F474624

General Info

Members Datasets Scaffolds Average Seq Length
678 339 595 383

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10000521|JGI25406J46586_100005216
Length 431
Sequence LCNTTTYLRGQQESHLMNQATTSDVASNSFLVGEGWDGAYLFTQAMRWFGPNDPVSLWDIKQAGCSGVVTALHHIPAGEVWNVDEILKRKNEIEAIGLTWDVVESVFVNEAIKTQTGDFKKYIENYKITLYNLAACGINIVTYNFMPVLDWTRTDLSYTMPDDSKALRFERAAFVAFDMYILGRENAEHDYTWEELNRAKERYEAMSDEEIEQLQRNIIAGLPGSSEGFTMNDFRKALEPYKNIDTQKLQQHLIYFLKEIIPAAEEAGVMMAIHPDDPPYSILGLPRVVCTARQVQQLVDAVPSLNNGLCFCTGSFGVRIDNNLPKMIEQFSDRIHFVHLRSTRRNEYGDFYEDNHLEGDVDMYSVVKKLLEVMRRRKVSLPMRPDHGHQMLDDLKKKTNPGYSAIGRLRGLAELRGLEMGIYKSLFAKAE

Samples

Sample ID Description Type Environment
1 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541283 Pedobacter sp. OK701 Isolate Unclassified
11 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
12 2738541302 Pedobacter sp. CF074 Isolate Unclassified
13 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
14 2738543023 Pedobacter sp. OK628 Isolate Unclassified
15 2739367651 Pedobacter sp. OK291 Isolate Unclassified
16 2739367656 Pedobacter sp. CF523 Isolate Unclassified
17 2739367663 Pedobacter sp. YR510 Isolate Unclassified
18 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
19 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
20 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
21 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
22 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
23 2818991437 Pedobacter terrae 518 Isolate Unclassified
24 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
25 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
26 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
27 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
28 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
29 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
30 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
31 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
32 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
33 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
34 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
35 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
38 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
39 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
40 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
41 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
42 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
43 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
44 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
45 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
46 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
47 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
48 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
49 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
50 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
51 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
52 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
53 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
54 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
55 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
56 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
57 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
58 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
59 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
60 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
61 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
62 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
63 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
64 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
65 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
66 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
67 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
68 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
72 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
73 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
80 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
94 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
95 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
96 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
97 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
98 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
99 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
100 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
101 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
102 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
103 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
104 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
105 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
106 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
107 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
108 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
109 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
114 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
115 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
128 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
129 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
130 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
145 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
146 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
147 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
166 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
170 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
171 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
179 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
242 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
248 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
249 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
250 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
271 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
272 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
277 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
309 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
310 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
311 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
312 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
313 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
314 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
315 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
322 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
323 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
326 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
327 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
336 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
337 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
338 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
339 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.79
Metatranscriptomes 0
Isolates 11.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.18
Nodule 0.59
Rhizoplane 0.29
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004506 3300001904 Bacteria 2375
2 JGI24740J21852_10003264 3300001979 Bacteria 7158
3 JGI24739J22299_10043101 3300001989 Bacteria 1493
4 JGI24737J22298_10005668 3300001990 Bacteria 4299
5 JGI24735J21928_10000001 3300002067 Bacteria 650042
6 JGI25154J39366_1000001 3300002738 Bacteria 483450
7 JGI25152J39213_1000128 3300002773 Bacteria 51965
8 JGI25150J39212_1000021 3300002774 Bacteria 133190
9 JGI25151J46595_10000078 3300003187 Bacteria 133190
10 JGI25406J46586_10000521 3300003203 Bacteria 17983
11 JGI25153J46596_10000057 3300003215 Bacteria 133190
12 JGI25153J46596_10000209 3300003215 Bacteria 52915
13 rootH1_10035249 3300003316 Bacteria 45273
14 rootH1_10132184 3300003316 Bacteria 3909
15 rootH2_10007188 3300003320 Bacteria 50032
16 rootH2_10019266 3300003320 Bacteria 14510
17 rootH2_10022625 3300003320 Bacteria 19374
18 rootL2_10002510 3300003322 Bacteria 3604
19 rootL2_10026318 3300003322 Bacteria 3083
20 rootL2_10040843 3300003322 Bacteria 6397
21 rootL2_10080383 3300003322 Bacteria 3966
22 rootL2_10190204 3300003322 Unclassified 2930
23 rootH1_10006645 3300003323 Bacteria 138273
24 rootH1_10013148 3300003323 Bacteria 11892
25 rootH1_10017001 3300003323 Bacteria 11181
26 rootH1_10039506 3300003323 Bacteria 11154
27 rootH1_10062356 3300003323 Bacteria 12638
28 rootH1_10087371 3300003323 Bacteria 5579
29 rootH1_10187548 3300003323 Bacteria 12847
30 JGI25160J50197_1003260 3300003354 Bacteria 7312
31 JGI25160J50197_1005642 3300003354 Bacteria 5179
32 JGI25160J50197_1006440 3300003354 Bacteria 4752
33 Ga0055535_1001690 3300003761 Bacteria 10071
34 Ga0055526_1015403 3300003771 Bacteria 3069
35 Ga0055536_1000009 3300003781 Bacteria 311572
36 Ga0055536_1000018 3300003781 Bacteria 205832
37 Ga0055536_1000038 3300003781 Bacteria 133102
38 Ga0055528_1005071 3300003790 Bacteria 6217
