F474624
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 339 | 595 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300003203|JGI25406J46586_10000521|JGI25406J46586_100005216 |
| Length | 431 |
| Sequence | LCNTTTYLRGQQESHLMNQATTSDVASNSFLVGEGWDGAYLFTQAMRWFGPNDPVSLWDIKQAGCSGVVTALHHIPAGEVWNVDEILKRKNEIEAIGLTWDVVESVFVNEAIKTQTGDFKKYIENYKITLYNLAACGINIVTYNFMPVLDWTRTDLSYTMPDDSKALRFERAAFVAFDMYILGRENAEHDYTWEELNRAKERYEAMSDEEIEQLQRNIIAGLPGSSEGFTMNDFRKALEPYKNIDTQKLQQHLIYFLKEIIPAAEEAGVMMAIHPDDPPYSILGLPRVVCTARQVQQLVDAVPSLNNGLCFCTGSFGVRIDNNLPKMIEQFSDRIHFVHLRSTRRNEYGDFYEDNHLEGDVDMYSVVKKLLEVMRRRKVSLPMRPDHGHQMLDDLKKKTNPGYSAIGRLRGLAELRGLEMGIYKSLFAKAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 5 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 6 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 7 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 8 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 9 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 10 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 11 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 12 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 13 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 14 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 15 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 16 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 17 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 18 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 19 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 20 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 21 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 22 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 23 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 24 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 25 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 26 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 27 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 28 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 29 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 30 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 31 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 32 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 33 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 34 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 35 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 36 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 37 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 38 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 39 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 40 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 41 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 42 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 43 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 44 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 45 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 46 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 47 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 48 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 49 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 50 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 51 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 52 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 53 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 54 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 55 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 56 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 57 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 58 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 59 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 60 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 61 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 62 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 63 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 64 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 65 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 66 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 67 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 68 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 69 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 70 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 71 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 72 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 73 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 74 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 75 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 76 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 77 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 79 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 80 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 81 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 82 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 83 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 91 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 97 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 100 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 109 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 115 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 128 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 129 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 130 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 131 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 132 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 133 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 134 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 135 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 136 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 137 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 138 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 140 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 141 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 145 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 146 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 173 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 248 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 249 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 250 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 254 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 256 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 271 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 272 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 276 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 277 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 312 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 313 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 323 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 326 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 327 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 332 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 336 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 337 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 338 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 339 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.79 |
| Metatranscriptomes | 0 |
| Isolates | 11.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.18 |
| Nodule | 0.59 |
| Rhizoplane | 0.29 |
| Rhizosphere | 75.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004506 | 3300001904 | Bacteria | 2375 |
| 2 | JGI24740J21852_10003264 | 3300001979 | Bacteria | 7158 |
| 3 | JGI24739J22299_10043101 | 3300001989 | Bacteria | 1493 |
| 4 | JGI24737J22298_10005668 | 3300001990 | Bacteria | 4299 |
