1123 Ga0466967_0046221
1124 Ga0466967_0061777
1125 Ga0466967_0062850
1126 Ga0466967_0071542
1127 Ga0466967_0101004
1128 Ga0466967_0144883
1129 Ga0466967_0145790
1130 Ga0466967_0179385
1131 Ga0466967_0212070
1132 Ga0466967_0226284
1133 Ga0466967_0229292
1134 Ga0466967_0362321
1135 Ga0466967_0363280
1136 Ga0466967_0404704
1137 Ga0466967_0460910
1138 Ga0466967_0465633
1139 Ga0466967_0487336
1140 Ga0466967_1005901
1141 Ga0466967_1018814
1142 Ga0466967_1030848
1143 Ga0466967_1167515
1144 Ga0466967_1293313
1145 Ga0466967_1462883
1146 Ga0466967_2342008
1147 Ga0495603_0710429
1148 Ga0495629_0706054
1149 Ga0495641_0042554
1150 Ga0495641_0387962
1151 Ga0495641_0584335
1152 Ga0495651_0149048
1153 Ga0495651_0663633
1154 Ga0495653_0036514
1155 Ga0495653_0106063
1156 Ga0495653_0514552
1157 Ga0495580_0368292
1158 Ga0495582_0085177
1159 Ga0495582_0380874
1160 Ga0495664_0052136
1161 Ga0495584_0085591
1162 Ga0495584_0108332
1163 Ga0495585_0601973
1164 Ga0495594_0744507
1165 Ga0495596_0434666
1166 Ga0495608_0005356
1167 Ga0495608_0013987
1168 Ga0495608_0394353
1169 Ga0495618_0578049
1170 Ga0495630_0057166
1171 Ga0495630_0343203
1172 Ga0495631_0184283
1173 Ga0495637_0351039
1174 Ga0495663_0052050
1175 Ga0495642_0275254
1176 Ga0495642_0374623
1177 Ga0495652_0065292
1178 Ga0495652_0138153
1179 Ga0495652_0184854
1180 Ga0495665_0132690
1181 Ga0495587_0010553
1182 Ga0495587_0098320
1183 Ga0495667_0091540
1184 Ga0495667_0154383
1185 Ga0495656_0115562
1186 Ga0495656_0203783
1187 Ga0495634_0043312
1188 Ga0495611_0537664
1189 Ga0495635_0050980
1190 Ga0495635_0225088
1191 Ga0495661_0445211
1192 Ga0495588_0753256
1193 Ga0495657_0055341
1194 Ga0495657_0062744
1195 Ga0495657_0583008
1196 Ga0495599_0044374
1197 Ga0495623_0196780
1198 Ga0495623_0738448
1199 Ga0495646_0097604
1200 Ga0495647_0158951
1201 Ga0495658_0275868
1202 Ga0495613_0105338
1203 Ga0495613_0667181
1204 Ga0495624_0161193
1205 Ga0495624_0341355
1206 Ga0495600_0392319
1207 Ga0495581_0142491
1208 Ga0495581_0672075
1209 Ga0495604_0039781
1210 Ga0495604_0310941
1211 Ga0495604_0612470
1212 Ga0495674_0039263
1213 Ga0495674_0125666
1214 Ga0495674_0901888
1215 Ga0495676_0101779
1216 Ga0495676_0189501
1217 Ga0495676_0448008
1218 Ga0495676_0968124
1219 Ga0495676_0995647
1220 Ga0495680_0015306
1221 Ga0495680_0032766
1222 Ga0495675_0093843
1223 Ga0495684_0158496
1224 Ga0495684_0422982
1225 Ga0495684_1090884
1226 Ga0495602_1090451
1227 Ga0496100_0002873
1228 Ga0496100_0888328
1229 Ga0496100_1250105
1230 Ga0496101_0213196
1231 Ga0496101_0491890
1232 Ga0496102_0004411
1233 Ga0496102_0385265
1234 Ga0496102_0499160
1235 Ga0496103_0024537
1236 Ga0496103_0504314
1237 Ga0496104_0138902
1238 Ga0496104_0339180
1239 Ga0496104_0940778
1240 Ga0496105_0026253
1241 Ga0496105_0066005
1242 Ga0496105_0100296
1243 Ga0496105_1401699
1244 Ga0496106_0028830
1245 Ga0496106_0070831
1246 Ga0496106_1242738
1247 Ga0496107_0009417
1248 Ga0496107_0085959
1249 Ga0496108_0007544
1250 Ga0496108_0097220
1251 Ga0496108_0230534
1252 Ga0496108_0585493
1253 Ga0496109_0044918
1254 Ga0496109_0047917
1255 Ga0496109_0053800
1256 Ga0496109_0124580
1257 Ga0496109_0336788
1258 Ga0496109_0598490
1259 Ga0496110_0399220
1260 Ga0496111_0153466
1261 Ga0496111_0340413
1262 Ga0496111_0647201
1263 Ga0496112_0020070
1264 Ga0496112_0023014
1265 Ga0496112_0060683
1266 Ga0496112_0276705
1267 Ga0496112_0385125
1268 Ga0496112_0539462
1269 Ga0496112_1046476
1270 Ga0496112_1395535
1271 Ga0496113_1049588
1272 Ga0496114_0008800
1273 Ga0496114_0130695
1274 Ga0496114_0136277
1275 Ga0496114_0411493
1276 Ga0496114_1038648
1277 Ga0496114_1045240
1278 Ga0496115_0000468
1279 Ga0496115_0003165
1280 Ga0496115_0448111
1281 Ga0501032_0794657
1282 Ga0501034_0065603
1283 Ga0501037_0606206
1284 Ga0501043_0483196
1285 Ga0501046_0453813
1286 Ga0501047_0020647
1287 Ga0501047_0030926
1288 Ga0501047_0089203
1289 Ga0501047_0114792
1290 Ga0501047_0251911
1291 Ga0501048_1191468
1292 Ga0501067_0016225
1293 Ga0501067_0114053
1294 Ga0501067_0182860
1295 Ga0501068_0175729
1296 Ga0501068_1156162
1297 Ga0501069_0041601
1298 Ga0501069_0091310
1299 Ga0501069_0112901
1300 Ga0501069_0119334
1301 Ga0501069_0799121
1302 Ga0501070_0000120
1303 Ga0501070_0007509
1304 Ga0501070_0026784
1305 Ga0501070_0218691
1306 Ga0501072_0007793
1307 Ga0501072_0833647
1308 Ga0501073_0022897
1309 Ga0501073_0025754
1310 Ga0501074_0014259
1311 Ga0501074_0017916
1312 Ga0501074_0369585
1313 Ga0501074_0475047
1314 Ga0501074_0492177
1315 Ga0501079_0103970
1316 Ga0501079_0790433
1317 Ga0501079_1274216
1318 Ga0501080_0011468
1319 Ga0501080_0118423
1320 Ga0501080_0125573
1321 Ga0501080_0192605
1322 Ga0501080_0244275
1323 Ga0501080_0363795
1324 Ga0501080_1657067
1325 Ga0501083_0002282
1326 Ga0501083_0948207
1327 Ga0501035_0630558
1328 Ga0501035_1027154
1329 Ga0501044_0247094
1330 Ga0501045_1353934
1331 nmdc:mga0n895_27853_c1
1332 nmdc:mga0rr50_115739_c1
1333 nmdc:mga0rr50_214248_c1
1334 nmdc:mga0a205_132950_c1
1335 nmdc:mga0a205_728608_c1
1336 Ga0495601_0016450
1337 Ga0495612_0212128
1338 Ga0495612_0255566
1339 Ga0500635_0305571
1340 Ga0495595_0007111
1341 Ga0495595_0129934
1342 Ga0495619_0004914
1343 Ga0495619_0212704
1344 Ga0501084_0124032
1345 Ga0587106_131742
1346 Ga0587128_134805
1347 Ga0501082_0053269
1348 Ga0466962_0004936
1349 Ga0466962_0048060
1350 Ga0466962_0062341
1351 Ga0466962_0140435
1352 Ga0466962_0208401
1353 Ga0530510_0353526
1354 Ga0530510_0439075
1355 Ga0530510_0506338
1356 Ga0530510_0660382