39 Ga0055530_10001763 3300003791 Bacteria 15122
40 Ga0055530_10002115 3300003791 Bacteria 13226
41 Ga0055530_10002626 3300003791 Bacteria 11280
42 Ga0055530_10010075 3300003791 Bacteria 3545
43 Ga0055531_10000061 3300003794 Bacteria 120535
44 Ga0065165_1000053 3300005262 Bacteria 189081
45 Ga0065165_1000505 3300005262 Bacteria 60144
46 Ga0065714_10002374 3300005288 Bacteria 37517
47 Ga0065714_10010603 3300005288 Bacteria 5989
48 Ga0065714_10064467 3300005288 Bacteria 63317
49 Ga0065714_10076716 3300005288 Bacteria 2762
50 Ga0065714_10094227 3300005288 Bacteria 1823
51 Ga0065714_10104306 3300005288 Bacteria 1587
52 Ga0070658_10003995 3300005327 Bacteria 12090
53 Ga0070676_10000736 3300005328 Bacteria 16050
54 Ga0070676_10001877 3300005328 Bacteria 10683
55 Ga0070676_10206653 3300005328 Bacteria 1290
56 Ga0070683_100000416 3300005329 Bacteria 29488
57 Ga0070683_100017490 3300005329 Bacteria 6337
58 Ga0070670_100100218 3300005331 Bacteria 2493
59 Ga0068869_100048050 3300005334 Unclassified 3084
60 Ga0068869_100245983 3300005334 Bacteria 1427
61 Ga0070666_10000375 3300005335 Bacteria 28142
62 Ga0070666_10000474 3300005335 Bacteria 24278
63 Ga0070666_10005234 3300005335 Bacteria 7944
64 Ga0070666_10104599 3300005335 Bacteria 1954
65 Ga0070682_100016548 3300005337 Bacteria 4289
66 Ga0068868_100002213 3300005338 Bacteria 13436
67 Ga0068868_100002884 3300005338 Bacteria 11932
68 Ga0068868_100031804 3300005338 Bacteria 4057
69 Ga0068868_100044373 3300005338 Bacteria 3476
70 Ga0070689_100038133 3300005340 Bacteria 3675
71 Ga0070689_100177136 3300005340 Bacteria 1730
72 Ga0070661_100052272 3300005344 Bacteria 2990
73 Ga0070668_100000876 3300005347 Bacteria 20916
74 Ga0070669_100001647 3300005353 Bacteria 16171
75 Ga0070669_100027089 3300005353 Bacteria 4125
76 Ga0070675_100050426 3300005354 Bacteria 3417
77 Ga0070675_100204859 3300005354 Bacteria 1713
78 Ga0070671_100002219 3300005355 Bacteria 14995
79 Ga0070671_100062937 3300005355 Bacteria 3089
80 Ga0070674_100042044 3300005356 Bacteria 3102
81 Ga0070673_100001104 3300005364 Bacteria 15457
82 Ga0070673_100050103 3300005364 Bacteria 3263
83 Ga0070673_100185381 3300005364 Bacteria 1784
84 Ga0070673_100203869 3300005364 Bacteria 1704
85 Ga0070688_100081557 3300005365 Bacteria 2095
86 Ga0070688_100112236 3300005365 Bacteria 1814
87 Ga0070667_100000588 3300005367 Bacteria 35773
88 Ga0070667_100005666 3300005367 Bacteria 10430
89 Ga0070667_100008498 3300005367 Bacteria 8512
90 Ga0070667_100027924 3300005367 Bacteria 4696
91 Ga0070667_100106094 3300005367 Bacteria 2432
92 Ga0070663_100046592 3300005455 Bacteria 3068
93 Ga0070678_100003233 3300005456 Bacteria 9050
94 Ga0070662_100013592 3300005457 Bacteria 5420
95 Ga0070681_10120544 3300005458 Bacteria 2558
96 Ga0068867_100035423 3300005459 Bacteria 3620
97 Ga0068867_100074820 3300005459 Bacteria 2540
98 Ga0068867_100136493 3300005459 Bacteria 1913
99 Ga0068867_100159772 3300005459 Bacteria 1776
100 Ga0070698_100157987 3300005471 Bacteria 2212
101 Ga0070684_100019166 3300005535 Bacteria 5657
102 Ga0068853_100003326 3300005539 Bacteria 12307
103 Ga0068853_100021933 3300005539 Bacteria 5327
104 Ga0070672_100000511 3300005543 Bacteria 22741
105 Ga0070672_100108440 3300005543 Bacteria 2260
106 Ga0070672_100148887 3300005543 Bacteria 1935
107 Ga0070672_100157263 3300005543 Bacteria 1883
108 Ga0070665_100001321 3300005548 Bacteria 29603
109 Ga0068855_100000071 3300005563 Bacteria 122638
110 Ga0068855_100006106 3300005563 Bacteria 14690
111 Ga0068855_100073811 3300005563 Bacteria 3963
112 Ga0068855_100138473 3300005563 Bacteria 2776
113 Ga0068855_100151087 3300005563 Bacteria 2641
114 Ga0070664_100128937 3300005564 Bacteria 2221
115 Ga0070664_100184146 3300005564 Bacteria 1858
116 Ga0070664_100308898 3300005564 Bacteria 1430
117 Ga0068857_100004433 3300005577 Bacteria 11872
118 Ga0068857_100027897 3300005577 Bacteria 4979
119 Ga0068857_100082991 3300005577 Bacteria 2863
120 Ga0068857_100144436 3300005577 Bacteria 2152
121 Ga0068854_100001289 3300005578 Bacteria 15085
122 Ga0068854_100055961 3300005578 Bacteria 2842
123 Ga0068854_100117892 3300005578 Bacteria 2011
124 Ga0068856_100038584 3300005614 Bacteria 4689
125 Ga0070702_100011497 3300005615 Bacteria 4404
126 Ga0068852_100010804 3300005616 Bacteria 6840
127 Ga0068852_100015349 3300005616 Bacteria 5936
128 Ga0068852_100049983 3300005616 Bacteria 3580
129 Ga0068852_100109176 3300005616 Bacteria 2512
130 Ga0068852_100353215 3300005616 Bacteria 1436
131 Ga0068859_100000086 3300005617 Bacteria 85696
132 Ga0068859_100015843 3300005617 Bacteria 7574
133 Ga0068859_100025448 3300005617 Bacteria 5936
134 Ga0068859_100190057 3300005617 Bacteria 2138
135 Ga0068864_100002120 3300005618 Bacteria 16404
136 Ga0068864_100028675 3300005618 Bacteria 4708
137 Ga0068866_10067325 3300005718 Unclassified 1880
138 Ga0068861_100000923 3300005719 Bacteria 17840
139 Ga0068861_100050923 3300005719 Bacteria 3142
140 Ga0068861_100073932 3300005719 Bacteria 2649
141 Ga0068851_10000384 3300005834 Bacteria 20008
142 Ga0068863_100001340 3300005841 Bacteria 24519
143 Ga0068863_100013044 3300005841 Bacteria 8013
144 Ga0068863_100141315 3300005841 Bacteria 2301
145 Ga0068863_100248112 3300005841 Bacteria 1719
146 Ga0068858_100002273 3300005842 Bacteria 19437
147 Ga0068858_100004360 3300005842 Bacteria 13883
148 Ga0068860_100002118 3300005843 Bacteria 20935
149 Ga0068860_100044232 3300005843 Bacteria 4245
150 Ga0068860_100077080 3300005843 Bacteria 3170
151 Ga0068862_100063199 3300005844 Unclassified 3185
152 Ga0081539_10000147 3300005985 Bacteria 164274
153 Ga0075366_10068737 3300006195 Bacteria 2108
154 Ga0075366_10125475 3300006195 Bacteria 1548
155 Ga0097621_100003220 3300006237 Bacteria 11219
156 Ga0097621_100013909 3300006237 Bacteria 6010
157 Ga0097621_100014395 3300006237 Bacteria 5920
158 Ga0097621_100049927 3300006237 Bacteria 3401
159 Ga0097621_100145627 3300006237 Bacteria 2028
160 Ga0097621_100249767 3300006237 Bacteria 1553
161 Ga0068871_100001314 3300006358 Bacteria 16613
162 Ga0068871_100025101 3300006358 Bacteria 4632
163 Ga0068871_100083784 3300006358 Bacteria 2645
164 Ga0068871_100150597 3300006358 Bacteria 1984
165 Ga0068871_100156621 3300006358 Bacteria 1945
166 Ga0068871_100233535 3300006358 Bacteria 1597
167 Ga0075431_100024145 3300006847 Bacteria 6225
168 Ga0075429_100009693 3300006880 Bacteria 8351
169 Ga0068865_100030969 3300006881 Bacteria 3562
170 Ga0068865_100184774 3300006881 Bacteria 1608
171 Ga0068865_100218210 3300006881 Bacteria 1490
172 Ga0097620_100000086 3300006931 Bacteria 85696
173 Ga0097620_100015843 3300006931 Bacteria 7574
174 Ga0097620_100025449 3300006931 Bacteria 5936
175 Ga0097620_100190063 3300006931 Bacteria 2138
176 Ga0079104_1000691 3300006946 Bacteria 30800
177 Ga0099826_10002736 3300006948 Bacteria 11551
178 Ga0105251_10033920 3300009011 Bacteria 2529
179 Ga0105244_10000120 3300009036 Bacteria 82283
180 Ga0105240_10000195 3300009093 Bacteria 123313
181 Ga0105240_10000698 3300009093 Bacteria 61738
182 Ga0105240_10001517 3300009093 Bacteria 39516
183 Ga0105240_10003007 3300009093 Bacteria 26534
184 Ga0105240_10009054 3300009093 Bacteria 14136
185 Ga0105240_10012381 3300009093 Bacteria 11780
186 Ga0111539_10002087 3300009094 Bacteria 26711
187 Ga0105247_10000793 3300009101 Bacteria 24229
188 Ga0105247_10002917 3300009101 Bacteria 11377
189 Ga0114129_10000714 3300009147 Bacteria 42000
190 Ga0105243_10000011 3300009148 Bacteria 312350
191 Ga0105241_10000254 3300009174 Bacteria 40113
192 Ga0105241_10090605 3300009174 Bacteria 2412
193 Ga0105241_10131627 3300009174 Bacteria 2026
194 Ga0105242_10020788 3300009176 Bacteria 5148
195 Ga0105242_10021527 3300009176 Bacteria 5065
196 Ga0105242_10151011 3300009176 Bacteria 2025
197 Ga0105248_10067327 3300009177 Bacteria 4021
198 Ga0105248_10376140 3300009177 Bacteria 1599
199 Ga0105237_10001891 3300009545 Bacteria 26726
200 Ga0105237_10002105 3300009545 Bacteria 25143
201 Ga0105237_10024976 3300009545 Bacteria 6113
202 Ga0105237_10033300 3300009545 Bacteria 5220
203 Ga0105237_10105060 3300009545 Bacteria 2816
204 Ga0105237_10143609 3300009545 Bacteria 2381
205 Ga0105238_10000496 3300009551 Bacteria 41316
206 Ga0105238_10002761 3300009551 Bacteria 17515
207 Ga0105238_10190251 3300009551 Bacteria 2028
208 Ga0105249_10003436 3300009553 Bacteria 13717
209 Ga0105249_10004284 3300009553 Bacteria 12331
210 Ga0105249_10035574 3300009553 Bacteria 4516
211 Ga0105249_10038377 3300009553 Bacteria 4346
212 Ga0105249_10047688 3300009553 Bacteria 3904
213 Ga0105249_10176696 3300009553 Bacteria 2074
214 Ga0105239_10000579 3300010375 Bacteria 52245
215 Ga0105239_10185231 3300010375 Bacteria 2330
216 Ga0105239_10468354 3300010375 Bacteria 1431
217 Ga0105246_10015666 3300011119 Bacteria 4791
218 Ga0157373_10001036 3300013100 Bacteria 21414
219 Ga0157373_10003571 3300013100 Bacteria 11753
220 Ga0157373_10139449 3300013100 Bacteria 1705
221 Ga0157371_10000034 3300013102 Bacteria 223947
222 Ga0157371_10003442 3300013102 Bacteria 14355