| 5 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 6 | JGI25154J39366_1000001 | 3300002738 | Bacteria | 483450 |
| 7 | JGI25152J39213_1000128 | 3300002773 | Bacteria | 51965 |
| 8 | JGI25150J39212_1000021 | 3300002774 | Bacteria | 133190 |
| 9 | JGI25151J46595_10000078 | 3300003187 | Bacteria | 133190 |
| 10 | JGI25406J46586_10000521 | 3300003203 | Bacteria | 17983 |
| 11 | JGI25153J46596_10000057 | 3300003215 | Bacteria | 133190 |
| 12 | JGI25153J46596_10000209 | 3300003215 | Bacteria | 52915 |
| 13 | rootH1_10035249 | 3300003316 | Bacteria | 45273 |
| 14 | rootH1_10132184 | 3300003316 | Bacteria | 3909 |
| 15 | rootH2_10007188 | 3300003320 | Bacteria | 50032 |
| 16 | rootH2_10019266 | 3300003320 | Bacteria | 14510 |
| 17 | rootH2_10022625 | 3300003320 | Bacteria | 19374 |
| 18 | rootL2_10002510 | 3300003322 | Bacteria | 3604 |
| 19 | rootL2_10026318 | 3300003322 | Bacteria | 3083 |
| 20 | rootL2_10040843 | 3300003322 | Bacteria | 6397 |
| 21 | rootL2_10080383 | 3300003322 | Bacteria | 3966 |
| 22 | rootL2_10190204 | 3300003322 | Unclassified | 2930 |
| 23 | rootH1_10006645 | 3300003323 | Bacteria | 138273 |
| 24 | rootH1_10013148 | 3300003323 | Bacteria | 11892 |
| 25 | rootH1_10017001 | 3300003323 | Bacteria | 11181 |
| 26 | rootH1_10039506 | 3300003323 | Bacteria | 11154 |
| 27 | rootH1_10062356 | 3300003323 | Bacteria | 12638 |
| 28 | rootH1_10087371 | 3300003323 | Bacteria | 5579 |
| 29 | rootH1_10187548 | 3300003323 | Bacteria | 12847 |
| 30 | JGI25160J50197_1003260 | 3300003354 | Bacteria | 7312 |
| 31 | JGI25160J50197_1005642 | 3300003354 | Bacteria | 5179 |
| 32 | JGI25160J50197_1006440 | 3300003354 | Bacteria | 4752 |
| 33 | Ga0055535_1001690 | 3300003761 | Bacteria | 10071 |
| 34 | Ga0055526_1015403 | 3300003771 | Bacteria | 3069 |
| 35 | Ga0055536_1000009 | 3300003781 | Bacteria | 311572 |
| 36 | Ga0055536_1000018 | 3300003781 | Bacteria | 205832 |
| 37 | Ga0055536_1000038 | 3300003781 | Bacteria | 133102 |
| 38 | Ga0055528_1005071 | 3300003790 | Bacteria | 6217 |
| 39 | Ga0055530_10001763 | 3300003791 | Bacteria | 15122 |
| 40 | Ga0055530_10002115 | 3300003791 | Bacteria | 13226 |
| 41 | Ga0055530_10002626 | 3300003791 | Bacteria | 11280 |
| 42 | Ga0055530_10010075 | 3300003791 | Bacteria | 3545 |
| 43 | Ga0055531_10000061 | 3300003794 | Bacteria | 120535 |
| 44 | Ga0065165_1000053 | 3300005262 | Bacteria | 189081 |
| 45 | Ga0065165_1000505 | 3300005262 | Bacteria | 60144 |
| 46 | Ga0065714_10002374 | 3300005288 | Bacteria | 37517 |
| 47 | Ga0065714_10010603 | 3300005288 | Bacteria | 5989 |
| 48 | Ga0065714_10064467 | 3300005288 | Bacteria | 63317 |
| 49 | Ga0065714_10076716 | 3300005288 | Bacteria | 2762 |
| 50 | Ga0065714_10094227 | 3300005288 | Bacteria | 1823 |
| 51 | Ga0065714_10104306 | 3300005288 | Bacteria | 1587 |
| 52 | Ga0070658_10003995 | 3300005327 | Bacteria | 12090 |
| 53 | Ga0070676_10000736 | 3300005328 | Bacteria | 16050 |
| 54 | Ga0070676_10001877 | 3300005328 | Bacteria | 10683 |
| 55 | Ga0070676_10206653 | 3300005328 | Bacteria | 1290 |
| 56 | Ga0070683_100000416 | 3300005329 | Bacteria | 29488 |
| 57 | Ga0070683_100017490 | 3300005329 | Bacteria | 6337 |
| 58 | Ga0070670_100100218 | 3300005331 | Bacteria | 2493 |
| 59 | Ga0068869_100048050 | 3300005334 | Unclassified | 3084 |
| 60 | Ga0068869_100245983 | 3300005334 | Bacteria | 1427 |
| 61 | Ga0070666_10000375 | 3300005335 | Bacteria | 28142 |
| 62 | Ga0070666_10000474 | 3300005335 | Bacteria | 24278 |
| 63 | Ga0070666_10005234 | 3300005335 | Bacteria | 7944 |
| 64 | Ga0070666_10104599 | 3300005335 | Bacteria | 1954 |
| 65 | Ga0070682_100016548 | 3300005337 | Bacteria | 4289 |
| 66 | Ga0068868_100002213 | 3300005338 | Bacteria | 13436 |
| 67 | Ga0068868_100002884 | 3300005338 | Bacteria | 11932 |
| 68 | Ga0068868_100031804 | 3300005338 | Bacteria | 4057 |
| 69 | Ga0068868_100044373 | 3300005338 | Bacteria | 3476 |
| 70 | Ga0070689_100038133 | 3300005340 | Bacteria | 3675 |
| 71 | Ga0070689_100177136 | 3300005340 | Bacteria | 1730 |
| 72 | Ga0070661_100052272 | 3300005344 | Bacteria | 2990 |
| 73 | Ga0070668_100000876 | 3300005347 | Bacteria | 20916 |
| 74 | Ga0070669_100001647 | 3300005353 | Bacteria | 16171 |
| 75 | Ga0070669_100027089 | 3300005353 | Bacteria | 4125 |
| 76 | Ga0070675_100050426 | 3300005354 | Bacteria | 3417 |
| 77 | Ga0070675_100204859 | 3300005354 | Bacteria | 1713 |
| 78 | Ga0070671_100002219 | 3300005355 | Bacteria | 14995 |
| 79 | Ga0070671_100062937 | 3300005355 | Bacteria | 3089 |
| 80 | Ga0070674_100042044 | 3300005356 | Bacteria | 3102 |
| 81 | Ga0070673_100001104 | 3300005364 | Bacteria | 15457 |
| 82 | Ga0070673_100050103 | 3300005364 | Bacteria | 3263 |
| 83 | Ga0070673_100185381 | 3300005364 | Bacteria | 1784 |
| 84 | Ga0070673_100203869 | 3300005364 | Bacteria | 1704 |
| 85 | Ga0070688_100081557 | 3300005365 | Bacteria | 2095 |
| 86 | Ga0070688_100112236 | 3300005365 | Bacteria | 1814 |
| 87 | Ga0070667_100000588 | 3300005367 | Bacteria | 35773 |
| 88 | Ga0070667_100005666 | 3300005367 | Bacteria | 10430 |
| 89 | Ga0070667_100008498 | 3300005367 | Bacteria | 8512 |
| 90 | Ga0070667_100027924 | 3300005367 | Bacteria | 4696 |
| 91 | Ga0070667_100106094 | 3300005367 | Bacteria | 2432 |
| 92 | Ga0070663_100046592 | 3300005455 | Bacteria | 3068 |
| 93 | Ga0070678_100003233 | 3300005456 | Bacteria | 9050 |
| 94 | Ga0070662_100013592 | 3300005457 | Bacteria | 5420 |
| 95 | Ga0070681_10120544 | 3300005458 | Bacteria | 2558 |
| 96 | Ga0068867_100035423 | 3300005459 | Bacteria | 3620 |
| 97 | Ga0068867_100074820 | 3300005459 | Bacteria | 2540 |
| 98 | Ga0068867_100136493 | 3300005459 | Bacteria | 1913 |
| 99 | Ga0068867_100159772 | 3300005459 | Bacteria | 1776 |
| 100 | Ga0070698_100157987 | 3300005471 | Bacteria | 2212 |
| 101 | Ga0070684_100019166 | 3300005535 | Bacteria | 5657 |
| 102 | Ga0068853_100003326 | 3300005539 | Bacteria | 12307 |
| 103 | Ga0068853_100021933 | 3300005539 | Bacteria | 5327 |
| 104 | Ga0070672_100000511 | 3300005543 | Bacteria | 22741 |
| 105 | Ga0070672_100108440 | 3300005543 | Bacteria | 2260 |
| 106 | Ga0070672_100148887 | 3300005543 | Bacteria | 1935 |
| 107 | Ga0070672_100157263 | 3300005543 | Bacteria | 1883 |
| 108 | Ga0070665_100001321 | 3300005548 | Bacteria | 29603 |
| 109 | Ga0068855_100000071 | 3300005563 | Bacteria | 122638 |
| 110 | Ga0068855_100006106 | 3300005563 | Bacteria | 14690 |
| 111 | Ga0068855_100073811 | 3300005563 | Bacteria | 3963 |
| 112 | Ga0068855_100138473 | 3300005563 | Bacteria | 2776 |
| 113 | Ga0068855_100151087 | 3300005563 | Bacteria | 2641 |
| 114 | Ga0070664_100128937 | 3300005564 | Bacteria | 2221 |
| 115 | Ga0070664_100184146 | 3300005564 | Bacteria | 1858 |
| 116 | Ga0070664_100308898 | 3300005564 | Bacteria | 1430 |
| 117 | Ga0068857_100004433 | 3300005577 | Bacteria | 11872 |
| 118 | Ga0068857_100027897 | 3300005577 | Bacteria | 4979 |
| 119 | Ga0068857_100082991 | 3300005577 | Bacteria | 2863 |
| 120 | Ga0068857_100144436 | 3300005577 | Bacteria | 2152 |
| 121 | Ga0068854_100001289 | 3300005578 | Bacteria | 15085 |
| 122 | Ga0068854_100055961 | 3300005578 | Bacteria | 2842 |
| 123 | Ga0068854_100117892 | 3300005578 | Bacteria | 2011 |
| 124 | Ga0068856_100038584 | 3300005614 | Bacteria | 4689 |
| 125 | Ga0070702_100011497 | 3300005615 | Bacteria | 4404 |
| 126 | Ga0068852_100010804 | 3300005616 | Bacteria | 6840 |
| 127 | Ga0068852_100015349 | 3300005616 | Bacteria | 5936 |
| 128 | Ga0068852_100049983 | 3300005616 | Bacteria | 3580 |
| 129 | Ga0068852_100109176 | 3300005616 | Bacteria | 2512 |
| 130 | Ga0068852_100353215 | 3300005616 | Bacteria | 1436 |
| 131 | Ga0068859_100000086 | 3300005617 | Bacteria | 85696 |
| 132 | Ga0068859_100015843 | 3300005617 | Bacteria | 7574 |
| 133 | Ga0068859_100025448 | 3300005617 | Bacteria | 5936 |
| 134 | Ga0068859_100190057 | 3300005617 | Bacteria | 2138 |
| 135 | Ga0068864_100002120 | 3300005618 | Bacteria | 16404 |
| 136 | Ga0068864_100028675 | 3300005618 | Bacteria | 4708 |