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08734

GYD

GYD domain

10

99

0.98

PF11746

DUF3303

Domain of unknown function (DUF3303)

9

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pcq-assembly1.cif.gz_B crystal structure of mtbaldr (rv2779c) 0.8048 2 85
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.8008 2 85
2vc1-assembly1.cif.gz_B feast or famine regulatory protein (rv3291c)from m. tuberculosis complexed with l-methionine 0.7957 1 85
2w29-assembly1.cif.gz_B gly102thr mutant of rv3291c 0.7839 1 85
2w25-assembly1.cif.gz_B crystal structure of glu104ala mutant 0.7833 2 85
ID Description Score Start End Superfamily
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7902 2 85 3.30.70.920
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7763 2 83 3.30.70.920
2cg4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7551 2 83 3.30.70.920
2w24A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7531 1 83 3.30.70.920
4pcqD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7436 2 83 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A3N5IBJ4-F1-model_v4 GYD domain-containing protein 0.9995 1 85
AF-A0A7V9I4J8-F1-model_v4 GYD domain-containing protein 0.9992 1 94
AF-A0A1F8NY32-F1-model_v4 GYD domain superfamily 0.9968 1 93
AF-A0A7C2R6K4-F1-model_v4 GYD domain-containing protein 0.9947 1 93
AF-A0A3B9VPI1-F1-model_v4 GYD domain superfamily 0.9944 7 93

Map