223 Ga0157371_10005972 3300013102 Bacteria 10157
224 Ga0157371_10013855 3300013102 Bacteria 6108
225 Ga0157371_10038726 3300013102 Bacteria 3410
226 Ga0157371_10038878 3300013102 Bacteria 3403
227 Ga0157371_10109266 3300013102 Bacteria 1963
228 Ga0157370_10000405 3300013104 Bacteria 54383
229 Ga0157370_10000640 3300013104 Bacteria 43586
230 Ga0157370_10000920 3300013104 Bacteria 37348
231 Ga0157370_10002194 3300013104 Bacteria 23812
232 Ga0157370_10002625 3300013104 Bacteria 21610
233 Ga0157370_10002675 3300013104 Bacteria 21354
234 Ga0157370_10003317 3300013104 Bacteria 18961
235 Ga0157370_10004387 3300013104 Bacteria 16197
236 Ga0157370_10004945 3300013104 Bacteria 15086
237 Ga0157370_10007720 3300013104 Bacteria 11663
238 Ga0157370_10008589 3300013104 Bacteria 10999
239 Ga0157370_10024727 3300013104 Bacteria 5947
240 Ga0157370_10027437 3300013104 Bacteria 5614
241 Ga0157370_10070674 3300013104 Bacteria 3295
242 Ga0157370_10097344 3300013104 Bacteria 2760
243 Ga0157370_10348614 3300013104 Bacteria 1365
244 Ga0157369_10000002 3300013105 Bacteria 524510
245 Ga0157369_10002318 3300013105 Bacteria 22909
246 Ga0157369_10027588 3300013105 Bacteria 6291
247 Ga0157369_10192838 3300013105 Bacteria 2140
248 Ga0157369_10193466 3300013105 Bacteria 2136
249 Ga0157374_10000001 3300013296 Bacteria 1077351
250 Ga0157374_10043822 3300013296 Bacteria 4135
251 Ga0157374_10163278 3300013296 Bacteria 2170
252 Ga0157378_10002828 3300013297 Bacteria 15480
253 Ga0157378_10058343 3300013297 Bacteria 3442
254 Ga0157378_10067078 3300013297 Bacteria 3215
255 Ga0157378_10076231 3300013297 Bacteria 3021
256 Ga0157378_10299420 3300013297 Bacteria 1556
257 Ga0163162_10000674 3300013306 Bacteria 31727
258 Ga0163162_10001501 3300013306 Bacteria 21743
259 Ga0163162_10003760 3300013306 Bacteria 14539
260 Ga0163162_10005178 3300013306 Bacteria 12576
261 Ga0163162_10005335 3300013306 Bacteria 12405
262 Ga0163162_10019498 3300013306 Bacteria 6653
263 Ga0163162_10024019 3300013306 Bacteria 6016
264 Ga0163162_10062970 3300013306 Bacteria 3750
265 Ga0163162_10277967 3300013306 Bacteria 1806
266 Ga0157372_10000034 3300013307 Bacteria 174784
267 Ga0157372_10001527 3300013307 Bacteria 25162
268 Ga0157372_10003589 3300013307 Bacteria 16694
269 Ga0157372_10009970 3300013307 Bacteria 10105
270 Ga0157372_10012503 3300013307 Bacteria 9046
271 Ga0157372_10072036 3300013307 Bacteria 3893
272 Ga0157372_10095794 3300013307 Bacteria 3382
273 Ga0157372_10104462 3300013307 Bacteria 3239
274 Ga0157372_10112438 3300013307 Bacteria 3120
275 Ga0157372_10410641 3300013307 Bacteria 1578
276 Ga0157375_10004612 3300013308 Bacteria 11976
277 Ga0157375_10019591 3300013308 Bacteria 6157
278 Ga0157375_10025638 3300013308 Bacteria 5483
279 Ga0157375_10035618 3300013308 Bacteria 4753
280 Ga0157375_10225163 3300013308 Bacteria 2034
281 Ga0163163_10003420 3300014325 Bacteria 13486
282 Ga0163163_10173837 3300014325 Bacteria 2200
283 Ga0157380_10284510 3300014326 Bacteria 1515
284 Ga0182008_10000335 3300014497 Bacteria 36787
285 Ga0182008_10000613 3300014497 Bacteria 26197
286 Ga0182008_10016639 3300014497 Bacteria 3819
287 Ga0182008_10050526 3300014497 Bacteria 2064
288 Ga0157377_10036152 3300014745 Bacteria 2715
289 Ga0157379_10000571 3300014968 Bacteria 29790
290 Ga0157379_10023146 3300014968 Bacteria 5509
291 Ga0157379_10042210 3300014968 Bacteria 4072
292 Ga0157379_10070831 3300014968 Bacteria 3120
293 Ga0157379_10176621 3300014968 Bacteria 1929
294 Ga0157379_10218409 3300014968 Bacteria 1727
295 Ga0157376_10002660 3300014969 Bacteria 12140
296 Ga0157376_10018216 3300014969 Bacteria 5377
297 Ga0157376_10040973 3300014969 Bacteria 3789
298 Ga0157376_10088822 3300014969 Bacteria 2671
299 Ga0182006_1000770 3300015261 Bacteria 21827
300 Ga0182006_1001214 3300015261 Bacteria 16081
301 Ga0182006_1001696 3300015261 Bacteria 12872
302 Ga0182006_1002006 3300015261 Bacteria 11466
303 Ga0182006_1005799 3300015261 Bacteria 5820
304 Ga0182006_1007598 3300015261 Bacteria 4953
305 Ga0182007_10000001 3300015262 Bacteria 1127301
306 Ga0182005_1000496 3300015265 Bacteria 20079
307 Ga0183373_1003 3300015682 Bacteria 558813
308 Ga0163161_10000023 3300017792 Bacteria 205048
309 Ga0163161_10000108 3300017792 Bacteria 78805
310 Ga0163161_10000913 3300017792 Bacteria 22828
311 Ga0163161_10008720 3300017792 Bacteria 7013
312 Ga0163161_10017167 3300017792 Bacteria 5062
313 Ga0163161_10072957 3300017792 Bacteria 2514
314 Ga0209436_104848 3300025208 Bacteria 3226
315 Ga0209258_100041 3300025242 Bacteria 381381
316 Ga0207425_1000004 3300025245 Bacteria 1092421
317 Ga0209646_1000002 3300025246 Bacteria 1425781
318 Ga0209026_1000233 3300025250 Bacteria 74825
319 Ga0209148_1000090 3300025254 Bacteria 250982
320 Ga0209129_1000048 3300025258 Bacteria 270192
321 Ga0209673_1000034 3300025273 Bacteria 328788
322 Ga0209130_1001027 3300025284 Bacteria 21399
323 Ga0209676_1000001 3300025292 Bacteria 1852142
324 Ga0209676_1000201 3300025292 Bacteria 133195
325 Ga0209025_1000009 3300025294 Bacteria 1092561
326 Ga0209564_1002475 3300025295 Bacteria 14476
327 Ga0209758_1000010 3300025297 Bacteria 1092782
328 Ga0209758_1000419 3300025297 Bacteria 72133
329 Ga0209758_1003298 3300025297 Bacteria 14943
330 Ga0209050_1000018 3300025298 Bacteria 723263
331 Ga0209050_1000114 3300025298 Bacteria 205865
332 Ga0209050_1000203 3300025298 Bacteria 133156
333 Ga0209050_1000353 3300025298 Bacteria 88509
334 Ga0207426_1000177 3300025302 Bacteria 159426
335 Ga0207426_1000324 3300025302 Bacteria 91661
336 Ga0207426_1000592 3300025302 Bacteria 47901
337 Ga0207426_1004355 3300025302 Bacteria 6956
338 Ga0209257_1000001 3300025304 Bacteria 2274655
339 Ga0209257_1000006 3300025304 Bacteria 1570111
340 Ga0209257_1001792 3300025304 Bacteria 23622
341 Ga0207655_1000266 3300025728 Bacteria 82011
342 Ga0207710_10006649 3300025900 Bacteria 4928
343 Ga0207710_10014277 3300025900 Bacteria 3347
344 Ga0207680_10000117 3300025903 Bacteria 36819
345 Ga0207680_10000801 3300025903 Bacteria 14781
346 Ga0207647_10042596 3300025904 Bacteria 2847
347 Ga0207645_10000292 3300025907 Bacteria 42021
348 Ga0207645_10055288 3300025907 Bacteria 2534
349 Ga0207643_10002074 3300025908 Bacteria 11036
350 Ga0207643_10010554 3300025908 Bacteria 4973
351 Ga0207705_10003352 3300025909 Bacteria 12176
352 Ga0207705_10022080 3300025909 Bacteria 4540
353 Ga0207705_10024142 3300025909 Bacteria 4339
354 Ga0207654_10016425 3300025911 Bacteria 3855
355 Ga0207654_10098384 3300025911 Bacteria 1797
356 Ga0207695_10000023 3300025913 Bacteria 657903
357 Ga0207695_10000110 3300025913 Bacteria 250079
358 Ga0207695_10000229 3300025913 Bacteria 149313
359 Ga0207695_10007801 3300025913 Bacteria 13546
360 Ga0207695_10035045 3300025913 Bacteria 5448
361 Ga0207671_10001845 3300025914 Bacteria 23653
362 Ga0207671_10002829 3300025914 Bacteria 18049
363 Ga0207671_10003885 3300025914 Bacteria 14585
364 Ga0207671_10039435 3300025914 Bacteria 3497
365 Ga0207671_10143904 3300025914 Bacteria 1838
366 Ga0207662_10047702 3300025918 Bacteria 2537
367 Ga0207657_10137438 3300025919 Bacteria 1999
368 Ga0207657_10261809 3300025919 Bacteria 1376
369 Ga0207649_10089604 3300025920 Bacteria 2011
370 Ga0207652_10001773 3300025921 Bacteria 18792
371 Ga0207681_10030545 3300025923 Bacteria 3513
372 Ga0207681_10040645 3300025923 Bacteria 3096
373 Ga0207681_10160689 3300025923 Bacteria 1693
374 Ga0207694_10010106 3300025924 Bacteria 7112
375 Ga0207650_10001164 3300025925 Bacteria 19325
376 Ga0207650_10046465 3300025925 Bacteria 3197
377 Ga0207650_10124656 3300025925 Bacteria 2010
378 Ga0207690_10099092 3300025932 Bacteria 2077
379 Ga0207706_10013982 3300025933 Bacteria 7278
380 Ga0207706_10033675 3300025933 Bacteria 4559
381 Ga0207686_10045778 3300025934 Bacteria 2694
382 Ga0207709_10000034 3300025935 Bacteria 313184
383 Ga0207669_10018300 3300025937 Bacteria 3618
384 Ga0207704_10003386 3300025938 Bacteria 7241
385 Ga0207704_10072670 3300025938 Bacteria 2187
386 Ga0207691_10038187 3300025940 Bacteria 4442
387 Ga0207691_10054945 3300025940 Bacteria 3631
388 Ga0207691_10235387 3300025940 Bacteria 1585
389 Ga0207691_10262245 3300025940 Unclassified 1489
390 Ga0207689_10000260 3300025942 Bacteria 47416
391 Ga0207689_10000722 3300025942 Bacteria 31657
392 Ga0207689_10063560 3300025942 Bacteria 3036
393 Ga0207689_10141868 3300025942 Bacteria 1979
394 Ga0207661_10009921 3300025944 Bacteria 6839
395 Ga0207661_10034262 3300025944 Bacteria 3947
396 Ga0207667_10001623 3300025949 Bacteria 28293
397 Ga0207667_10010568 3300025949 Bacteria 10783
398 Ga0207667_10015148 3300025949 Bacteria 8768
399 Ga0207667_10123376 3300025949 Bacteria 2669
400 Ga0207667_10274998 3300025949 Bacteria 1722
401 Ga0207651_10000857 3300025960 Bacteria 13286
402 Ga0207651_10018119 3300025960 Bacteria 4182
403 Ga0207651_10039267 3300025960 Unclassified 3120
404 Ga0207651_10062849 3300025960 Bacteria 2590
405 Ga0207651_10152072 3300025960 Bacteria 1803
406 Ga0207712_10011421 3300025961 Bacteria 5659
407 Ga0207712_10090317 3300025961 Bacteria 2254
408 Ga0207668_10001121 3300025972 Bacteria 15969