| 137 | Ga0068866_10067325 | 3300005718 | Unclassified | 1880 |
| 138 | Ga0068861_100000923 | 3300005719 | Bacteria | 17840 |
| 139 | Ga0068861_100050923 | 3300005719 | Bacteria | 3142 |
| 140 | Ga0068861_100073932 | 3300005719 | Bacteria | 2649 |
| 141 | Ga0068851_10000384 | 3300005834 | Bacteria | 20008 |
| 142 | Ga0068863_100001340 | 3300005841 | Bacteria | 24519 |
| 143 | Ga0068863_100013044 | 3300005841 | Bacteria | 8013 |
| 144 | Ga0068863_100141315 | 3300005841 | Bacteria | 2301 |
| 145 | Ga0068863_100248112 | 3300005841 | Bacteria | 1719 |
| 146 | Ga0068858_100002273 | 3300005842 | Bacteria | 19437 |
| 147 | Ga0068858_100004360 | 3300005842 | Bacteria | 13883 |
| 148 | Ga0068860_100002118 | 3300005843 | Bacteria | 20935 |
| 149 | Ga0068860_100044232 | 3300005843 | Bacteria | 4245 |
| 150 | Ga0068860_100077080 | 3300005843 | Bacteria | 3170 |
| 151 | Ga0068862_100063199 | 3300005844 | Unclassified | 3185 |
| 152 | Ga0081539_10000147 | 3300005985 | Bacteria | 164274 |
| 153 | Ga0075366_10068737 | 3300006195 | Bacteria | 2108 |
| 154 | Ga0075366_10125475 | 3300006195 | Bacteria | 1548 |
| 155 | Ga0097621_100003220 | 3300006237 | Bacteria | 11219 |
| 156 | Ga0097621_100013909 | 3300006237 | Bacteria | 6010 |
| 157 | Ga0097621_100014395 | 3300006237 | Bacteria | 5920 |
| 158 | Ga0097621_100049927 | 3300006237 | Bacteria | 3401 |
| 159 | Ga0097621_100145627 | 3300006237 | Bacteria | 2028 |
| 160 | Ga0097621_100249767 | 3300006237 | Bacteria | 1553 |
| 161 | Ga0068871_100001314 | 3300006358 | Bacteria | 16613 |
| 162 | Ga0068871_100025101 | 3300006358 | Bacteria | 4632 |
| 163 | Ga0068871_100083784 | 3300006358 | Bacteria | 2645 |
| 164 | Ga0068871_100150597 | 3300006358 | Bacteria | 1984 |
| 165 | Ga0068871_100156621 | 3300006358 | Bacteria | 1945 |
| 166 | Ga0068871_100233535 | 3300006358 | Bacteria | 1597 |
| 167 | Ga0075431_100024145 | 3300006847 | Bacteria | 6225 |
| 168 | Ga0075429_100009693 | 3300006880 | Bacteria | 8351 |
| 169 | Ga0068865_100030969 | 3300006881 | Bacteria | 3562 |
| 170 | Ga0068865_100184774 | 3300006881 | Bacteria | 1608 |
| 171 | Ga0068865_100218210 | 3300006881 | Bacteria | 1490 |
| 172 | Ga0097620_100000086 | 3300006931 | Bacteria | 85696 |
| 173 | Ga0097620_100015843 | 3300006931 | Bacteria | 7574 |
| 174 | Ga0097620_100025449 | 3300006931 | Bacteria | 5936 |
| 175 | Ga0097620_100190063 | 3300006931 | Bacteria | 2138 |
| 176 | Ga0079104_1000691 | 3300006946 | Bacteria | 30800 |
| 177 | Ga0099826_10002736 | 3300006948 | Bacteria | 11551 |
| 178 | Ga0105251_10033920 | 3300009011 | Bacteria | 2529 |
| 179 | Ga0105244_10000120 | 3300009036 | Bacteria | 82283 |
| 180 | Ga0105240_10000195 | 3300009093 | Bacteria | 123313 |
| 181 | Ga0105240_10000698 | 3300009093 | Bacteria | 61738 |
| 182 | Ga0105240_10001517 | 3300009093 | Bacteria | 39516 |
| 183 | Ga0105240_10003007 | 3300009093 | Bacteria | 26534 |
| 184 | Ga0105240_10009054 | 3300009093 | Bacteria | 14136 |
| 185 | Ga0105240_10012381 | 3300009093 | Bacteria | 11780 |
| 186 | Ga0111539_10002087 | 3300009094 | Bacteria | 26711 |
| 187 | Ga0105247_10000793 | 3300009101 | Bacteria | 24229 |
| 188 | Ga0105247_10002917 | 3300009101 | Bacteria | 11377 |
| 189 | Ga0114129_10000714 | 3300009147 | Bacteria | 42000 |
| 190 | Ga0105243_10000011 | 3300009148 | Bacteria | 312350 |
| 191 | Ga0105241_10000254 | 3300009174 | Bacteria | 40113 |
| 192 | Ga0105241_10090605 | 3300009174 | Bacteria | 2412 |
| 193 | Ga0105241_10131627 | 3300009174 | Bacteria | 2026 |
| 194 | Ga0105242_10020788 | 3300009176 | Bacteria | 5148 |
| 195 | Ga0105242_10021527 | 3300009176 | Bacteria | 5065 |
| 196 | Ga0105242_10151011 | 3300009176 | Bacteria | 2025 |
| 197 | Ga0105248_10067327 | 3300009177 | Bacteria | 4021 |
| 198 | Ga0105248_10376140 | 3300009177 | Bacteria | 1599 |
| 199 | Ga0105237_10001891 | 3300009545 | Bacteria | 26726 |
| 200 | Ga0105237_10002105 | 3300009545 | Bacteria | 25143 |
| 201 | Ga0105237_10024976 | 3300009545 | Bacteria | 6113 |
| 202 | Ga0105237_10033300 | 3300009545 | Bacteria | 5220 |
| 203 | Ga0105237_10105060 | 3300009545 | Bacteria | 2816 |
| 204 | Ga0105237_10143609 | 3300009545 | Bacteria | 2381 |
| 205 | Ga0105238_10000496 | 3300009551 | Bacteria | 41316 |
| 206 | Ga0105238_10002761 | 3300009551 | Bacteria | 17515 |
| 207 | Ga0105238_10190251 | 3300009551 | Bacteria | 2028 |
| 208 | Ga0105249_10003436 | 3300009553 | Bacteria | 13717 |
| 209 | Ga0105249_10004284 | 3300009553 | Bacteria | 12331 |
| 210 | Ga0105249_10035574 | 3300009553 | Bacteria | 4516 |
| 211 | Ga0105249_10038377 | 3300009553 | Bacteria | 4346 |
| 212 | Ga0105249_10047688 | 3300009553 | Bacteria | 3904 |
| 213 | Ga0105249_10176696 | 3300009553 | Bacteria | 2074 |
| 214 | Ga0105239_10000579 | 3300010375 | Bacteria | 52245 |
| 215 | Ga0105239_10185231 | 3300010375 | Bacteria | 2330 |
| 216 | Ga0105239_10468354 | 3300010375 | Bacteria | 1431 |
| 217 | Ga0105246_10015666 | 3300011119 | Bacteria | 4791 |
| 218 | Ga0157373_10001036 | 3300013100 | Bacteria | 21414 |
| 219 | Ga0157373_10003571 | 3300013100 | Bacteria | 11753 |
| 220 | Ga0157373_10139449 | 3300013100 | Bacteria | 1705 |
| 221 | Ga0157371_10000034 | 3300013102 | Bacteria | 223947 |
| 222 | Ga0157371_10003442 | 3300013102 | Bacteria | 14355 |
| 223 | Ga0157371_10005972 | 3300013102 | Bacteria | 10157 |
| 224 | Ga0157371_10013855 | 3300013102 | Bacteria | 6108 |
| 225 | Ga0157371_10038726 | 3300013102 | Bacteria | 3410 |
| 226 | Ga0157371_10038878 | 3300013102 | Bacteria | 3403 |
| 227 | Ga0157371_10109266 | 3300013102 | Bacteria | 1963 |
| 228 | Ga0157370_10000405 | 3300013104 | Bacteria | 54383 |
| 229 | Ga0157370_10000640 | 3300013104 | Bacteria | 43586 |
| 230 | Ga0157370_10000920 | 3300013104 | Bacteria | 37348 |
| 231 | Ga0157370_10002194 | 3300013104 | Bacteria | 23812 |
| 232 | Ga0157370_10002625 | 3300013104 | Bacteria | 21610 |
| 233 | Ga0157370_10002675 | 3300013104 | Bacteria | 21354 |
| 234 | Ga0157370_10003317 | 3300013104 | Bacteria | 18961 |
| 235 | Ga0157370_10004387 | 3300013104 | Bacteria | 16197 |
| 236 | Ga0157370_10004945 | 3300013104 | Bacteria | 15086 |
| 237 | Ga0157370_10007720 | 3300013104 | Bacteria | 11663 |
| 238 | Ga0157370_10008589 | 3300013104 | Bacteria | 10999 |
| 239 | Ga0157370_10024727 | 3300013104 | Bacteria | 5947 |
| 240 | Ga0157370_10027437 | 3300013104 | Bacteria | 5614 |
| 241 | Ga0157370_10070674 | 3300013104 | Bacteria | 3295 |
| 242 | Ga0157370_10097344 | 3300013104 | Bacteria | 2760 |
| 243 | Ga0157370_10348614 | 3300013104 | Bacteria | 1365 |
| 244 | Ga0157369_10000002 | 3300013105 | Bacteria | 524510 |
| 245 | Ga0157369_10002318 | 3300013105 | Bacteria | 22909 |
| 246 | Ga0157369_10027588 | 3300013105 | Bacteria | 6291 |
| 247 | Ga0157369_10192838 | 3300013105 | Bacteria | 2140 |
| 248 | Ga0157369_10193466 | 3300013105 | Bacteria | 2136 |
| 249 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 250 | Ga0157374_10043822 | 3300013296 | Bacteria | 4135 |
| 251 | Ga0157374_10163278 | 3300013296 | Bacteria | 2170 |
| 252 | Ga0157378_10002828 | 3300013297 | Bacteria | 15480 |
| 253 | Ga0157378_10058343 | 3300013297 | Bacteria | 3442 |
| 254 | Ga0157378_10067078 | 3300013297 | Bacteria | 3215 |
| 255 | Ga0157378_10076231 | 3300013297 | Bacteria | 3021 |
| 256 | Ga0157378_10299420 | 3300013297 | Bacteria | 1556 |
| 257 | Ga0163162_10000674 | 3300013306 | Bacteria | 31727 |
| 258 | Ga0163162_10001501 | 3300013306 | Bacteria | 21743 |
| 259 | Ga0163162_10003760 | 3300013306 | Bacteria | 14539 |
| 260 | Ga0163162_10005178 | 3300013306 | Bacteria | 12576 |
| 261 | Ga0163162_10005335 | 3300013306 | Bacteria | 12405 |
| 262 | Ga0163162_10019498 | 3300013306 | Bacteria | 6653 |
| 263 | Ga0163162_10024019 | 3300013306 | Bacteria | 6016 |
| 264 | Ga0163162_10062970 | 3300013306 | Bacteria | 3750 |
| 265 | Ga0163162_10277967 | 3300013306 | Bacteria | 1806 |
| 266 | Ga0157372_10000034 | 3300013307 | Bacteria | 174784 |