409 Ga0207668_10046723 3300025972 Bacteria 2960
410 Ga0207640_10014455 3300025981 Bacteria 4546
411 Ga0207658_10001753 3300025986 Bacteria 16330
412 Ga0207658_10001959 3300025986 Bacteria 15364
413 Ga0207658_10006893 3300025986 Bacteria 7735
414 Ga0207658_10027157 3300025986 Bacteria 4020
415 Ga0207658_10042904 3300025986 Bacteria 3285
416 Ga0207677_10001454 3300026023 Bacteria 12547
417 Ga0207677_10042300 3300026023 Bacteria 3020
418 Ga0207677_10052126 3300026023 Bacteria 2778
419 Ga0207703_10004860 3300026035 Bacteria 10936
420 Ga0207703_10010647 3300026035 Bacteria 7184
421 Ga0207639_10002058 3300026041 Bacteria 13565
422 Ga0207639_10029547 3300026041 Bacteria 4014
423 Ga0207639_10081046 3300026041 Bacteria 2569
424 Ga0207678_10295569 3300026067 Bacteria 1391
425 Ga0207702_10169950 3300026078 Bacteria 1998
426 Ga0207702_10262508 3300026078 Bacteria 1627
427 Ga0207641_10000061 3300026088 Bacteria 160161
428 Ga0207641_10038139 3300026088 Bacteria 4016
429 Ga0207641_10054861 3300026088 Bacteria 3384
430 Ga0207641_10065798 3300026088 Bacteria 3101
431 Ga0207648_10000498 3300026089 Bacteria 43756
432 Ga0207648_10013882 3300026089 Bacteria 7470
433 Ga0207648_10050290 3300026089 Bacteria 3645
434 Ga0207648_10156527 3300026089 Unclassified 2011
435 Ga0207676_10030694 3300026095 Bacteria 4036
436 Ga0207674_10003174 3300026116 Bacteria 20238
437 Ga0207674_10033080 3300026116 Bacteria 5415
438 Ga0207674_10093368 3300026116 Bacteria 2997
439 Ga0207674_10267925 3300026116 Bacteria 1655
440 Ga0207674_10293142 3300026116 Bacteria 1575
441 Ga0207675_100005957 3300026118 Bacteria 11618
442 Ga0207675_100018811 3300026118 Bacteria 6446
443 Ga0207675_100061516 3300026118 Bacteria 3505
444 Ga0207675_100090022 3300026118 Bacteria 2885
445 Ga0207675_100125072 3300026118 Unclassified 2435
446 Ga0207683_10000585 3300026121 Bacteria 33627
447 Ga0207698_10008091 3300026142 Bacteria 6629
448 Ga0207698_10031882 3300026142 Bacteria 3810
449 Ga0207698_10037794 3300026142 Bacteria 3560
450 Ga0207698_10168944 3300026142 Bacteria 1923
451 Ga0207698_10328129 3300026142 Bacteria 1436
452 Ga0209281_1000037 3300027111 Bacteria 368555
453 Ga0209282_1006995 3300027666 Bacteria 7045
454 Ga0268266_10003239 3300028379 Bacteria 16440
455 Ga0268264_10001938 3300028381 Bacteria 18618
456 Ga0268264_10002707 3300028381 Bacteria 15465
457 Ga0268264_10004286 3300028381 Bacteria 12177
458 Ga0268264_10020316 3300028381 Bacteria 5428
459 Ga0268264_10072295 3300028381 Bacteria 2925
460 Ga0307515_10000780 3300028794 Bacteria 73338
461 Ga0307515_10270711 3300028794 Bacteria 1420
462 Ga0307511_10004383 3300030521 Bacteria 14404
463 Ga0316177_1078287 3300030731 Bacteria 10626
464 Ga0316176_1082807 3300030732 Bacteria 20683
465 Ga0316183_1015945 3300030742 Bacteria 25321
466 Ga0316181_1158450 3300030744 Bacteria 6710
467 Ga0307513_10052042 3300031456 Bacteria 4412
468 Ga0307408_100000523 3300031548 Bacteria 33139
469 Ga0307408_100001044 3300031548 Bacteria 21263
470 Ga0307408_100001050 3300031548 Bacteria 21208
471 Ga0307408_100002795 3300031548 Bacteria 12115
472 Ga0307408_100002864 3300031548 Bacteria 11955
473 Ga0307408_100044263 3300031548 Bacteria 3171
474 Ga0307516_10000577 3300031730 Bacteria 49482
475 Ga0307405_10000031 3300031731 Bacteria 99176
476 Ga0307413_10000608 3300031824 Bacteria 12015
477 Ga0307410_10000029 3300031852 Bacteria 50877
478 Ga0307406_10000012 3300031901 Bacteria 111189
479 Ga0307407_10000065 3300031903 Bacteria 41572
480 Ga0307407_10001039 3300031903 Bacteria 9600
481 Ga0307412_10001866 3300031911 Bacteria 11653
482 Ga0307412_10002513 3300031911 Bacteria 10198
483 Ga0307416_100000146 3300032002 Bacteria 41573
484 Ga0307416_100146571 3300032002 Bacteria 2156
485 Ga0307414_10000001 3300032004 Bacteria 1352954
486 Ga0307414_10001598 3300032004 Bacteria 11764
487 Ga0307414_10011142 3300032004 Bacteria 5259
488 Ga0307414_10013353 3300032004 Bacteria 4887
489 Ga0307414_10071924 3300032004 Bacteria 2497
490 Ga0307411_10000011 3300032005 Bacteria 204666
491 Ga0307510_10022799 3300033180 Bacteria 7263
492 Ga0373937_0035884 3300036401 Bacteria 4516
493 Ga0395905_0006439 3300037471 Bacteria 11821
494 Ga0395905_0022329 3300037471 Bacteria 5986
495 Ga0395905_0180329 3300037471 Bacteria 1983
496 Ga0395905_0186061 3300037471 Bacteria 1949
497 Ga0395901_0416372 3300038443 Bacteria 1378
498 Ga0436365_0920295 3300039437 Bacteria 45426
499 Ga0439439_0017086 3300041406 Bacteria 1781
500 Ga0439447_003485 3300041407 Bacteria 5589
501 Ga0439431_0000737 3300041997 Bacteria 7068
502 Ga0439431_0018540 3300041997 Bacteria 1647
503 Ga0439445_0010751 3300042004 Bacteria 2172
504 Ga0450899_003127 3300042135 Bacteria 1784
505 Ga0439434_0002205 3300042435 Bacteria 5656
506 Ga0451577_0016763 3300042876 Bacteria 6775
507 Ga0451577_0056653 3300042876 Bacteria 3496
508 Ga0466972_0003358 3300044658 Bacteria 7933
509 Ga0466982_0101498 3300044672 Bacteria 1782
510 Ga0466965_0021300 3300044683 Bacteria 3119
511 Ga0466961_0009882 3300044693 Bacteria 6078
512 Ga0453684_0001775 3300044712 Bacteria 57622
513 Ga0453684_0028647 3300044712 Bacteria 7938
514 Ga0466968_0003823 3300044735 Bacteria 5585
515 Ga0466970_0009210 3300044765 Bacteria 4982
516 Ga0466959_0005372 3300045049 Bacteria 8772
517 Ga0466959_0062939 3300045049 Bacteria 2695
518 Ga0451576_0003626 3300045051 Bacteria 20977
519 Ga0451576_0006920 3300045051 Bacteria 13733
520 Ga0466958_0008462 3300045836 Bacteria 5710
521 Ga0466967_0130616 3300045976 Unclassified 2331
522 Ga0495627_004222 3300046453 Bacteria 6075
523 Ga0495585_0000132 3300046492 Bacteria 80905
524 Ga0495610_0000064 3300046512 Bacteria 125922
525 Ga0495610_0001020 3300046512 Bacteria 25786
526 Ga0495610_0002154 3300046512 Bacteria 16751
527 Ga0495610_0005260 3300046512 Bacteria 9261
528 Ga0495637_0063719 3300046520 Bacteria 1506
529 Ga0495648_0007897 3300046524 Bacteria 8450
530 Ga0495633_0000175 3300046558 Bacteria 83653
531 Ga0495633_0000223 3300046558 Bacteria 70403
532 Ga0495633_0013201 3300046558 Bacteria 4362
533 Ga0495668_0000191 3300046616 Bacteria 90923
534 Ga0495672_0015522 3300047320 Bacteria 5166
535 Ga0495687_000001 3300047443 Bacteria 1215582
536 Ga0495687_001120 3300047443 Bacteria 26041
537 Ga0495686_0004164 3300047472 Bacteria 12029
538 Ga0495686_0027606 3300047472 Bacteria 3705
539 Ga0496104_0317270 3300048907 Bacteria 1472
540 Ga0496116_0000073 3300048919 Bacteria 237590
541 Ga0496116_0002724 3300048919 Bacteria 18172
542 Ga0496117_0014391 3300048920 Bacteria 6819
543 Ga0496118_0138050 3300048921 Bacteria 1552
544 Ga0496121_0019075 3300048924 Bacteria 6880
545 Ga0496121_0093379 3300048924 Bacteria 2343
546 Ga0496122_0000276 3300048925 Bacteria 114526
547 Ga0496122_0000765 3300048925 Bacteria 62189
548 Ga0496122_0010272 3300048925 Bacteria 9687
549 Ga0496123_0005845 3300048926 Bacteria 12189
550 Ga0496123_0007990 3300048926 Bacteria 9802
551 Ga0496123_0028896 3300048926 Bacteria 4094
552 Ga0496124_0173106 3300048927 Bacteria 1669
553 Ga0496125_0000253 3300048928 Bacteria 109929
554 Ga0496125_0000899 3300048928 Bacteria 47036
555 Ga0496125_0015898 3300048928 Bacteria 7249
556 Ga0496126_0003326 3300048929 Bacteria 20452
557 Ga0496126_0070976 3300048929 Bacteria 3101
558 Ga0501034_0009656 3300049571 Bacteria 10090
559 Ga0501034_0037269 3300049571 Bacteria 4923
560 Ga0501047_0126110 3300049581 Bacteria 2440
561 Ga0501236_001008 3300049670 Bacteria 3195
562 Ga0501238_000180 3300049671 Bacteria 9426
563 Ga0501249_000005 3300049679 Bacteria 225972
564 Ga0501257_000372 3300049686 Bacteria 8734
565 Ga0501219_000576 3300049703 Bacteria 5370
566 Ga0501241_000121 3300049758 Bacteria 16940
567 Ga0501266_000006 3300049763 Bacteria 312183
568 Ga0501280_007638 3300049776 Bacteria 1510
569 Ga0501044_0011376 3300049823 Bacteria 9637
570 Ga0501044_0124502 3300049823 Bacteria 2576
571 Ga0501044_0201670 3300049823 Bacteria 1947
572 Ga0501284_00011 3300050005 Bacteria 131008
573 nmdc:mga0k408_73788_c2 3300050493 Bacteria 1559
574 nmdc:mga05p37_3494_c1 3300050507 Bacteria 18375
575 nmdc:mga09592_198153_c1 3300050508 Bacteria 1739
576 Ga0500644_0000182 3300053088 Bacteria 40141
577 Ga0500646_0008069 3300053090 Bacteria 2692
578 Ga0500583_0007260 3300053092 Bacteria 3885
579 Ga0500641_0000003 3300053096 Bacteria 284831
580 Ga0500641_0000117 3300053096 Bacteria 30553
581 Ga0500562_000111 3300053108 Bacteria 28772
582 Ga0500607_072770 3300053121 Bacteria 1771
583 Ga0500618_017274 3300053125 Bacteria 1796
584 Ga0500658_0000007 3300053134 Bacteria 284115
585 Ga0500559_0016298 3300053136 Bacteria 3137
586 Ga0500568_0016532 3300053139 Bacteria 3277
587 Ga0500577_0005308 3300053142 Bacteria 3463
588 Ga0500604_0006093 3300053151 Bacteria 3183
589 Ga0500604_0024678 3300053151 Bacteria 1723
590 Ga0500622_0000026 3300053156 Bacteria 235660
591 Ga0500622_0000365 3300053156 Bacteria 43555
592 Ga0500622_0001039 3300053156 Bacteria 23193
593 Ga0500622_0021016 3300053156 Bacteria 3464
594 Ga0501084_0012175 3300054114 Bacteria 7120
595 Ga0500661_010844 3300055283 Bacteria 1656

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10070831 Ga0157379_100708311 278
2 3300048925 Ga0496122_0000276 Ga0496122_0000276_4807_5883 300
3 3300048926 Ga0496123_0007990 Ga0496123_0007990_6681_7757 300
4 3300048928 Ga0496125_0000899 Ga0496125_0000899_42005_43075 300
5 3300048928 Ga0496125_0015898 Ga0496125_0015898_3881_4951 300
6 3300048929 Ga0496126_0003326 Ga0496126_0003326_3584_4660 300
7 3300037471 Ga0395905_0186061 Ga0395905_0186061_842_1936 317
8 3300045051 Ga0451576_0003626 Ga0451576_0003626_19877_20965 317
9 3300005718 Ga0068866_10067325 Ga0068866_100673252 326
10 3300009553 Ga0105249_10035574 Ga0105249_100355742 328
11 3300026118 Ga0207675_100125072 Ga0207675_1001250722 328
12 3300013306 Ga0163162_10005178 Ga0163162_1000517811 329
13 3300005288 Ga0065714_10076716 Ga0065714_100767161 330
14 3300049763 Ga0501266_000006 Ga0501266_000006_52036_53214 331
15 3300025728 Ga0207655_1000266 Ga0207655_100026632 334
16 3300005577 Ga0068857_100082991 Ga0068857_1000829912 335
17 3300013308 Ga0157375_10225163 Ga0157375_102251632 335
18 3300025923 Ga0207681_10160689 Ga0207681_101606891 335
19 3300025938 Ga0207704_10072670 Ga0207704_100726702 335
20 3300026078 Ga0207702_10262508 Ga0207702_102625082 335
21 3300026116 Ga0207674_10093368 Ga0207674_100933682 335
22 iso_pu_bacteria 2643221600 2644010274 335
23 iso_pu_bacteria 2643221667 2644370750 335
24 iso_pu_bacteria 2643221725 2644686100 335
25 iso_pu_bacteria 2738541279 2738734321 335
26 iso_pu_bacteria 2738541285 2738767079 335
27 iso_pu_bacteria 2738543007 2739215902 335
28 iso_pu_bacteria 2739367857 2740001488 335
29 iso_pu_bacteria 2739367858 2740006304 335
30 iso_pu_bacteria 2816332280 2817415088 335
31 3300005337 Ga0070682_100016548 Ga0070682_1000165482 336
32 3300009036 Ga0105244_10000120 Ga0105244_1000012014 336
33 3300013102 Ga0157371_10003442 Ga0157371_100034428 336
34 3300013104 Ga0157370_10070674 Ga0157370_100706742 336
35 3300013105 Ga0157369_10027588 Ga0157369_100275885 336
36 3300048919 Ga0496116_0000073 Ga0496116_0000073_19168_20340 336
37 3300048921 Ga0496118_0138050 Ga0496118_0138050_216_1388 336
38 3300048924 Ga0496121_0019075 Ga0496121_0019075_39_1211 336
39 3300048924 Ga0496121_0093379 Ga0496121_0093379_721_1893 336
40 3300048927 Ga0496124_0173106 Ga0496124_0173106_289_1461 336
41 3300048928 Ga0496125_0000253 Ga0496125_0000253_19242_20414 336
42 3300048929 Ga0496126_0070976 Ga0496126_0070976_499_1671 336
43 3300005335 Ga0070666_10005234 Ga0070666_100052344 337
44 3300005338 Ga0068868_100031804 Ga0068868_1000318043 337
45 3300005356 Ga0070674_100042044 Ga0070674_1000420442 337
46 3300005364 Ga0070673_100050103 Ga0070673_1000501032 337
47 3300005367 Ga0070667_100106094 Ga0070667_1001060943 337
48 3300005456 Ga0070678_100003233 Ga0070678_1000032334 337
49 3300005459 Ga0068867_100159772 Ga0068867_1001597722 337
50 3300005578 Ga0068854_100117892 Ga0068854_1001178922 337
51 3300005617 Ga0068859_100190057 Ga0068859_1001900571 337
52 3300005719 Ga0068861_100050923 Ga0068861_1000509232 337
53 3300006237 Ga0097621_100014395 Ga0097621_1000143952 337
54 3300006358 Ga0068871_100156621 Ga0068871_1001566212 337
55 3300006881 Ga0068865_100218210 Ga0068865_1002182102 337
56 3300006931 Ga0097620_100190063 Ga0097620_1001900631 337
57 3300009174 Ga0105241_10090605 Ga0105241_100906052 337
58 3300009176 Ga0105242_10151011 Ga0105242_101510111 337
59 3300013297 Ga0157378_10067078 Ga0157378_100670782 337
60 3300017792 Ga0163161_10000023 Ga0163161_10000023101 337
61 3300025907 Ga0207645_10000292 Ga0207645_1000029214 337
62 3300025908 Ga0207643_10002074 Ga0207643_100020746 337
63 3300025937 Ga0207669_10018300 Ga0207669_100183002 337
64 3300025940 Ga0207691_10038187 Ga0207691_100381873 337
65 3300025942 Ga0207689_10000722 Ga0207689_100007229 337
66 3300025960 Ga0207651_10018119 Ga0207651_100181191 337
67 3300025986 Ga0207658_10042904 Ga0207658_100429042 337
68 3300026089 Ga0207648_10000498 Ga0207648_1000049817 337
69 3300026118 Ga0207675_100018811 Ga0207675_1000188114 337
70 3300026121 Ga0207683_10000585 Ga0207683_1000058516 337
71 3300028381 Ga0268264_10020316 Ga0268264_100203164 337
72 3300031548 Ga0307408_100001050 Ga0307408_10000105013 337
73 3300031911 Ga0307412_10001866 Ga0307412_100018663 337
74 3300005288 Ga0065714_10094227 Ga0065714_100942271 338
75 3300013306 Ga0163162_10062970 Ga0163162_100629704 338
76 3300013308 Ga0157375_10019591 Ga0157375_100195914 338
77 3300014968 Ga0157379_10218409 Ga0157379_102184092 338
78 3300015261 Ga0182006_1001214 Ga0182006_10012146 338
79 3300031852 Ga0307410_10000029 Ga0307410_1000002917 338
80 3300048907 Ga0496104_0317270 Ga0496104_0317270_33_1175 338
81 3300003316 rootH1_10035249 rootH1_1003524915 339
82 3300003316 rootH1_10132184 rootH1_101321843 339
83 3300003322 rootL2_10002510 rootL2_100025103 339
84 3300003323 rootH1_10039506 rootH1_100395067 339
85 3300005328 Ga0070676_10206653 Ga0070676_102066531 339
86 3300005329 Ga0070683_100000416 Ga0070683_1000004162 339
87 3300005331 Ga0070670_100100218 Ga0070670_1001002182 339
88 3300005334 Ga0068869_100245983 Ga0068869_1002459831 339
89 3300005344 Ga0070661_100052272 Ga0070661_1000522722 339
90 3300005355 Ga0070671_100002219 Ga0070671_1000022198 339
91 3300005459 Ga0068867_100074820 Ga0068867_1000748201 339
92 3300005535 Ga0070684_100019166 Ga0070684_1000191662 339
93 3300005563 Ga0068855_100006106 Ga0068855_1000061067 339
94 3300005564 Ga0070664_100128937 Ga0070664_1001289372 339
95 3300005564 Ga0070664_100308898 Ga0070664_1003088981 339
96 3300005577 Ga0068857_100027897 Ga0068857_1000278972 339
97 3300005578 Ga0068854_100055961 Ga0068854_1000559612 339
98 3300005617 Ga0068859_100025448 Ga0068859_1000254483 339
99 3300005841 Ga0068863_100248112 Ga0068863_1002481122 339
100 3300005843 Ga0068860_100002118 Ga0068860_10000211810 339
101 3300006237 Ga0097621_100003220 Ga0097621_1000032202 339
102 3300006358 Ga0068871_100233535 Ga0068871_1002335351 339
103 3300006931 Ga0097620_100025449 Ga0097620_1000254494 339
104 3300009545 Ga0105237_10143609 Ga0105237_101436092 339
105 3300013104 Ga0157370_10008589 Ga0157370_100085896 339
106 3300013296 Ga0157374_10163278 Ga0157374_101632782 339
107 3300013297 Ga0157378_10002828 Ga0157378_1000282811 339
108 3300013297 Ga0157378_10002828 Ga0157378_1000282812 339
109 3300025904 Ga0207647_10042596 Ga0207647_100425962 339
110 3300025907 Ga0207645_10055288 Ga0207645_100552881 339
111 3300025909 Ga0207705_10024142 Ga0207705_100241423 339
112 3300025914 Ga0207671_10143904 Ga0207671_101439041 339
113 3300025919 Ga0207657_10137438 Ga0207657_101374382 339
114 3300025925 Ga0207650_10046465 Ga0207650_100464652 339
115 3300025934 Ga0207686_10045778 Ga0207686_100457782 339
116 3300025944 Ga0207661_10034262 Ga0207661_100342622 339
117 3300025986 Ga0207658_10001959 Ga0207658_100019599 339
118 3300025986 Ga0207658_10006893 Ga0207658_100068934 339
119 3300026088 Ga0207641_10054861 Ga0207641_100548612 339
120 3300026089 Ga0207648_10013882 Ga0207648_100138825 339
121 3300026116 Ga0207674_10293142 Ga0207674_102931421 339
122 3300026118 Ga0207675_100061516 Ga0207675_1000615161 339
123 3300026142 Ga0207698_10008091 Ga0207698_100080914 339
124 3300028381 Ga0268264_10001938 Ga0268264_1000193811 339
125 3300028794 Ga0307515_10000780 Ga0307515_1000078021 339
126 3300042876 Ga0451577_0056653 Ga0451577_0056653_2082_3230 339
127 3300044712 Ga0453684_0028647 Ga0453684_0028647_4767_5915 339
128 3300049823 Ga0501044_0201670 Ga0501044_0201670_108_1253 339
129 3300053096 Ga0500641_0000003 Ga0500641_0000003_18461_19675 339
130 3300003320 rootH2_10022625 rootH2_100226257 340
131 3300013306 Ga0163162_10277967 Ga0163162_102779672 340
132 3300031548 Ga0307408_100002795 Ga0307408_1000027956 340
133 3300031824 Ga0307413_10000608 Ga0307413_100006087 340
134 3300031901 Ga0307406_10000012 Ga0307406_1000001266 340
135 3300031903 Ga0307407_10001039 Ga0307407_100010398 340
136 3300032004 Ga0307414_10000001 Ga0307414_1000000123 340
137 3300032005 Ga0307411_10000011 Ga0307411_1000001151 340
138 3300041407 Ga0439447_003485 Ga0439447_003485_4246_5424 340
139 3300049671 Ga0501238_000180 Ga0501238_000180_2421_3602 340
140 3300049776 Ga0501280_007638 Ga0501280_007638_95_1273 340
141 3300053134 Ga0500658_0000007 Ga0500658_0000007_247374_248552 340
142 iso_pu_bacteria 2929921140 2929922873 340
143 iso_pu_bacteria 8003151029 8003154699 340
144 3300001979 JGI24740J21852_10003264 JGI24740J21852_100032643 341
145 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001156 341
146 3300003215 JGI25153J46596_10000209 JGI25153J46596_1000020938 341
147 3300003354 JGI25160J50197_1006440 JGI25160J50197_10064404 341
148 3300009174 Ga0105241_10131627 Ga0105241_101316272 341
149 3300025246 Ga0209646_1000002 Ga0209646_1000002156 341
150 3300025250 Ga0209026_1000233 Ga0209026_100023324 341
151 3300025297 Ga0209758_1000419 Ga0209758_100041955 341
152 3300025302 Ga0207426_1000324 Ga0207426_10003245 341
153 3300049581 Ga0501047_0126110 Ga0501047_0126110_800_1960 341
154 3300049823 Ga0501044_0124502 Ga0501044_0124502_52_1212 341
155 iso_pu_bacteria 2721755487 2722727324 341
156 iso_pu_bacteria 2738541302 2738855339 341
157 iso_pu_bacteria 2818991460 2819679666 341
158 iso_pu_bacteria 2883068021 2883070864 341
159 iso_pu_bacteria 2898713307 2898713358 341
160 iso_pu_bacteria 2904445276 2904446950 341
161 iso_pu_bacteria 2904780799 2904784238 341
162 iso_pu_bacteria 2919177583 2919180206 341
163 iso_pu_bacteria 2945997725 2945999721 341
164 iso_pu_bacteria 2977232053 2977235547 341
165 3300010375 Ga0105239_10000579 Ga0105239_1000057922 342
166 3300013307 Ga0157372_10009970 Ga0157372_100099705 342
167 3300026067 Ga0207678_10295569 Ga0207678_102955692 342
168 3300037471 Ga0395905_0022329 Ga0395905_0022329_3428_4612 342
169 3300053151 Ga0500604_0024678 Ga0500604_0024678_330_1499 342
170 iso_pu_bacteria 2643221716 2644644311 342
171 iso_pu_bacteria 2738541302 2738853712 342
172 iso_pu_bacteria 2775506987 2776612088 342
173 iso_pu_bacteria 2802428842 2802652959 342
174 iso_pu_bacteria 2818991460 2819681944 342
175 iso_pu_bacteria 2821136567 2821136642 342
176 iso_pu_bacteria 2840677318 2840677968 342
177 iso_pu_bacteria 2842909656 2842910651 342
178 iso_pu_bacteria 2857613821 2857613841 342
179 iso_pu_bacteria 2857618242 2857620620 342
180 iso_pu_bacteria 2881359912 2881363704 342