| 267 | Ga0157372_10001527 | 3300013307 | Bacteria | 25162 |
| 268 | Ga0157372_10003589 | 3300013307 | Bacteria | 16694 |
| 269 | Ga0157372_10009970 | 3300013307 | Bacteria | 10105 |
| 270 | Ga0157372_10012503 | 3300013307 | Bacteria | 9046 |
| 271 | Ga0157372_10072036 | 3300013307 | Bacteria | 3893 |
| 272 | Ga0157372_10095794 | 3300013307 | Bacteria | 3382 |
| 273 | Ga0157372_10104462 | 3300013307 | Bacteria | 3239 |
| 274 | Ga0157372_10112438 | 3300013307 | Bacteria | 3120 |
| 275 | Ga0157372_10410641 | 3300013307 | Bacteria | 1578 |
| 276 | Ga0157375_10004612 | 3300013308 | Bacteria | 11976 |
| 277 | Ga0157375_10019591 | 3300013308 | Bacteria | 6157 |
| 278 | Ga0157375_10025638 | 3300013308 | Bacteria | 5483 |
| 279 | Ga0157375_10035618 | 3300013308 | Bacteria | 4753 |
| 280 | Ga0157375_10225163 | 3300013308 | Bacteria | 2034 |
| 281 | Ga0163163_10003420 | 3300014325 | Bacteria | 13486 |
| 282 | Ga0163163_10173837 | 3300014325 | Bacteria | 2200 |
| 283 | Ga0157380_10284510 | 3300014326 | Bacteria | 1515 |
| 284 | Ga0182008_10000335 | 3300014497 | Bacteria | 36787 |
| 285 | Ga0182008_10000613 | 3300014497 | Bacteria | 26197 |
| 286 | Ga0182008_10016639 | 3300014497 | Bacteria | 3819 |
| 287 | Ga0182008_10050526 | 3300014497 | Bacteria | 2064 |
| 288 | Ga0157377_10036152 | 3300014745 | Bacteria | 2715 |
| 289 | Ga0157379_10000571 | 3300014968 | Bacteria | 29790 |
| 290 | Ga0157379_10023146 | 3300014968 | Bacteria | 5509 |
| 291 | Ga0157379_10042210 | 3300014968 | Bacteria | 4072 |
| 292 | Ga0157379_10070831 | 3300014968 | Bacteria | 3120 |
| 293 | Ga0157379_10176621 | 3300014968 | Bacteria | 1929 |
| 294 | Ga0157379_10218409 | 3300014968 | Bacteria | 1727 |
| 295 | Ga0157376_10002660 | 3300014969 | Bacteria | 12140 |
| 296 | Ga0157376_10018216 | 3300014969 | Bacteria | 5377 |
| 297 | Ga0157376_10040973 | 3300014969 | Bacteria | 3789 |
| 298 | Ga0157376_10088822 | 3300014969 | Bacteria | 2671 |
| 299 | Ga0182006_1000770 | 3300015261 | Bacteria | 21827 |
| 300 | Ga0182006_1001214 | 3300015261 | Bacteria | 16081 |
| 301 | Ga0182006_1001696 | 3300015261 | Bacteria | 12872 |
| 302 | Ga0182006_1002006 | 3300015261 | Bacteria | 11466 |
| 303 | Ga0182006_1005799 | 3300015261 | Bacteria | 5820 |
| 304 | Ga0182006_1007598 | 3300015261 | Bacteria | 4953 |
| 305 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 306 | Ga0182005_1000496 | 3300015265 | Bacteria | 20079 |
| 307 | Ga0183373_1003 | 3300015682 | Bacteria | 558813 |
| 308 | Ga0163161_10000023 | 3300017792 | Bacteria | 205048 |
| 309 | Ga0163161_10000108 | 3300017792 | Bacteria | 78805 |
| 310 | Ga0163161_10000913 | 3300017792 | Bacteria | 22828 |
| 311 | Ga0163161_10008720 | 3300017792 | Bacteria | 7013 |
| 312 | Ga0163161_10017167 | 3300017792 | Bacteria | 5062 |
| 313 | Ga0163161_10072957 | 3300017792 | Bacteria | 2514 |
| 314 | Ga0209436_104848 | 3300025208 | Bacteria | 3226 |
| 315 | Ga0209258_100041 | 3300025242 | Bacteria | 381381 |
| 316 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 317 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 318 | Ga0209026_1000233 | 3300025250 | Bacteria | 74825 |
| 319 | Ga0209148_1000090 | 3300025254 | Bacteria | 250982 |
| 320 | Ga0209129_1000048 | 3300025258 | Bacteria | 270192 |
| 321 | Ga0209673_1000034 | 3300025273 | Bacteria | 328788 |
| 322 | Ga0209130_1001027 | 3300025284 | Bacteria | 21399 |
| 323 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 324 | Ga0209676_1000201 | 3300025292 | Bacteria | 133195 |
| 325 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 326 | Ga0209564_1002475 | 3300025295 | Bacteria | 14476 |
| 327 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 328 | Ga0209758_1000419 | 3300025297 | Bacteria | 72133 |
| 329 | Ga0209758_1003298 | 3300025297 | Bacteria | 14943 |
| 330 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 331 | Ga0209050_1000114 | 3300025298 | Bacteria | 205865 |
| 332 | Ga0209050_1000203 | 3300025298 | Bacteria | 133156 |
| 333 | Ga0209050_1000353 | 3300025298 | Bacteria | 88509 |
| 334 | Ga0207426_1000177 | 3300025302 | Bacteria | 159426 |
| 335 | Ga0207426_1000324 | 3300025302 | Bacteria | 91661 |
| 336 | Ga0207426_1000592 | 3300025302 | Bacteria | 47901 |
| 337 | Ga0207426_1004355 | 3300025302 | Bacteria | 6956 |
| 338 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 339 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 340 | Ga0209257_1001792 | 3300025304 | Bacteria | 23622 |
| 341 | Ga0207655_1000266 | 3300025728 | Bacteria | 82011 |
| 342 | Ga0207710_10006649 | 3300025900 | Bacteria | 4928 |
| 343 | Ga0207710_10014277 | 3300025900 | Bacteria | 3347 |
| 344 | Ga0207680_10000117 | 3300025903 | Bacteria | 36819 |
| 345 | Ga0207680_10000801 | 3300025903 | Bacteria | 14781 |
| 346 | Ga0207647_10042596 | 3300025904 | Bacteria | 2847 |
| 347 | Ga0207645_10000292 | 3300025907 | Bacteria | 42021 |
| 348 | Ga0207645_10055288 | 3300025907 | Bacteria | 2534 |
| 349 | Ga0207643_10002074 | 3300025908 | Bacteria | 11036 |
| 350 | Ga0207643_10010554 | 3300025908 | Bacteria | 4973 |
| 351 | Ga0207705_10003352 | 3300025909 | Bacteria | 12176 |
| 352 | Ga0207705_10022080 | 3300025909 | Bacteria | 4540 |
| 353 | Ga0207705_10024142 | 3300025909 | Bacteria | 4339 |
| 354 | Ga0207654_10016425 | 3300025911 | Bacteria | 3855 |
| 355 | Ga0207654_10098384 | 3300025911 | Bacteria | 1797 |
| 356 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 357 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 358 | Ga0207695_10000229 | 3300025913 | Bacteria | 149313 |
| 359 | Ga0207695_10007801 | 3300025913 | Bacteria | 13546 |
| 360 | Ga0207695_10035045 | 3300025913 | Bacteria | 5448 |
| 361 | Ga0207671_10001845 | 3300025914 | Bacteria | 23653 |
| 362 | Ga0207671_10002829 | 3300025914 | Bacteria | 18049 |
| 363 | Ga0207671_10003885 | 3300025914 | Bacteria | 14585 |
| 364 | Ga0207671_10039435 | 3300025914 | Bacteria | 3497 |
| 365 | Ga0207671_10143904 | 3300025914 | Bacteria | 1838 |
| 366 | Ga0207662_10047702 | 3300025918 | Bacteria | 2537 |
| 367 | Ga0207657_10137438 | 3300025919 | Bacteria | 1999 |
| 368 | Ga0207657_10261809 | 3300025919 | Bacteria | 1376 |
| 369 | Ga0207649_10089604 | 3300025920 | Bacteria | 2011 |
| 370 | Ga0207652_10001773 | 3300025921 | Bacteria | 18792 |
| 371 | Ga0207681_10030545 | 3300025923 | Bacteria | 3513 |
| 372 | Ga0207681_10040645 | 3300025923 | Bacteria | 3096 |
| 373 | Ga0207681_10160689 | 3300025923 | Bacteria | 1693 |
| 374 | Ga0207694_10010106 | 3300025924 | Bacteria | 7112 |
| 375 | Ga0207650_10001164 | 3300025925 | Bacteria | 19325 |
| 376 | Ga0207650_10046465 | 3300025925 | Bacteria | 3197 |
| 377 | Ga0207650_10124656 | 3300025925 | Bacteria | 2010 |
| 378 | Ga0207690_10099092 | 3300025932 | Bacteria | 2077 |
| 379 | Ga0207706_10013982 | 3300025933 | Bacteria | 7278 |
| 380 | Ga0207706_10033675 | 3300025933 | Bacteria | 4559 |
| 381 | Ga0207686_10045778 | 3300025934 | Bacteria | 2694 |
| 382 | Ga0207709_10000034 | 3300025935 | Bacteria | 313184 |
| 383 | Ga0207669_10018300 | 3300025937 | Bacteria | 3618 |
| 384 | Ga0207704_10003386 | 3300025938 | Bacteria | 7241 |
| 385 | Ga0207704_10072670 | 3300025938 | Bacteria | 2187 |
| 386 | Ga0207691_10038187 | 3300025940 | Bacteria | 4442 |
| 387 | Ga0207691_10054945 | 3300025940 | Bacteria | 3631 |
| 388 | Ga0207691_10235387 | 3300025940 | Bacteria | 1585 |
| 389 | Ga0207691_10262245 | 3300025940 | Unclassified | 1489 |
| 390 | Ga0207689_10000260 | 3300025942 | Bacteria | 47416 |
| 391 | Ga0207689_10000722 | 3300025942 | Bacteria | 31657 |
| 392 | Ga0207689_10063560 | 3300025942 | Bacteria | 3036 |
| 393 | Ga0207689_10141868 | 3300025942 | Bacteria | 1979 |
| 394 | Ga0207661_10009921 | 3300025944 | Bacteria | 6839 |
| 395 | Ga0207661_10034262 | 3300025944 | Bacteria | 3947 |
| 396 | Ga0207667_10001623 | 3300025949 | Bacteria | 28293 |
| 397 | Ga0207667_10010568 | 3300025949 | Bacteria | 10783 |
| 398 | Ga0207667_10015148 | 3300025949 | Bacteria | 8768 |