181 iso_pu_bacteria 2884791551 2884795992 342
182 iso_pu_bacteria 2896085136 2896085785 342
183 iso_pu_bacteria 2896085136 2896087976 342
184 iso_pu_bacteria 2903895155 2903896317 342
185 iso_pu_bacteria 2904419702 2904423767 342
186 iso_pu_bacteria 2904445276 2904445395 342
187 iso_pu_bacteria 2904467357 2904468613 342
188 iso_pu_bacteria 2919191525 2919196364 342
189 iso_pu_bacteria 2919509842 2919512491 342
190 iso_pu_bacteria 2919683626 2919687897 342
191 iso_pu_bacteria 2929150217 2929154605 342
192 iso_pu_bacteria 2929177148 2929178499 342
193 iso_pu_bacteria 2945977869 2945980899 342
194 iso_pu_bacteria 2945997725 2946000969 342
195 iso_pu_bacteria 2946013367 2946019700 342
196 iso_pu_bacteria 2954016120 2954017870 342
197 iso_pu_bacteria 2958458903 2958463164 342
198 iso_pu_bacteria 2977268062 2977268956 342
199 iso_pu_bacteria 8054307821 8054311654 342
200 iso_pu_bacteria 8055419101 8055420697 342
201 iso_pu_bacteria 8055592153 8055594961 342
202 3300001989 JGI24739J22299_10043101 JGI24739J22299_100431011 343
203 3300001990 JGI24737J22298_10005668 JGI24737J22298_100056684 343
204 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001477 343
205 3300003320 rootH2_10019266 rootH2_100192665 343
206 3300003322 rootL2_10026318 rootL2_100263183 343
207 3300003322 rootL2_10080383 rootL2_100803831 343
208 3300003322 rootL2_10190204 rootL2_101902044 343
209 3300003323 rootH1_10013148 rootH1_100131486 343
210 3300003323 rootH1_10017001 rootH1_100170017 343
211 3300003323 rootH1_10062356 rootH1_1006235610 343
212 3300003323 rootH1_10087371 rootH1_100873712 343
213 3300003323 rootH1_10187548 rootH1_101875484 343
214 3300003354 JGI25160J50197_1003260 JGI25160J50197_10032604 343
215 3300003354 JGI25160J50197_1005642 JGI25160J50197_10056425 343
216 3300003761 Ga0055535_1001690 Ga0055535_10016908 343
217 3300003771 Ga0055526_1015403 Ga0055526_10154032 343
218 3300003790 Ga0055528_1005071 Ga0055528_10050717 343
219 3300003791 Ga0055530_10002115 Ga0055530_100021154 343
220 3300005262 Ga0065165_1000053 Ga0065165_100005374 343
221 3300005262 Ga0065165_1000505 Ga0065165_100050530 343
222 3300005329 Ga0070683_100017490 Ga0070683_1000174905 343
223 3300005335 Ga0070666_10000375 Ga0070666_1000037513 343
224 3300005338 Ga0068868_100044373 Ga0068868_1000443732 343
225 3300005340 Ga0070689_100177136 Ga0070689_1001771361 343
226 3300005353 Ga0070669_100027089 Ga0070669_1000270893 343
227 3300005355 Ga0070671_100062937 Ga0070671_1000629372 343
228 3300005364 Ga0070673_100185381 Ga0070673_1001853811 343
229 3300005367 Ga0070667_100005666 Ga0070667_1000056663 343
230 3300005367 Ga0070667_100008498 Ga0070667_1000084982 343
231 3300005458 Ga0070681_10120544 Ga0070681_101205442 343
232 3300005471 Ga0070698_100157987 Ga0070698_1001579871 343
233 3300005539 Ga0068853_100003326 Ga0068853_1000033262 343
234 3300005543 Ga0070672_100108440 Ga0070672_1001084401 343
235 3300005563 Ga0068855_100000071 Ga0068855_10000007177 343
236 3300005563 Ga0068855_100073811 Ga0068855_1000738114 343
237 3300005563 Ga0068855_100138473 Ga0068855_1001384733 343
238 3300005615 Ga0070702_100011497 Ga0070702_1000114971 343
239 3300005616 Ga0068852_100015349 Ga0068852_1000153492 343
240 3300005616 Ga0068852_100353215 Ga0068852_1003532152 343
241 3300005617 Ga0068859_100000086 Ga0068859_10000008615 343
242 3300005618 Ga0068864_100028675 Ga0068864_1000286754 343
243 3300005841 Ga0068863_100013044 Ga0068863_1000130443 343
244 3300005842 Ga0068858_100002273 Ga0068858_1000022737 343
245 3300005843 Ga0068860_100002118 Ga0068860_1000021189 343
246 3300006195 Ga0075366_10068737 Ga0075366_100687372 343
247 3300006195 Ga0075366_10125475 Ga0075366_101254751 343
248 3300006237 Ga0097621_100013909 Ga0097621_1000139094 343
249 3300006237 Ga0097621_100049927 Ga0097621_1000499272 343
250 3300006237 Ga0097621_100249767 Ga0097621_1002497671 343
251 3300006358 Ga0068871_100083784 Ga0068871_1000837842 343
252 3300006358 Ga0068871_100150597 Ga0068871_1001505973 343
253 3300006931 Ga0097620_100000086 Ga0097620_10000008668 343
254 3300009093 Ga0105240_10000698 Ga0105240_1000069828 343
255 3300009101 Ga0105247_10002917 Ga0105247_1000291710 343
256 3300009147 Ga0114129_10000714 Ga0114129_1000071421 343
257 3300009176 Ga0105242_10021527 Ga0105242_100215272 343
258 3300009177 Ga0105248_10376140 Ga0105248_103761402 343
259 3300009545 Ga0105237_10001891 Ga0105237_1000189117 343
260 3300009545 Ga0105237_10105060 Ga0105237_101050602 343
261 3300009553 Ga0105249_10003436 Ga0105249_1000343611 343
262 3300013100 Ga0157373_10003571 Ga0157373_100035714 343
263 3300013102 Ga0157371_10013855 Ga0157371_100138554 343
264 3300013102 Ga0157371_10038878 Ga0157371_100388782 343
265 3300013102 Ga0157371_10109266 Ga0157371_101092662 343
266 3300013105 Ga0157369_10002318 Ga0157369_1000231816 343
267 3300013105 Ga0157369_10192838 Ga0157369_101928382 343
268 3300013306 Ga0163162_10003760 Ga0163162_100037607 343
269 3300013306 Ga0163162_10024019 Ga0163162_100240197 343
270 3300013307 Ga0157372_10000034 Ga0157372_1000003492 343
271 3300013307 Ga0157372_10001527 Ga0157372_1000152713 343
272 3300013308 Ga0157375_10035618 Ga0157375_100356182 343
273 3300014325 Ga0163163_10173837 Ga0163163_101738372 343
274 3300014968 Ga0157379_10042210 Ga0157379_100422102 343
275 3300014969 Ga0157376_10018216 Ga0157376_100182162 343
276 3300014969 Ga0157376_10040973 Ga0157376_100409733 343
277 3300015265 Ga0182005_1000496 Ga0182005_100049615 343
278 3300025208 Ga0209436_104848 Ga0209436_1048482 343
279 3300025242 Ga0209258_100041 Ga0209258_10004179 343
280 3300025254 Ga0209148_1000090 Ga0209148_1000090156 343
281 3300025273 Ga0209673_1000034 Ga0209673_1000034122 343
282 3300025284 Ga0209130_1001027 Ga0209130_10010273 343
283 3300025295 Ga0209564_1002475 Ga0209564_10024757 343
284 3300025297 Ga0209758_1003298 Ga0209758_10032986 343
285 3300025298 Ga0209050_1000353 Ga0209050_100035377 343
286 3300025302 Ga0207426_1000177 Ga0207426_1000177103 343
287 3300025302 Ga0207426_1000592 Ga0207426_10005926 343
288 3300025302 Ga0207426_1004355 Ga0207426_10043553 343
289 3300025304 Ga0209257_1000001 Ga0209257_10000011815 343
290 3300025304 Ga0209257_1001792 Ga0209257_100179213 343
291 3300025900 Ga0207710_10006649 Ga0207710_100066492 343
292 3300025900 Ga0207710_10014277 Ga0207710_100142773 343
293 3300025903 Ga0207680_10000117 Ga0207680_1000011717 343
294 3300025913 Ga0207695_10000023 Ga0207695_1000002358 343
295 3300025913 Ga0207695_10000110 Ga0207695_10000110160 343
296 3300025913 Ga0207695_10007801 Ga0207695_100078012 343
297 3300025914 Ga0207671_10001845 Ga0207671_1000184514 343
298 3300025918 Ga0207662_10047702 Ga0207662_100477021 343
299 3300025923 Ga0207681_10030545 Ga0207681_100305453 343
300 3300025925 Ga0207650_10001164 Ga0207650_1000116417 343
301 3300025933 Ga0207706_10033675 Ga0207706_100336754 343
302 3300025940 Ga0207691_10235387 Ga0207691_102353871 343
303 3300025940 Ga0207691_10262245 Ga0207691_102622451 343
304 3300025942 Ga0207689_10000260 Ga0207689_1000026027 343
305 3300025944 Ga0207661_10009921 Ga0207661_100099214 343
306 3300025949 Ga0207667_10001623 Ga0207667_100016234 343
307 3300025949 Ga0207667_10010568 Ga0207667_100105687 343
308 3300025949 Ga0207667_10274998 Ga0207667_102749981 343
309 3300025960 Ga0207651_10062849 Ga0207651_100628492 343
310 3300025960 Ga0207651_10152072 Ga0207651_101520722 343
311 3300025961 Ga0207712_10011421 Ga0207712_100114216 343
312 3300025961 Ga0207712_10090317 Ga0207712_100903172 343
313 3300025986 Ga0207658_10001959 Ga0207658_1000195910 343
314 3300025986 Ga0207658_10027157 Ga0207658_100271571 343
315 3300026023 Ga0207677_10042300 Ga0207677_100423002 343
316 3300026035 Ga0207703_10004860 Ga0207703_100048606 343
317 3300026041 Ga0207639_10002058 Ga0207639_100020588 343
318 3300026088 Ga0207641_10000061 Ga0207641_10000061140 343
319 3300026088 Ga0207641_10065798 Ga0207641_100657982 343
320 3300026095 Ga0207676_10030694 Ga0207676_100306942 343
321 3300026142 Ga0207698_10328129 Ga0207698_103281291 343
322 3300028381 Ga0268264_10001938 Ga0268264_1000193810 343
323 3300028381 Ga0268264_10002707 Ga0268264_1000270713 343
324 3300030521 Ga0307511_10004383 Ga0307511_100043834 343
325 3300031456 Ga0307513_10052042 Ga0307513_100520422 343
326 3300031548 Ga0307408_100000523 Ga0307408_1000005231 343
327 3300031548 Ga0307408_100002864 Ga0307408_1000028648 343
328 3300031730 Ga0307516_10000577 Ga0307516_100005776 343
329 3300031911 Ga0307412_10002513 Ga0307412_100025132 343
330 3300032004 Ga0307414_10071924 Ga0307414_100719242 343
331 3300037471 Ga0395905_0006439 Ga0395905_0006439_10044_11234 343
332 3300037471 Ga0395905_0180329 Ga0395905_0180329_302_1477 343
333 3300041406 Ga0439439_0017086 Ga0439439_0017086_527_1693 343
334 3300041997 Ga0439431_0000737 Ga0439431_0000737_4583_5749 343
335 3300042004 Ga0439445_0010751 Ga0439445_0010751_135_1301 343
336 3300042435 Ga0439434_0002205 Ga0439434_0002205_1022_2188 343
337 3300044658 Ga0466972_0003358 Ga0466972_0003358_3804_4961 343
338 3300044672 Ga0466982_0101498 Ga0466982_0101498_605_1771 343
339 3300044735 Ga0466968_0003823 Ga0466968_0003823_2748_3905 343
340 3300045049 Ga0466959_0062939 Ga0466959_0062939_100_1266 343
341 3300046453 Ga0495627_004222 Ga0495627_004222_1084_2250 343
342 3300046492 Ga0495585_0000132 Ga0495585_0000132_59716_60909 343
343 3300046512 Ga0495610_0002154 Ga0495610_0002154_3508_4701 343
344 3300046520 Ga0495637_0063719 Ga0495637_0063719_169_1362 343
345 3300046558 Ga0495633_0000175 Ga0495633_0000175_63138_64304 343
346 3300046558 Ga0495633_0013201 Ga0495633_0013201_1795_2988 343
347 3300047443 Ga0495687_001120 Ga0495687_001120_828_2021 343
348 3300047472 Ga0495686_0027606 Ga0495686_0027606_470_1663 343
349 3300049571 Ga0501034_0009656 Ga0501034_0009656_2205_3392 343
350 3300049571 Ga0501034_0037269 Ga0501034_0037269_552_1709 343
351 3300049703 Ga0501219_000576 Ga0501219_000576_677_1837 343
352 3300049758 Ga0501241_000121 Ga0501241_000121_5551_6717 343
353 3300049823 Ga0501044_0011376 Ga0501044_0011376_4629_5798 343
354 3300050005 Ga0501284_00011 Ga0501284_00011_89321_90481 343
355 3300050493 nmdc:mga0k408_73788_c2 nmdc:mga0k408_73788_c2_356_1549 343
356 3300050507 nmdc:mga05p37_3494_c1 nmdc:mga05p37_3494_c1_12436_13593 343
357 3300053088 Ga0500644_0000182 Ga0500644_0000182_3049_4224 343
358 3300053090 Ga0500646_0008069 Ga0500646_0008069_261_1436 343
359 3300053092 Ga0500583_0007260 Ga0500583_0007260_2222_3397 343
360 3300053108 Ga0500562_000111 Ga0500562_000111_13581_14798 343
361 3300053121 Ga0500607_072770 Ga0500607_072770_260_1435 343
362 3300053125 Ga0500618_017274 Ga0500618_017274_531_1694 343
363 3300053136 Ga0500559_0016298 Ga0500559_0016298_1772_2947 343
364 3300053139 Ga0500568_0016532 Ga0500568_0016532_659_1816 343
365 3300053142 Ga0500577_0005308 Ga0500577_0005308_376_1551 343
366 3300053156 Ga0500622_0001039 Ga0500622_0001039_13886_15052 343
367 3300054114 Ga0501084_0012175 Ga0501084_0012175_1867_3078 343
368 3300055283 Ga0500661_010844 Ga0500661_010844_58_1224 343
369 iso_pu_bacteria 2599185184 2599477153 343
370 iso_pu_bacteria 2818991442 2819573222 343
371 iso_pu_bacteria 2842903701 2842909586 343
372 iso_pu_bacteria 2902048731 2902050799 343
373 iso_pu_bacteria 2928078545 2928079066 343
374 iso_pu_bacteria 2928147474 2928148563 343
375 iso_pu_bacteria 2929239360 2929240829 343
376 iso_pu_bacteria 2932082852 2932085857 343
377 3300003320 rootH2_10007188 rootH2_1000718841 344
378 3300005543 Ga0070672_100157263 Ga0070672_1001572632 344
379 3300005577 Ga0068857_100004433 Ga0068857_10000443313 344
380 3300005578 Ga0068854_100001289 Ga0068854_1000012893 344
381 3300005614 Ga0068856_100038584 Ga0068856_1000385846 344
382 3300006237 Ga0097621_100145627 Ga0097621_1001456272 344
383 3300009148 Ga0105243_10000011 Ga0105243_100000112 344
384 3300009551 Ga0105238_10190251 Ga0105238_101902512 344
385 3300013100 Ga0157373_10139449 Ga0157373_101394492 344
386 3300013104 Ga0157370_10002675 Ga0157370_1000267525 344
387 3300013307 Ga0157372_10003589 Ga0157372_1000358914 344
388 3300013307 Ga0157372_10012503 Ga0157372_100125033 344
389 3300025935 Ga0207709_10000034 Ga0207709_100000343 344
390 3300025949 Ga0207667_10015148 Ga0207667_100151486 344
391 3300025981 Ga0207640_10014455 Ga0207640_100144552 344
392 3300026041 Ga0207639_10081046 Ga0207639_100810462 344
393 3300026078 Ga0207702_10169950 Ga0207702_101699502 344
394 3300026116 Ga0207674_10003174 Ga0207674_1000317413 344
395 3300026142 Ga0207698_10031882 Ga0207698_100318825 344
396 3300031548 Ga0307408_100001044 Ga0307408_1000010449 344
397 3300031548 Ga0307408_100044263 Ga0307408_1000442632 344
398 3300044693 Ga0466961_0009882 Ga0466961_0009882_4267_5439 344
399 3300044765 Ga0466970_0009210 Ga0466970_0009210_786_1958 344
400 3300045049 Ga0466959_0005372 Ga0466959_0005372_4768_5940 344
401 3300045836 Ga0466958_0008462 Ga0466958_0008462_1169_2341 344
402 3300045976 Ga0466967_0130616 Ga0466967_0130616_1026_2240 344
403 3300048919 Ga0496116_0002724 Ga0496116_0002724_1919_3079 344
404 3300048920 Ga0496117_0014391 Ga0496117_0014391_3490_4650 344
405 3300048925 Ga0496122_0010272 Ga0496122_0010272_6453_7613 344
406 3300048926 Ga0496123_0028896 Ga0496123_0028896_1711_2871 344
407 3300049670 Ga0501236_001008 Ga0501236_001008_96_1259 344
408 3300049686 Ga0501257_000372 Ga0501257_000372_6911_8074 344
409 3300053151 Ga0500604_0006093 Ga0500604_0006093_996_2189 344
410 iso_pu_bacteria 2585427687 2586206915 344
411 iso_pu_bacteria 2739367651 2739588974 344
412 iso_pu_bacteria 2739367656 2739618038 344
413 iso_pu_bacteria 2739367663 2739644949 344
414 iso_pu_bacteria 2818991437 2819547950 344
415 iso_pu_bacteria 2842722452 2842726401 344
416 iso_pu_bacteria 2849281842 2849284587 344
417 iso_pu_bacteria 2857627736 2857630926 344
418 iso_pu_bacteria 2896317667 2896321235 344
419 3300001904 JGI24736J21556_1004506 JGI24736J21556_10045064 345
420 3300002773 JGI25152J39213_1000128 JGI25152J39213_100012810 345
421 3300002774 JGI25150J39212_1000021 JGI25150J39212_100002162 345
422 3300003187 JGI25151J46595_10000078 JGI25151J46595_1000007862 345
423 3300003203 JGI25406J46586_10000521 JGI25406J46586_100005216 345
424 3300003215 JGI25153J46596_10000057 JGI25153J46596_1000005762 345
425 3300003322 rootL2_10040843 rootL2_100408435 345
426 3300003323 rootH1_10006645 rootH1_1000664587 345
427 3300003781 Ga0055536_1000009 Ga0055536_1000009127 345
428 3300003781 Ga0055536_1000018 Ga0055536_100001816 345
429 3300003781 Ga0055536_1000038 Ga0055536_100003881 345
430 3300003791 Ga0055530_10001763 Ga0055530_100017637 345
431 3300003791 Ga0055530_10002626 Ga0055530_100026268 345
432 3300003791 Ga0055530_10010075 Ga0055530_100100752 345
433 3300003794 Ga0055531_10000061 Ga0055531_1000006142 345
434 3300005288 Ga0065714_10002374 Ga0065714_1000237425 345
435 3300005288 Ga0065714_10010603 Ga0065714_100106033 345
436 3300005288 Ga0065714_10064467 Ga0065714_1006446726 345
437 3300005288 Ga0065714_10104306 Ga0065714_101043061 345
438 3300005327 Ga0070658_10003995 Ga0070658_100039957 345
439 3300005328 Ga0070676_10000736 Ga0070676_1000073611 345
440 3300005328 Ga0070676_10001877 Ga0070676_100018773 345
441 3300005334 Ga0068869_100048050 Ga0068869_1000480502 345
442 3300005335 Ga0070666_10000474 Ga0070666_1000047411 345
443 3300005335 Ga0070666_10104599 Ga0070666_101045991 345
444 3300005338 Ga0068868_100002213 Ga0068868_1000022138 345
445 3300005338 Ga0068868_100002884 Ga0068868_1000028846 345
446 3300005338 Ga0068868_100044373 Ga0068868_1000443733 345
447 3300005340 Ga0070689_100038133 Ga0070689_1000381331 345
448 3300005347 Ga0070668_100000876 Ga0070668_1000008762 345
449 3300005353 Ga0070669_100001647 Ga0070669_1000016474 345
450 3300005354 Ga0070675_100050426 Ga0070675_1000504262 345
451 3300005354 Ga0070675_100204859 Ga0070675_1002048592 345
452 3300005364 Ga0070673_100001104 Ga0070673_1000011042 345
453 3300005364 Ga0070673_100203869 Ga0070673_1002038692 345
454 3300005365 Ga0070688_100081557 Ga0070688_1000815573 345
455 3300005365 Ga0070688_100112236 Ga0070688_1001122362 345
456 3300005367 Ga0070667_100000588 Ga0070667_10000058820 345
457 3300005367 Ga0070667_100027924 Ga0070667_1000279243 345
458 3300005455 Ga0070663_100046592 Ga0070663_1000465922 345
459 3300005457 Ga0070662_100013592 Ga0070662_1000135924 345
460 3300005459 Ga0068867_100035423 Ga0068867_1000354232 345
461 3300005459 Ga0068867_100136493 Ga0068867_1001364931 345
462 3300005539 Ga0068853_100021933 Ga0068853_1000219332 345
463 3300005543 Ga0070672_100000511 Ga0070672_1000005118 345
464 3300005543 Ga0070672_100148887 Ga0070672_1001488872 345
465 3300005548 Ga0070665_100001321 Ga0070665_10000132112 345
466 3300005563 Ga0068855_100151087 Ga0068855_1001510872 345
467 3300005564 Ga0070664_100184146 Ga0070664_1001841462 345
468 3300005577 Ga0068857_100144436 Ga0068857_1001444363 345
469 3300005616 Ga0068852_100010804 Ga0068852_1000108048 345
470 3300005616 Ga0068852_100049983 Ga0068852_1000499832 345
471 3300005616 Ga0068852_100109176 Ga0068852_1001091762 345
472 3300005617 Ga0068859_100015843 Ga0068859_1000158433 345
473 3300005618 Ga0068864_100002120 Ga0068864_1000021203 345
474 3300005719 Ga0068861_100000923 Ga0068861_10000092310 345
475 3300005719 Ga0068861_100073932 Ga0068861_1000739322 345
476 3300005834 Ga0068851_10000384 Ga0068851_100003849 345
477 3300005841 Ga0068863_100001340 Ga0068863_10000134011 345
478 3300005841 Ga0068863_100141315 Ga0068863_1001413152 345
479 3300005842 Ga0068858_100004360 Ga0068858_1000043602 345
480 3300005843 Ga0068860_100044232 Ga0068860_1000442323 345
481 3300005843 Ga0068860_100077080 Ga0068860_1000770805 345
482 3300005844 Ga0068862_100063199 Ga0068862_1000631992 345
483 3300005985 Ga0081539_10000147 Ga0081539_1000014715 345
484 3300006358 Ga0068871_100001314 Ga0068871_1000013143 345
485 3300006358 Ga0068871_100025101 Ga0068871_1000251013 345
486 3300006847 Ga0075431_100024145 Ga0075431_1000241454 345
487 3300006880 Ga0075429_100009693 Ga0075429_1000096933 345
488 3300006881 Ga0068865_100030969 Ga0068865_1000309692 345
489 3300006881 Ga0068865_100184774 Ga0068865_1001847741 345
490 3300006931 Ga0097620_100015843 Ga0097620_1000158433 345
491 3300006946 Ga0079104_1000691 Ga0079104_10006916 345
492 3300006948 Ga0099826_10002736 Ga0099826_100027369 345
493 3300009011 Ga0105251_10033920 Ga0105251_100339202 345
494 3300009093 Ga0105240_10000195 Ga0105240_1000019522 345
495 3300009093 Ga0105240_10001517 Ga0105240_1000151727 345
496 3300009093 Ga0105240_10003007 Ga0105240_100030078 345
497 3300009093 Ga0105240_10009054 Ga0105240_100090548 345
498 3300009093 Ga0105240_10012381 Ga0105240_100123819 345
499 3300009094 Ga0111539_10002087 Ga0111539_1000208720 345
500 3300009101 Ga0105247_10000793 Ga0105247_100007935 345
501 3300009174 Ga0105241_10000254 Ga0105241_100002543 345
502 3300009176 Ga0105242_10020788 Ga0105242_100207882 345
503 3300009177 Ga0105248_10067327 Ga0105248_100673272 345
504 3300009545 Ga0105237_10002105 Ga0105237_1000210516 345
505 3300009545 Ga0105237_10024976 Ga0105237_100249764 345
506 3300009545 Ga0105237_10033300 Ga0105237_100333002 345
507 3300009551 Ga0105238_10000496 Ga0105238_1000049623 345
508 3300009551 Ga0105238_10002761 Ga0105238_100027611 345
509 3300009553 Ga0105249_10004284 Ga0105249_100042848 345
510 3300009553 Ga0105249_10038377 Ga0105249_100383773 345
511 3300009553 Ga0105249_10047688 Ga0105249_100476883 345
512 3300009553 Ga0105249_10176696 Ga0105249_101766962 345
513 3300010375 Ga0105239_10185231 Ga0105239_101852312 345
514 3300010375 Ga0105239_10468354 Ga0105239_104683542 345
515 3300011119 Ga0105246_10015666 Ga0105246_100156664 345
516 3300013100 Ga0157373_10001036 Ga0157373_100010367 345
517 3300013102 Ga0157371_10000034 Ga0157371_10000034180 345
518 3300013102 Ga0157371_10005972 Ga0157371_100059722 345
519 3300013102 Ga0157371_10038726 Ga0157371_100387262 345
520 3300013104 Ga0157370_10000405 Ga0157370_1000040521 345
521 3300013104 Ga0157370_10000640 Ga0157370_1000064023 345
522 3300013104 Ga0157370_10000920 Ga0157370_100009207 345
523 3300013104 Ga0157370_10002194 Ga0157370_1000219411 345
524 3300013104 Ga0157370_10002625 Ga0157370_100026258 345
525 3300013104 Ga0157370_10003317 Ga0157370_100033172 345
526 3300013104 Ga0157370_10004387 Ga0157370_100043871 345
527 3300013104 Ga0157370_10004945 Ga0157370_100049453 345
528 3300013104 Ga0157370_10007720 Ga0157370_100077206 345
529 3300013104 Ga0157370_10024727 Ga0157370_100247275 345
530 3300013104 Ga0157370_10027437 Ga0157370_100274374 345
531 3300013104 Ga0157370_10097344 Ga0157370_100973442 345
532 3300013104 Ga0157370_10348614 Ga0157370_103486142 345