| 399 | Ga0207667_10123376 | 3300025949 | Bacteria | 2669 |
| 400 | Ga0207667_10274998 | 3300025949 | Bacteria | 1722 |
| 401 | Ga0207651_10000857 | 3300025960 | Bacteria | 13286 |
| 402 | Ga0207651_10018119 | 3300025960 | Bacteria | 4182 |
| 403 | Ga0207651_10039267 | 3300025960 | Unclassified | 3120 |
| 404 | Ga0207651_10062849 | 3300025960 | Bacteria | 2590 |
| 405 | Ga0207651_10152072 | 3300025960 | Bacteria | 1803 |
| 406 | Ga0207712_10011421 | 3300025961 | Bacteria | 5659 |
| 407 | Ga0207712_10090317 | 3300025961 | Bacteria | 2254 |
| 408 | Ga0207668_10001121 | 3300025972 | Bacteria | 15969 |
| 409 | Ga0207668_10046723 | 3300025972 | Bacteria | 2960 |
| 410 | Ga0207640_10014455 | 3300025981 | Bacteria | 4546 |
| 411 | Ga0207658_10001753 | 3300025986 | Bacteria | 16330 |
| 412 | Ga0207658_10001959 | 3300025986 | Bacteria | 15364 |
| 413 | Ga0207658_10006893 | 3300025986 | Bacteria | 7735 |
| 414 | Ga0207658_10027157 | 3300025986 | Bacteria | 4020 |
| 415 | Ga0207658_10042904 | 3300025986 | Bacteria | 3285 |
| 416 | Ga0207677_10001454 | 3300026023 | Bacteria | 12547 |
| 417 | Ga0207677_10042300 | 3300026023 | Bacteria | 3020 |
| 418 | Ga0207677_10052126 | 3300026023 | Bacteria | 2778 |
| 419 | Ga0207703_10004860 | 3300026035 | Bacteria | 10936 |
| 420 | Ga0207703_10010647 | 3300026035 | Bacteria | 7184 |
| 421 | Ga0207639_10002058 | 3300026041 | Bacteria | 13565 |
| 422 | Ga0207639_10029547 | 3300026041 | Bacteria | 4014 |
| 423 | Ga0207639_10081046 | 3300026041 | Bacteria | 2569 |
| 424 | Ga0207678_10295569 | 3300026067 | Bacteria | 1391 |
| 425 | Ga0207702_10169950 | 3300026078 | Bacteria | 1998 |
| 426 | Ga0207702_10262508 | 3300026078 | Bacteria | 1627 |
| 427 | Ga0207641_10000061 | 3300026088 | Bacteria | 160161 |
| 428 | Ga0207641_10038139 | 3300026088 | Bacteria | 4016 |
| 429 | Ga0207641_10054861 | 3300026088 | Bacteria | 3384 |
| 430 | Ga0207641_10065798 | 3300026088 | Bacteria | 3101 |
| 431 | Ga0207648_10000498 | 3300026089 | Bacteria | 43756 |
| 432 | Ga0207648_10013882 | 3300026089 | Bacteria | 7470 |
| 433 | Ga0207648_10050290 | 3300026089 | Bacteria | 3645 |
| 434 | Ga0207648_10156527 | 3300026089 | Unclassified | 2011 |
| 435 | Ga0207676_10030694 | 3300026095 | Bacteria | 4036 |
| 436 | Ga0207674_10003174 | 3300026116 | Bacteria | 20238 |
| 437 | Ga0207674_10033080 | 3300026116 | Bacteria | 5415 |
| 438 | Ga0207674_10093368 | 3300026116 | Bacteria | 2997 |
| 439 | Ga0207674_10267925 | 3300026116 | Bacteria | 1655 |
| 440 | Ga0207674_10293142 | 3300026116 | Bacteria | 1575 |
| 441 | Ga0207675_100005957 | 3300026118 | Bacteria | 11618 |
| 442 | Ga0207675_100018811 | 3300026118 | Bacteria | 6446 |
| 443 | Ga0207675_100061516 | 3300026118 | Bacteria | 3505 |
| 444 | Ga0207675_100090022 | 3300026118 | Bacteria | 2885 |
| 445 | Ga0207675_100125072 | 3300026118 | Unclassified | 2435 |
| 446 | Ga0207683_10000585 | 3300026121 | Bacteria | 33627 |
| 447 | Ga0207698_10008091 | 3300026142 | Bacteria | 6629 |
| 448 | Ga0207698_10031882 | 3300026142 | Bacteria | 3810 |
| 449 | Ga0207698_10037794 | 3300026142 | Bacteria | 3560 |
| 450 | Ga0207698_10168944 | 3300026142 | Bacteria | 1923 |
| 451 | Ga0207698_10328129 | 3300026142 | Bacteria | 1436 |
| 452 | Ga0209281_1000037 | 3300027111 | Bacteria | 368555 |
| 453 | Ga0209282_1006995 | 3300027666 | Bacteria | 7045 |
| 454 | Ga0268266_10003239 | 3300028379 | Bacteria | 16440 |
| 455 | Ga0268264_10001938 | 3300028381 | Bacteria | 18618 |
| 456 | Ga0268264_10002707 | 3300028381 | Bacteria | 15465 |
| 457 | Ga0268264_10004286 | 3300028381 | Bacteria | 12177 |
| 458 | Ga0268264_10020316 | 3300028381 | Bacteria | 5428 |
| 459 | Ga0268264_10072295 | 3300028381 | Bacteria | 2925 |
| 460 | Ga0307515_10000780 | 3300028794 | Bacteria | 73338 |
| 461 | Ga0307515_10270711 | 3300028794 | Bacteria | 1420 |
| 462 | Ga0307511_10004383 | 3300030521 | Bacteria | 14404 |
| 463 | Ga0316177_1078287 | 3300030731 | Bacteria | 10626 |
| 464 | Ga0316176_1082807 | 3300030732 | Bacteria | 20683 |
| 465 | Ga0316183_1015945 | 3300030742 | Bacteria | 25321 |
| 466 | Ga0316181_1158450 | 3300030744 | Bacteria | 6710 |
| 467 | Ga0307513_10052042 | 3300031456 | Bacteria | 4412 |
| 468 | Ga0307408_100000523 | 3300031548 | Bacteria | 33139 |
| 469 | Ga0307408_100001044 | 3300031548 | Bacteria | 21263 |
| 470 | Ga0307408_100001050 | 3300031548 | Bacteria | 21208 |
| 471 | Ga0307408_100002795 | 3300031548 | Bacteria | 12115 |
| 472 | Ga0307408_100002864 | 3300031548 | Bacteria | 11955 |
| 473 | Ga0307408_100044263 | 3300031548 | Bacteria | 3171 |
| 474 | Ga0307516_10000577 | 3300031730 | Bacteria | 49482 |
| 475 | Ga0307405_10000031 | 3300031731 | Bacteria | 99176 |
| 476 | Ga0307413_10000608 | 3300031824 | Bacteria | 12015 |
| 477 | Ga0307410_10000029 | 3300031852 | Bacteria | 50877 |
| 478 | Ga0307406_10000012 | 3300031901 | Bacteria | 111189 |
| 479 | Ga0307407_10000065 | 3300031903 | Bacteria | 41572 |
| 480 | Ga0307407_10001039 | 3300031903 | Bacteria | 9600 |
| 481 | Ga0307412_10001866 | 3300031911 | Bacteria | 11653 |
| 482 | Ga0307412_10002513 | 3300031911 | Bacteria | 10198 |
| 483 | Ga0307416_100000146 | 3300032002 | Bacteria | 41573 |
| 484 | Ga0307416_100146571 | 3300032002 | Bacteria | 2156 |
| 485 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 486 | Ga0307414_10001598 | 3300032004 | Bacteria | 11764 |
| 487 | Ga0307414_10011142 | 3300032004 | Bacteria | 5259 |
| 488 | Ga0307414_10013353 | 3300032004 | Bacteria | 4887 |
| 489 | Ga0307414_10071924 | 3300032004 | Bacteria | 2497 |
| 490 | Ga0307411_10000011 | 3300032005 | Bacteria | 204666 |
| 491 | Ga0307510_10022799 | 3300033180 | Bacteria | 7263 |
| 492 | Ga0373937_0035884 | 3300036401 | Bacteria | 4516 |
| 493 | Ga0395905_0006439 | 3300037471 | Bacteria | 11821 |
| 494 | Ga0395905_0022329 | 3300037471 | Bacteria | 5986 |
| 495 | Ga0395905_0180329 | 3300037471 | Bacteria | 1983 |
| 496 | Ga0395905_0186061 | 3300037471 | Bacteria | 1949 |
| 497 | Ga0395901_0416372 | 3300038443 | Bacteria | 1378 |
| 498 | Ga0436365_0920295 | 3300039437 | Bacteria | 45426 |
| 499 | Ga0439439_0017086 | 3300041406 | Bacteria | 1781 |
| 500 | Ga0439447_003485 | 3300041407 | Bacteria | 5589 |
| 501 | Ga0439431_0000737 | 3300041997 | Bacteria | 7068 |
| 502 | Ga0439431_0018540 | 3300041997 | Bacteria | 1647 |
| 503 | Ga0439445_0010751 | 3300042004 | Bacteria | 2172 |
| 504 | Ga0450899_003127 | 3300042135 | Bacteria | 1784 |
| 505 | Ga0439434_0002205 | 3300042435 | Bacteria | 5656 |
| 506 | Ga0451577_0016763 | 3300042876 | Bacteria | 6775 |
| 507 | Ga0451577_0056653 | 3300042876 | Bacteria | 3496 |
| 508 | Ga0466972_0003358 | 3300044658 | Bacteria | 7933 |
| 509 | Ga0466982_0101498 | 3300044672 | Bacteria | 1782 |
| 510 | Ga0466965_0021300 | 3300044683 | Bacteria | 3119 |
| 511 | Ga0466961_0009882 | 3300044693 | Bacteria | 6078 |
| 512 | Ga0453684_0001775 | 3300044712 | Bacteria | 57622 |
| 513 | Ga0453684_0028647 | 3300044712 | Bacteria | 7938 |
| 514 | Ga0466968_0003823 | 3300044735 | Bacteria | 5585 |
| 515 | Ga0466970_0009210 | 3300044765 | Bacteria | 4982 |
| 516 | Ga0466959_0005372 | 3300045049 | Bacteria | 8772 |
| 517 | Ga0466959_0062939 | 3300045049 | Bacteria | 2695 |
| 518 | Ga0451576_0003626 | 3300045051 | Bacteria | 20977 |
| 519 | Ga0451576_0006920 | 3300045051 | Bacteria | 13733 |
| 520 | Ga0466958_0008462 | 3300045836 | Bacteria | 5710 |
| 521 | Ga0466967_0130616 | 3300045976 | Unclassified | 2331 |
| 522 | Ga0495627_004222 | 3300046453 | Bacteria | 6075 |
| 523 | Ga0495585_0000132 | 3300046492 | Bacteria | 80905 |
| 524 | Ga0495610_0000064 | 3300046512 | Bacteria | 125922 |
| 525 | Ga0495610_0001020 | 3300046512 | Bacteria | 25786 |
| 526 | Ga0495610_0002154 | 3300046512 | Bacteria | 16751 |
| 527 | Ga0495610_0005260 | 3300046512 | Bacteria | 9261 |
| 528 | Ga0495637_0063719 | 3300046520 | Bacteria | 1506 |
| 529 | Ga0495648_0007897 | 3300046524 | Bacteria | 8450 |
| 530 | Ga0495633_0000175 | 3300046558 | Bacteria | 83653 |
| 531 | Ga0495633_0000223 | 3300046558 | Bacteria | 70403 |
| 532 | Ga0495633_0013201 | 3300046558 | Bacteria | 4362 |
| 533 | Ga0495668_0000191 | 3300046616 | Bacteria | 90923 |
| 534 | Ga0495672_0015522 | 3300047320 | Bacteria | 5166 |
| 535 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 536 | Ga0495687_001120 | 3300047443 | Bacteria | 26041 |
| 537 | Ga0495686_0004164 | 3300047472 | Bacteria | 12029 |
| 538 | Ga0495686_0027606 | 3300047472 | Bacteria | 3705 |
| 539 | Ga0496104_0317270 | 3300048907 | Bacteria | 1472 |
| 540 | Ga0496116_0000073 | 3300048919 | Bacteria | 237590 |
| 541 | Ga0496116_0002724 | 3300048919 | Bacteria | 18172 |
| 542 | Ga0496117_0014391 | 3300048920 | Bacteria | 6819 |
| 543 | Ga0496118_0138050 | 3300048921 | Bacteria | 1552 |
| 544 | Ga0496121_0019075 | 3300048924 | Bacteria | 6880 |
| 545 | Ga0496121_0093379 | 3300048924 | Bacteria | 2343 |
| 546 | Ga0496122_0000276 | 3300048925 | Bacteria | 114526 |
| 547 | Ga0496122_0000765 | 3300048925 | Bacteria | 62189 |
| 548 | Ga0496122_0010272 | 3300048925 | Bacteria | 9687 |
| 549 | Ga0496123_0005845 | 3300048926 | Bacteria | 12189 |
| 550 | Ga0496123_0007990 | 3300048926 | Bacteria | 9802 |
| 551 | Ga0496123_0028896 | 3300048926 | Bacteria | 4094 |
| 552 | Ga0496124_0173106 | 3300048927 | Bacteria | 1669 |
| 553 | Ga0496125_0000253 | 3300048928 | Bacteria | 109929 |
| 554 | Ga0496125_0000899 | 3300048928 | Bacteria | 47036 |
| 555 | Ga0496125_0015898 | 3300048928 | Bacteria | 7249 |
| 556 | Ga0496126_0003326 | 3300048929 | Bacteria | 20452 |
| 557 | Ga0496126_0070976 | 3300048929 | Bacteria | 3101 |
| 558 | Ga0501034_0009656 | 3300049571 | Bacteria | 10090 |
| 559 | Ga0501034_0037269 | 3300049571 | Bacteria | 4923 |
| 560 | Ga0501047_0126110 | 3300049581 | Bacteria | 2440 |
| 561 | Ga0501236_001008 | 3300049670 | Bacteria | 3195 |
| 562 | Ga0501238_000180 | 3300049671 | Bacteria | 9426 |
| 563 | Ga0501249_000005 | 3300049679 | Bacteria | 225972 |
| 564 | Ga0501257_000372 | 3300049686 | Bacteria | 8734 |
| 565 | Ga0501219_000576 | 3300049703 | Bacteria | 5370 |
| 566 | Ga0501241_000121 | 3300049758 | Bacteria | 16940 |
| 567 | Ga0501266_000006 | 3300049763 | Bacteria | 312183 |
| 568 | Ga0501280_007638 | 3300049776 | Bacteria | 1510 |
| 569 | Ga0501044_0011376 | 3300049823 | Bacteria | 9637 |
| 570 | Ga0501044_0124502 | 3300049823 | Bacteria | 2576 |
| 571 | Ga0501044_0201670 | 3300049823 | Bacteria | 1947 |
| 572 | Ga0501284_00011 | 3300050005 | Bacteria | 131008 |
| 573 | nmdc:mga0k408_73788_c2 | 3300050493 | Bacteria | 1559 |
| 574 | nmdc:mga05p37_3494_c1 | 3300050507 | Bacteria | 18375 |
| 575 | nmdc:mga09592_198153_c1 | 3300050508 | Bacteria | 1739 |
| 576 | Ga0500644_0000182 | 3300053088 | Bacteria | 40141 |
| 577 | Ga0500646_0008069 | 3300053090 | Bacteria | 2692 |
| 578 | Ga0500583_0007260 | 3300053092 | Bacteria | 3885 |
| 579 | Ga0500641_0000003 | 3300053096 | Bacteria | 284831 |
| 580 | Ga0500641_0000117 | 3300053096 | Bacteria | 30553 |
| 581 | Ga0500562_000111 | 3300053108 | Bacteria | 28772 |
| 582 | Ga0500607_072770 | 3300053121 | Bacteria | 1771 |
| 583 | Ga0500618_017274 | 3300053125 | Bacteria | 1796 |
| 584 | Ga0500658_0000007 | 3300053134 | Bacteria | 284115 |
| 585 | Ga0500559_0016298 | 3300053136 | Bacteria | 3137 |
| 586 | Ga0500568_0016532 | 3300053139 | Bacteria | 3277 |
| 587 | Ga0500577_0005308 | 3300053142 | Bacteria | 3463 |
| 588 | Ga0500604_0006093 | 3300053151 | Bacteria | 3183 |
| 589 | Ga0500604_0024678 | 3300053151 | Bacteria | 1723 |
| 590 | Ga0500622_0000026 | 3300053156 | Bacteria | 235660 |
| 591 | Ga0500622_0000365 | 3300053156 | Bacteria | 43555 |
| 592 | Ga0500622_0001039 | 3300053156 | Bacteria | 23193 |
| 593 | Ga0500622_0021016 | 3300053156 | Bacteria | 3464 |
| 594 | Ga0501084_0012175 | 3300054114 | Bacteria | 7120 |
| 595 | Ga0500661_010844 | 3300055283 | Bacteria | 1656 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10070831 | Ga0157379_100708311 | 278 |
| 2 | 3300048925 | Ga0496122_0000276 | Ga0496122_0000276_4807_5883 | 300 |
| 3 | 3300048926 | Ga0496123_0007990 | Ga0496123_0007990_6681_7757 | 300 |
| 4 | 3300048928 | Ga0496125_0000899 | Ga0496125_0000899_42005_43075 | 300 |
| 5 | 3300048928 | Ga0496125_0015898 | Ga0496125_0015898_3881_4951 | 300 |
| 6 | 3300048929 | Ga0496126_0003326 | Ga0496126_0003326_3584_4660 | 300 |
| 7 | 3300037471 | Ga0395905_0186061 | Ga0395905_0186061_842_1936 | 317 |
| 8 | 3300045051 | Ga0451576_0003626 | Ga0451576_0003626_19877_20965 | 317 |
| 9 | 3300005718 | Ga0068866_10067325 | Ga0068866_100673252 | 326 |
| 10 | 3300009553 | Ga0105249_10035574 | Ga0105249_100355742 | 328 |
| 11 | 3300026118 | Ga0207675_100125072 | Ga0207675_1001250722 | 328 |
| 12 | 3300013306 | Ga0163162_10005178 | Ga0163162_1000517811 | 329 |
| 13 | 3300005288 | Ga0065714_10076716 | Ga0065714_100767161 | 330 |
| 14 | 3300049763 | Ga0501266_000006 | Ga0501266_000006_52036_53214 | 331 |
| 15 | 3300025728 | Ga0207655_1000266 | Ga0207655_100026632 | 334 |
| 16 | 3300005577 | Ga0068857_100082991 | Ga0068857_1000829912 | 335 |
| 17 | 3300013308 | Ga0157375_10225163 | Ga0157375_102251632 | 335 |
| 18 | 3300025923 | Ga0207681_10160689 | Ga0207681_101606891 | 335 |
| 19 | 3300025938 | Ga0207704_10072670 | Ga0207704_100726702 | 335 |
| 20 | 3300026078 | Ga0207702_10262508 | Ga0207702_102625082 | 335 |
| 21 | 3300026116 | Ga0207674_10093368 | Ga0207674_100933682 | 335 |
| 22 | iso_pu_bacteria | 2643221600 | 2644010274 | 335 |
| 23 | iso_pu_bacteria | 2643221667 | 2644370750 | 335 |
| 24 | iso_pu_bacteria | 2643221725 | 2644686100 | 335 |
| 25 | iso_pu_bacteria | 2738541279 | 2738734321 | 335 |
| 26 | iso_pu_bacteria | 2738541285 | 2738767079 | 335 |
| 27 | iso_pu_bacteria | 2738543007 | 2739215902 | 335 |
| 28 | iso_pu_bacteria | 2739367857 | 2740001488 | 335 |
| 29 | iso_pu_bacteria | 2739367858 | 2740006304 | 335 |
| 30 | iso_pu_bacteria | 2816332280 | 2817415088 | 335 |
| 31 | 3300005337 | Ga0070682_100016548 | Ga0070682_1000165482 | 336 |
| 32 | 3300009036 | Ga0105244_10000120 | Ga0105244_1000012014 | 336 |
| 33 | 3300013102 | Ga0157371_10003442 | Ga0157371_100034428 | 336 |
| 34 | 3300013104 | Ga0157370_10070674 | Ga0157370_100706742 | 336 |
| 35 | 3300013105 | Ga0157369_10027588 | Ga0157369_100275885 | 336 |
| 36 | 3300048919 | Ga0496116_0000073 | Ga0496116_0000073_19168_20340 | 336 |
| 37 | 3300048921 | Ga0496118_0138050 | Ga0496118_0138050_216_1388 | 336 |
| 38 | 3300048924 | Ga0496121_0019075 | Ga0496121_0019075_39_1211 | 336 |
| 39 | 3300048924 | Ga0496121_0093379 | Ga0496121_0093379_721_1893 | 336 |
| 40 | 3300048927 | Ga0496124_0173106 | Ga0496124_0173106_289_1461 | 336 |
| 41 | 3300048928 | Ga0496125_0000253 | Ga0496125_0000253_19242_20414 | 336 |
| 42 | 3300048929 | Ga0496126_0070976 | Ga0496126_0070976_499_1671 | 336 |
| 43 | 3300005335 | Ga0070666_10005234 | Ga0070666_100052344 | 337 |
| 44 | 3300005338 | Ga0068868_100031804 | Ga0068868_1000318043 | 337 |
| 45 | 3300005356 | Ga0070674_100042044 | Ga0070674_1000420442 | 337 |
| 46 | 3300005364 | Ga0070673_100050103 | Ga0070673_1000501032 | 337 |
| 47 | 3300005367 | Ga0070667_100106094 | Ga0070667_1001060943 | 337 |
| 48 | 3300005456 | Ga0070678_100003233 | Ga0070678_1000032334 | 337 |
| 49 | 3300005459 | Ga0068867_100159772 | Ga0068867_1001597722 | 337 |
| 50 | 3300005578 | Ga0068854_100117892 | Ga0068854_1001178922 | 337 |
| 51 | 3300005617 | Ga0068859_100190057 | Ga0068859_1001900571 | 337 |
| 52 | 3300005719 | Ga0068861_100050923 | Ga0068861_1000509232 | 337 |
| 53 | 3300006237 | Ga0097621_100014395 | Ga0097621_1000143952 | 337 |
| 54 | 3300006358 | Ga0068871_100156621 | Ga0068871_1001566212 | 337 |
| 55 | 3300006881 | Ga0068865_100218210 | Ga0068865_1002182102 | 337 |
| 56 | 3300006931 | Ga0097620_100190063 | Ga0097620_1001900631 | 337 |
| 57 | 3300009174 | Ga0105241_10090605 | Ga0105241_100906052 | 337 |
| 58 | 3300009176 | Ga0105242_10151011 | Ga0105242_101510111 | 337 |