533 3300013105 Ga0157369_10000002 Ga0157369_1000000299 345
534 3300013105 Ga0157369_10193466 Ga0157369_101934661 345
535 3300013296 Ga0157374_10000001 Ga0157374_10000001126 345
536 3300013296 Ga0157374_10043822 Ga0157374_100438223 345
537 3300013297 Ga0157378_10058343 Ga0157378_100583432 345
538 3300013297 Ga0157378_10076231 Ga0157378_100762312 345
539 3300013297 Ga0157378_10299420 Ga0157378_102994201 345
540 3300013306 Ga0163162_10000674 Ga0163162_100006749 345
541 3300013306 Ga0163162_10001501 Ga0163162_1000150115 345
542 3300013306 Ga0163162_10005335 Ga0163162_100053353 345
543 3300013306 Ga0163162_10019498 Ga0163162_100194983 345
544 3300013307 Ga0157372_10072036 Ga0157372_100720363 345
545 3300013307 Ga0157372_10095794 Ga0157372_100957942 345
546 3300013307 Ga0157372_10104462 Ga0157372_101044622 345
547 3300013307 Ga0157372_10112438 Ga0157372_101124382 345
548 3300013307 Ga0157372_10410641 Ga0157372_104106411 345
549 3300013308 Ga0157375_10004612 Ga0157375_100046123 345
550 3300013308 Ga0157375_10025638 Ga0157375_100256382 345
551 3300014325 Ga0163163_10003420 Ga0163163_100034203 345
552 3300014326 Ga0157380_10284510 Ga0157380_102845101 345
553 3300014497 Ga0182008_10000335 Ga0182008_1000033523 345
554 3300014497 Ga0182008_10000613 Ga0182008_1000061321 345
555 3300014497 Ga0182008_10016639 Ga0182008_100166392 345
556 3300014497 Ga0182008_10050526 Ga0182008_100505262 345
557 3300014745 Ga0157377_10036152 Ga0157377_100361521 345
558 3300014968 Ga0157379_10000571 Ga0157379_100005714 345
559 3300014968 Ga0157379_10023146 Ga0157379_100231462 345
560 3300014968 Ga0157379_10176621 Ga0157379_101766212 345
561 3300014969 Ga0157376_10002660 Ga0157376_100026608 345
562 3300014969 Ga0157376_10088822 Ga0157376_100888222 345
563 3300015261 Ga0182006_1000770 Ga0182006_10007706 345
564 3300015261 Ga0182006_1001696 Ga0182006_10016964 345
565 3300015261 Ga0182006_1002006 Ga0182006_10020067 345
566 3300015261 Ga0182006_1005799 Ga0182006_10057992 345
567 3300015261 Ga0182006_1007598 Ga0182006_10075984 345
568 3300015262 Ga0182007_10000001 Ga0182007_10000001678 345
569 3300015682 Ga0183373_1003 Ga0183373_1003140 345
570 3300017792 Ga0163161_10000108 Ga0163161_100001081 345
571 3300017792 Ga0163161_10000913 Ga0163161_100009139 345
572 3300017792 Ga0163161_10008720 Ga0163161_100087205 345
573 3300017792 Ga0163161_10017167 Ga0163161_100171676 345
574 3300017792 Ga0163161_10072957 Ga0163161_100729572 345
575 3300025245 Ga0207425_1000004 Ga0207425_100000460 345
576 3300025258 Ga0209129_1000048 Ga0209129_100004860 345
577 3300025292 Ga0209676_1000001 Ga0209676_1000001112 345
578 3300025292 Ga0209676_1000001 Ga0209676_10000011224 345
579 3300025292 Ga0209676_1000201 Ga0209676_100020129 345
580 3300025294 Ga0209025_1000009 Ga0209025_100000960 345
581 3300025297 Ga0209758_1000010 Ga0209758_100001061 345
582 3300025298 Ga0209050_1000018 Ga0209050_1000018360 345
583 3300025298 Ga0209050_1000114 Ga0209050_1000114140 345
584 3300025298 Ga0209050_1000203 Ga0209050_100020329 345
585 3300025304 Ga0209257_1000006 Ga0209257_1000006212 345
586 3300025903 Ga0207680_10000801 Ga0207680_100008014 345
587 3300025908 Ga0207643_10010554 Ga0207643_100105543 345
588 3300025909 Ga0207705_10003352 Ga0207705_100033528 345
589 3300025909 Ga0207705_10022080 Ga0207705_100220802 345
590 3300025911 Ga0207654_10016425 Ga0207654_100164254 345
591 3300025911 Ga0207654_10098384 Ga0207654_100983841 345
592 3300025913 Ga0207695_10000229 Ga0207695_1000022983 345
593 3300025913 Ga0207695_10035045 Ga0207695_100350455 345
594 3300025914 Ga0207671_10002829 Ga0207671_1000282919 345
595 3300025914 Ga0207671_10003885 Ga0207671_100038853 345
596 3300025914 Ga0207671_10039435 Ga0207671_100394352 345
597 3300025919 Ga0207657_10261809 Ga0207657_102618091 345
598 3300025920 Ga0207649_10089604 Ga0207649_100896042 345
599 3300025921 Ga0207652_10001773 Ga0207652_100017734 345
600 3300025923 Ga0207681_10040645 Ga0207681_100406452 345
601 3300025924 Ga0207694_10010106 Ga0207694_100101062 345
602 3300025925 Ga0207650_10124656 Ga0207650_101246561 345
603 3300025932 Ga0207690_10099092 Ga0207690_100990923 345
604 3300025933 Ga0207706_10013982 Ga0207706_100139824 345
605 3300025938 Ga0207704_10003386 Ga0207704_100033863 345
606 3300025940 Ga0207691_10054945 Ga0207691_100549452 345
607 3300025942 Ga0207689_10063560 Ga0207689_100635602 345
608 3300025942 Ga0207689_10141868 Ga0207689_101418681 345
609 3300025949 Ga0207667_10123376 Ga0207667_101233762 345
610 3300025960 Ga0207651_10000857 Ga0207651_100008573 345
611 3300025960 Ga0207651_10039267 Ga0207651_100392672 345
612 3300025972 Ga0207668_10001121 Ga0207668_100011212 345
613 3300025972 Ga0207668_10046723 Ga0207668_100467232 345
614 3300025986 Ga0207658_10001753 Ga0207658_1000175311 345
615 3300026023 Ga0207677_10001454 Ga0207677_100014543 345
616 3300026023 Ga0207677_10042300 Ga0207677_100423001 345
617 3300026023 Ga0207677_10052126 Ga0207677_100521262 345
618 3300026035 Ga0207703_10010647 Ga0207703_100106475 345
619 3300026041 Ga0207639_10029547 Ga0207639_100295472 345
620 3300026088 Ga0207641_10038139 Ga0207641_100381392 345
621 3300026089 Ga0207648_10050290 Ga0207648_100502903 345
622 3300026089 Ga0207648_10156527 Ga0207648_101565272 345
623 3300026116 Ga0207674_10033080 Ga0207674_100330801 345
624 3300026116 Ga0207674_10267925 Ga0207674_102679251 345
625 3300026118 Ga0207675_100005957 Ga0207675_1000059576 345
626 3300026118 Ga0207675_100090022 Ga0207675_1000900223 345
627 3300026142 Ga0207698_10037794 Ga0207698_100377942 345
628 3300026142 Ga0207698_10168944 Ga0207698_101689441 345
629 3300027111 Ga0209281_1000037 Ga0209281_10000376 345
630 3300027666 Ga0209282_1006995 Ga0209282_10069953 345
631 3300028379 Ga0268266_10003239 Ga0268266_100032397 345
632 3300028381 Ga0268264_10004286 Ga0268264_100042866 345
633 3300028381 Ga0268264_10072295 Ga0268264_100722953 345
634 3300028794 Ga0307515_10270711 Ga0307515_102707112 345
635 3300030731 Ga0316177_1078287 Ga0316177_10782872 345
636 3300030732 Ga0316176_1082807 Ga0316176_108280714 345
637 3300030742 Ga0316183_1015945 Ga0316183_10159455 345
638 3300030744 Ga0316181_1158450 Ga0316181_11584505 345
639 3300031731 Ga0307405_10000031 Ga0307405_1000003127 345
640 3300031903 Ga0307407_10000065 Ga0307407_100000657 345
641 3300032002 Ga0307416_100000146 Ga0307416_10000014628 345
642 3300032002 Ga0307416_100146571 Ga0307416_1001465712 345
643 3300032004 Ga0307414_10001598 Ga0307414_1000159811 345
644 3300032004 Ga0307414_10011142 Ga0307414_100111422 345
645 3300032004 Ga0307414_10013353 Ga0307414_100133532 345
646 3300033180 Ga0307510_10022799 Ga0307510_100227992 345
647 3300036401 Ga0373937_0035884 Ga0373937_0035884_1311_2489 345
648 3300038443 Ga0395901_0416372 Ga0395901_0416372_46_1230 345
649 3300039437 Ga0436365_0920295 Ga0436365_0920295_42591_43754 345
650 3300041997 Ga0439431_0018540 Ga0439431_0018540_142_1305 345
651 3300042135 Ga0450899_003127 Ga0450899_003127_504_1667 345
652 3300042876 Ga0451577_0016763 Ga0451577_0016763_3760_4935 345
653 3300044683 Ga0466965_0021300 Ga0466965_0021300_253_1434 345
654 3300044712 Ga0453684_0001775 Ga0453684_0001775_332_1507 345
655 3300045051 Ga0451576_0006920 Ga0451576_0006920_2092_3261 345
656 3300046512 Ga0495610_0000064 Ga0495610_0000064_38061_39224 345
657 3300046512 Ga0495610_0001020 Ga0495610_0001020_4503_5666 345
658 3300046512 Ga0495610_0005260 Ga0495610_0005260_2399_3562 345
659 3300046524 Ga0495648_0007897 Ga0495648_0007897_676_1851 345
660 3300046558 Ga0495633_0000223 Ga0495633_0000223_7246_8430 345
661 3300046616 Ga0495668_0000191 Ga0495668_0000191_57869_59035 345
662 3300047320 Ga0495672_0015522 Ga0495672_0015522_539_1702 345
663 3300047443 Ga0495687_000001 Ga0495687_000001_238786_240036 345
664 3300047472 Ga0495686_0004164 Ga0495686_0004164_10455_11636 345
665 3300048925 Ga0496122_0000765 Ga0496122_0000765_44047_45222 345
666 3300048926 Ga0496123_0005845 Ga0496123_0005845_3751_4926 345
667 3300049679 Ga0501249_000005 Ga0501249_000005_48030_49211 345
668 3300050508 nmdc:mga09592_198153_c1 nmdc:mga09592_198153_c1_452_1618 345
669 3300053096 Ga0500641_0000117 Ga0500641_0000117_17695_18897 345
670 3300053156 Ga0500622_0000026 Ga0500622_0000026_219996_221165 345
671 3300053156 Ga0500622_0000365 Ga0500622_0000365_14502_15671 345
672 3300053156 Ga0500622_0021016 Ga0500622_0021016_1076_2251 345
673 iso_pu_bacteria 2519899754 2520878058 345
674 iso_pu_bacteria 2738541283 2738759709 345
675 iso_pu_bacteria 2738543023 2739304614 345
676 iso_pu_bacteria 2852627209 2852628563 345
677 iso_pu_bacteria 2919186247 2919186934 345
678 iso_pu_bacteria 2939664404 2939665797 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03786

UxuA

D-mannonate dehydratase (UxuA)

42

424

0.98

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

130

381

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ban-assembly1.cif.gz_B the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.7617 2 344
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.7551 1 344
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.7512 1 345
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.7492 1 345
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.7353 3 343
ID Description Score Start End Superfamily
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8376 1 345 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8316 131 345 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8252 1 345 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7996 131 345 3.20.20.150
3banB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7617 2 344 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A530M004-F1-model_v4 deleted 0.9912 217 297
AF-A0A4U9D021-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.9796 208 297 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A060CDP4-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9737 3 68 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A349W3N1-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9727 206 285 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A520IDC8-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9697 214 345 GO:0008198
GO:0008927
GO:0030145
GO:0042840

Feature Viewer

pLDDT pTM Quality
80.7 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map