| 59 | 3300013297 | Ga0157378_10067078 | Ga0157378_100670782 | 337 |
| 60 | 3300017792 | Ga0163161_10000023 | Ga0163161_10000023101 | 337 |
| 61 | 3300025907 | Ga0207645_10000292 | Ga0207645_1000029214 | 337 |
| 62 | 3300025908 | Ga0207643_10002074 | Ga0207643_100020746 | 337 |
| 63 | 3300025937 | Ga0207669_10018300 | Ga0207669_100183002 | 337 |
| 64 | 3300025940 | Ga0207691_10038187 | Ga0207691_100381873 | 337 |
| 65 | 3300025942 | Ga0207689_10000722 | Ga0207689_100007229 | 337 |
| 66 | 3300025960 | Ga0207651_10018119 | Ga0207651_100181191 | 337 |
| 67 | 3300025986 | Ga0207658_10042904 | Ga0207658_100429042 | 337 |
| 68 | 3300026089 | Ga0207648_10000498 | Ga0207648_1000049817 | 337 |
| 69 | 3300026118 | Ga0207675_100018811 | Ga0207675_1000188114 | 337 |
| 70 | 3300026121 | Ga0207683_10000585 | Ga0207683_1000058516 | 337 |
| 71 | 3300028381 | Ga0268264_10020316 | Ga0268264_100203164 | 337 |
| 72 | 3300031548 | Ga0307408_100001050 | Ga0307408_10000105013 | 337 |
| 73 | 3300031911 | Ga0307412_10001866 | Ga0307412_100018663 | 337 |
| 74 | 3300005288 | Ga0065714_10094227 | Ga0065714_100942271 | 338 |
| 75 | 3300013306 | Ga0163162_10062970 | Ga0163162_100629704 | 338 |
| 76 | 3300013308 | Ga0157375_10019591 | Ga0157375_100195914 | 338 |
| 77 | 3300014968 | Ga0157379_10218409 | Ga0157379_102184092 | 338 |
| 78 | 3300015261 | Ga0182006_1001214 | Ga0182006_10012146 | 338 |
| 79 | 3300031852 | Ga0307410_10000029 | Ga0307410_1000002917 | 338 |
| 80 | 3300048907 | Ga0496104_0317270 | Ga0496104_0317270_33_1175 | 338 |
| 81 | 3300003316 | rootH1_10035249 | rootH1_1003524915 | 339 |
| 82 | 3300003316 | rootH1_10132184 | rootH1_101321843 | 339 |
| 83 | 3300003322 | rootL2_10002510 | rootL2_100025103 | 339 |
| 84 | 3300003323 | rootH1_10039506 | rootH1_100395067 | 339 |
| 85 | 3300005328 | Ga0070676_10206653 | Ga0070676_102066531 | 339 |
| 86 | 3300005329 | Ga0070683_100000416 | Ga0070683_1000004162 | 339 |
| 87 | 3300005331 | Ga0070670_100100218 | Ga0070670_1001002182 | 339 |
| 88 | 3300005334 | Ga0068869_100245983 | Ga0068869_1002459831 | 339 |
| 89 | 3300005344 | Ga0070661_100052272 | Ga0070661_1000522722 | 339 |
| 90 | 3300005355 | Ga0070671_100002219 | Ga0070671_1000022198 | 339 |
| 91 | 3300005459 | Ga0068867_100074820 | Ga0068867_1000748201 | 339 |
| 92 | 3300005535 | Ga0070684_100019166 | Ga0070684_1000191662 | 339 |
| 93 | 3300005563 | Ga0068855_100006106 | Ga0068855_1000061067 | 339 |
| 94 | 3300005564 | Ga0070664_100128937 | Ga0070664_1001289372 | 339 |
| 95 | 3300005564 | Ga0070664_100308898 | Ga0070664_1003088981 | 339 |
| 96 | 3300005577 | Ga0068857_100027897 | Ga0068857_1000278972 | 339 |
| 97 | 3300005578 | Ga0068854_100055961 | Ga0068854_1000559612 | 339 |
| 98 | 3300005617 | Ga0068859_100025448 | Ga0068859_1000254483 | 339 |
| 99 | 3300005841 | Ga0068863_100248112 | Ga0068863_1002481122 | 339 |
| 100 | 3300005843 | Ga0068860_100002118 | Ga0068860_10000211810 | 339 |
| 101 | 3300006237 | Ga0097621_100003220 | Ga0097621_1000032202 | 339 |
| 102 | 3300006358 | Ga0068871_100233535 | Ga0068871_1002335351 | 339 |
| 103 | 3300006931 | Ga0097620_100025449 | Ga0097620_1000254494 | 339 |
| 104 | 3300009545 | Ga0105237_10143609 | Ga0105237_101436092 | 339 |
| 105 | 3300013104 | Ga0157370_10008589 | Ga0157370_100085896 | 339 |
| 106 | 3300013296 | Ga0157374_10163278 | Ga0157374_101632782 | 339 |
| 107 | 3300013297 | Ga0157378_10002828 | Ga0157378_1000282811 | 339 |
| 108 | 3300013297 | Ga0157378_10002828 | Ga0157378_1000282812 | 339 |
| 109 | 3300025904 | Ga0207647_10042596 | Ga0207647_100425962 | 339 |
| 110 | 3300025907 | Ga0207645_10055288 | Ga0207645_100552881 | 339 |
| 111 | 3300025909 | Ga0207705_10024142 | Ga0207705_100241423 | 339 |
| 112 | 3300025914 | Ga0207671_10143904 | Ga0207671_101439041 | 339 |
| 113 | 3300025919 | Ga0207657_10137438 | Ga0207657_101374382 | 339 |
| 114 | 3300025925 | Ga0207650_10046465 | Ga0207650_100464652 | 339 |
| 115 | 3300025934 | Ga0207686_10045778 | Ga0207686_100457782 | 339 |
| 116 | 3300025944 | Ga0207661_10034262 | Ga0207661_100342622 | 339 |
| 117 | 3300025986 | Ga0207658_10001959 | Ga0207658_100019599 | 339 |
| 118 | 3300025986 | Ga0207658_10006893 | Ga0207658_100068934 | 339 |
| 119 | 3300026088 | Ga0207641_10054861 | Ga0207641_100548612 | 339 |
| 120 | 3300026089 | Ga0207648_10013882 | Ga0207648_100138825 | 339 |
| 121 | 3300026116 | Ga0207674_10293142 | Ga0207674_102931421 | 339 |
| 122 | 3300026118 | Ga0207675_100061516 | Ga0207675_1000615161 | 339 |
| 123 | 3300026142 | Ga0207698_10008091 | Ga0207698_100080914 | 339 |
| 124 | 3300028381 | Ga0268264_10001938 | Ga0268264_1000193811 | 339 |
| 125 | 3300028794 | Ga0307515_10000780 | Ga0307515_1000078021 | 339 |
| 126 | 3300042876 | Ga0451577_0056653 | Ga0451577_0056653_2082_3230 | 339 |
| 127 | 3300044712 | Ga0453684_0028647 | Ga0453684_0028647_4767_5915 | 339 |
| 128 | 3300049823 | Ga0501044_0201670 | Ga0501044_0201670_108_1253 | 339 |
| 129 | 3300053096 | Ga0500641_0000003 | Ga0500641_0000003_18461_19675 | 339 |
| 130 | 3300003320 | rootH2_10022625 | rootH2_100226257 | 340 |
| 131 | 3300013306 | Ga0163162_10277967 | Ga0163162_102779672 | 340 |
| 132 | 3300031548 | Ga0307408_100002795 | Ga0307408_1000027956 | 340 |
| 133 | 3300031824 | Ga0307413_10000608 | Ga0307413_100006087 | 340 |
| 134 | 3300031901 | Ga0307406_10000012 | Ga0307406_1000001266 | 340 |
| 135 | 3300031903 | Ga0307407_10001039 | Ga0307407_100010398 | 340 |
| 136 | 3300032004 | Ga0307414_10000001 | Ga0307414_1000000123 | 340 |
| 137 | 3300032005 | Ga0307411_10000011 | Ga0307411_1000001151 | 340 |
| 138 | 3300041407 | Ga0439447_003485 | Ga0439447_003485_4246_5424 | 340 |
| 139 | 3300049671 | Ga0501238_000180 | Ga0501238_000180_2421_3602 | 340 |
| 140 | 3300049776 | Ga0501280_007638 | Ga0501280_007638_95_1273 | 340 |
| 141 | 3300053134 | Ga0500658_0000007 | Ga0500658_0000007_247374_248552 | 340 |
| 142 | iso_pu_bacteria | 2929921140 | 2929922873 | 340 |
| 143 | iso_pu_bacteria | 8003151029 | 8003154699 | 340 |
| 144 | 3300001979 | JGI24740J21852_10003264 | JGI24740J21852_100032643 | 341 |
| 145 | 3300002738 | JGI25154J39366_1000001 | JGI25154J39366_1000001156 | 341 |
| 146 | 3300003215 | JGI25153J46596_10000209 | JGI25153J46596_1000020938 | 341 |
| 147 | 3300003354 | JGI25160J50197_1006440 | JGI25160J50197_10064404 | 341 |
| 148 | 3300009174 | Ga0105241_10131627 | Ga0105241_101316272 | 341 |
| 149 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002156 | 341 |
| 150 | 3300025250 | Ga0209026_1000233 | Ga0209026_100023324 | 341 |
| 151 | 3300025297 | Ga0209758_1000419 | Ga0209758_100041955 | 341 |
| 152 | 3300025302 | Ga0207426_1000324 | Ga0207426_10003245 | 341 |
| 153 | 3300049581 | Ga0501047_0126110 | Ga0501047_0126110_800_1960 | 341 |
| 154 | 3300049823 | Ga0501044_0124502 | Ga0501044_0124502_52_1212 | 341 |
| 155 | iso_pu_bacteria | 2721755487 | 2722727324 | 341 |
| 156 | iso_pu_bacteria | 2738541302 | 2738855339 | 341 |
| 157 | iso_pu_bacteria | 2818991460 | 2819679666 | 341 |
| 158 | iso_pu_bacteria | 2883068021 | 2883070864 | 341 |
| 159 | iso_pu_bacteria | 2898713307 | 2898713358 | 341 |
| 160 | iso_pu_bacteria | 2904445276 | 2904446950 | 341 |
| 161 | iso_pu_bacteria | 2904780799 | 2904784238 | 341 |
| 162 | iso_pu_bacteria | 2919177583 | 2919180206 | 341 |
| 163 | iso_pu_bacteria | 2945997725 | 2945999721 | 341 |
| 164 | iso_pu_bacteria | 2977232053 | 2977235547 | 341 |
| 165 | 3300010375 | Ga0105239_10000579 | Ga0105239_1000057922 | 342 |
| 166 | 3300013307 | Ga0157372_10009970 | Ga0157372_100099705 | 342 |
| 167 | 3300026067 | Ga0207678_10295569 | Ga0207678_102955692 | 342 |
| 168 | 3300037471 | Ga0395905_0022329 | Ga0395905_0022329_3428_4612 | 342 |
| 169 | 3300053151 | Ga0500604_0024678 | Ga0500604_0024678_330_1499 | 342 |
| 170 | iso_pu_bacteria | 2643221716 | 2644644311 | 342 |
| 171 | iso_pu_bacteria | 2738541302 | 2738853712 | 342 |
| 172 | iso_pu_bacteria | 2775506987 | 2776612088 | 342 |
| 173 | iso_pu_bacteria | 2802428842 | 2802652959 | 342 |
| 174 | iso_pu_bacteria | 2818991460 | 2819681944 | 342 |
| 175 | iso_pu_bacteria | 2821136567 | 2821136642 | 342 |
| 176 | iso_pu_bacteria | 2840677318 | 2840677968 | 342 |
| 177 | iso_pu_bacteria | 2842909656 | 2842910651 | 342 |
| 178 | iso_pu_bacteria | 2857613821 | 2857613841 | 342 |
| 179 | iso_pu_bacteria | 2857618242 | 2857620620 | 342 |
| 180 | iso_pu_bacteria | 2881359912 | 2881363704 | 342 |
| 181 | iso_pu_bacteria | 2884791551 | 2884795992 | 342 |
| 182 | iso_pu_bacteria | 2896085136 | 2896085785 | 342 |
| 183 | iso_pu_bacteria | 2896085136 | 2896087976 | 342 |
| 184 | iso_pu_bacteria | 2903895155 | 2903896317 | 342 |
| 185 | iso_pu_bacteria | 2904419702 | 2904423767 | 342 |
| 186 | iso_pu_bacteria | 2904445276 | 2904445395 | 342 |
| 187 | iso_pu_bacteria | 2904467357 | 2904468613 | 342 |
| 188 | iso_pu_bacteria | 2919191525 | 2919196364 | 342 |
| 189 | iso_pu_bacteria | 2919509842 | 2919512491 | 342 |
| 190 | iso_pu_bacteria | 2919683626 | 2919687897 | 342 |
| 191 | iso_pu_bacteria | 2929150217 | 2929154605 | 342 |
| 192 | iso_pu_bacteria | 2929177148 | 2929178499 | 342 |
| 193 | iso_pu_bacteria | 2945977869 | 2945980899 | 342 |
| 194 | iso_pu_bacteria | 2945997725 | 2946000969 | 342 |
| 195 | iso_pu_bacteria | 2946013367 | 2946019700 | 342 |
| 196 | iso_pu_bacteria | 2954016120 | 2954017870 | 342 |
| 197 | iso_pu_bacteria | 2958458903 | 2958463164 | 342 |
| 198 | iso_pu_bacteria | 2977268062 | 2977268956 | 342 |
| 199 | iso_pu_bacteria | 8054307821 | 8054311654 | 342 |
| 200 | iso_pu_bacteria | 8055419101 | 8055420697 | 342 |
| 201 | iso_pu_bacteria | 8055592153 | 8055594961 | 342 |
| 202 | 3300001989 | JGI24739J22299_10043101 | JGI24739J22299_100431011 | 343 |
| 203 | 3300001990 | JGI24737J22298_10005668 | JGI24737J22298_100056684 | 343 |
| 204 | 3300002067 | JGI24735J21928_10000001 | JGI24735J21928_10000001477 | 343 |
| 205 | 3300003320 | rootH2_10019266 | rootH2_100192665 | 343 |
| 206 | 3300003322 | rootL2_10026318 | rootL2_100263183 | 343 |
| 207 | 3300003322 | rootL2_10080383 | rootL2_100803831 | 343 |
| 208 | 3300003322 | rootL2_10190204 | rootL2_101902044 | 343 |
| 209 | 3300003323 | rootH1_10013148 | rootH1_100131486 | 343 |
| 210 | 3300003323 | rootH1_10017001 | rootH1_100170017 | 343 |
| 211 | 3300003323 | rootH1_10062356 | rootH1_1006235610 | 343 |
| 212 | 3300003323 | rootH1_10087371 | rootH1_100873712 | 343 |
| 213 | 3300003323 | rootH1_10187548 | rootH1_101875484 | 343 |
| 214 | 3300003354 | JGI25160J50197_1003260 | JGI25160J50197_10032604 | 343 |
| 215 | 3300003354 | JGI25160J50197_1005642 | JGI25160J50197_10056425 | 343 |
| 216 | 3300003761 | Ga0055535_1001690 | Ga0055535_10016908 | 343 |
| 217 | 3300003771 | Ga0055526_1015403 | Ga0055526_10154032 | 343 |
| 218 | 3300003790 | Ga0055528_1005071 | Ga0055528_10050717 | 343 |
| 219 | 3300003791 | Ga0055530_10002115 | Ga0055530_100021154 | 343 |
| 220 | 3300005262 | Ga0065165_1000053 | Ga0065165_100005374 | 343 |
| 221 | 3300005262 | Ga0065165_1000505 | Ga0065165_100050530 | 343 |
| 222 | 3300005329 | Ga0070683_100017490 | Ga0070683_1000174905 | 343 |
| 223 | 3300005335 | Ga0070666_10000375 | Ga0070666_1000037513 | 343 |
| 224 | 3300005338 | Ga0068868_100044373 | Ga0068868_1000443732 | 343 |
| 225 | 3300005340 | Ga0070689_100177136 | Ga0070689_1001771361 | 343 |
| 226 | 3300005353 | Ga0070669_100027089 | Ga0070669_1000270893 | 343 |
| 227 | 3300005355 | Ga0070671_100062937 | Ga0070671_1000629372 | 343 |
| 228 | 3300005364 | Ga0070673_100185381 | Ga0070673_1001853811 | 343 |
| 229 | 3300005367 | Ga0070667_100005666 | Ga0070667_1000056663 | 343 |
| 230 | 3300005367 | Ga0070667_100008498 | Ga0070667_1000084982 | 343 |
| 231 | 3300005458 | Ga0070681_10120544 | Ga0070681_101205442 | 343 |
| 232 | 3300005471 | Ga0070698_100157987 | Ga0070698_1001579871 | 343 |
| 233 | 3300005539 | Ga0068853_100003326 | Ga0068853_1000033262 | 343 |
| 234 | 3300005543 | Ga0070672_100108440 | Ga0070672_1001084401 | 343 |
| 235 | 3300005563 | Ga0068855_100000071 | Ga0068855_10000007177 | 343 |
| 236 | 3300005563 | Ga0068855_100073811 | Ga0068855_1000738114 | 343 |
| 237 | 3300005563 | Ga0068855_100138473 | Ga0068855_1001384733 | 343 |
| 238 | 3300005615 | Ga0070702_100011497 | Ga0070702_1000114971 | 343 |
| 239 | 3300005616 | Ga0068852_100015349 | Ga0068852_1000153492 | 343 |
| 240 | 3300005616 | Ga0068852_100353215 | Ga0068852_1003532152 | 343 |
| 241 | 3300005617 | Ga0068859_100000086 | Ga0068859_10000008615 | 343 |
| 242 | 3300005618 | Ga0068864_100028675 | Ga0068864_1000286754 | 343 |
| 243 | 3300005841 | Ga0068863_100013044 | Ga0068863_1000130443 | 343 |
| 244 | 3300005842 | Ga0068858_100002273 | Ga0068858_1000022737 | 343 |
| 245 | 3300005843 | Ga0068860_100002118 | Ga0068860_1000021189 | 343 |
| 246 | 3300006195 | Ga0075366_10068737 | Ga0075366_100687372 | 343 |
| 247 | 3300006195 | Ga0075366_10125475 | Ga0075366_101254751 | 343 |
| 248 | 3300006237 | Ga0097621_100013909 | Ga0097621_1000139094 | 343 |
| 249 | 3300006237 | Ga0097621_100049927 | Ga0097621_1000499272 | 343 |
| 250 | 3300006237 | Ga0097621_100249767 | Ga0097621_1002497671 | 343 |
| 251 | 3300006358 | Ga0068871_100083784 | Ga0068871_1000837842 | 343 |
| 252 | 3300006358 | Ga0068871_100150597 | Ga0068871_1001505973 | 343 |
| 253 | 3300006931 | Ga0097620_100000086 | Ga0097620_10000008668 | 343 |
| 254 | 3300009093 | Ga0105240_10000698 | Ga0105240_1000069828 | 343 |
| 255 | 3300009101 | Ga0105247_10002917 | Ga0105247_1000291710 | 343 |
| 256 | 3300009147 | Ga0114129_10000714 | Ga0114129_1000071421 | 343 |
| 257 | 3300009176 | Ga0105242_10021527 | Ga0105242_100215272 | 343 |
| 258 | 3300009177 | Ga0105248_10376140 | Ga0105248_103761402 | 343 |
| 259 | 3300009545 | Ga0105237_10001891 | Ga0105237_1000189117 | 343 |
| 260 | 3300009545 | Ga0105237_10105060 | Ga0105237_101050602 | 343 |
| 261 | 3300009553 | Ga0105249_10003436 | Ga0105249_1000343611 | 343 |
| 262 | 3300013100 | Ga0157373_10003571 | Ga0157373_100035714 | 343 |
| 263 | 3300013102 | Ga0157371_10013855 | Ga0157371_100138554 | 343 |
| 264 | 3300013102 | Ga0157371_10038878 | Ga0157371_100388782 | 343 |
| 265 | 3300013102 | Ga0157371_10109266 | Ga0157371_101092662 | 343 |
| 266 | 3300013105 | Ga0157369_10002318 | Ga0157369_1000231816 | 343 |
| 267 | 3300013105 | Ga0157369_10192838 | Ga0157369_101928382 | 343 |
| 268 | 3300013306 | Ga0163162_10003760 | Ga0163162_100037607 | 343 |
| 269 | 3300013306 | Ga0163162_10024019 | Ga0163162_100240197 | 343 |
| 270 | 3300013307 | Ga0157372_10000034 | Ga0157372_1000003492 | 343 |
| 271 | 3300013307 | Ga0157372_10001527 | Ga0157372_1000152713 | 343 |
| 272 | 3300013308 | Ga0157375_10035618 | Ga0157375_100356182 | 343 |
| 273 | 3300014325 | Ga0163163_10173837 | Ga0163163_101738372 | 343 |
| 274 | 3300014968 | Ga0157379_10042210 | Ga0157379_100422102 | 343 |
| 275 | 3300014969 | Ga0157376_10018216 | Ga0157376_100182162 | 343 |
| 276 | 3300014969 | Ga0157376_10040973 | Ga0157376_100409733 | 343 |
| 277 | 3300015265 | Ga0182005_1000496 | Ga0182005_100049615 | 343 |
| 278 | 3300025208 | Ga0209436_104848 | Ga0209436_1048482 | 343 |
| 279 | 3300025242 | Ga0209258_100041 | Ga0209258_10004179 | 343 |
| 280 | 3300025254 | Ga0209148_1000090 | Ga0209148_1000090156 | 343 |
| 281 | 3300025273 | Ga0209673_1000034 | Ga0209673_1000034122 | 343 |
| 282 | 3300025284 | Ga0209130_1001027 | Ga0209130_10010273 | 343 |
| 283 | 3300025295 | Ga0209564_1002475 | Ga0209564_10024757 | 343 |
| 284 | 3300025297 | Ga0209758_1003298 | Ga0209758_10032986 | 343 |
| 285 | 3300025298 | Ga0209050_1000353 | Ga0209050_100035377 | 343 |
| 286 | 3300025302 | Ga0207426_1000177 | Ga0207426_1000177103 | 343 |
| 287 | 3300025302 | Ga0207426_1000592 | Ga0207426_10005926 | 343 |
| 288 | 3300025302 | Ga0207426_1004355 | Ga0207426_10043553 | 343 |
| 289 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011815 | 343 |
| 290 | 3300025304 | Ga0209257_1001792 | Ga0209257_100179213 | 343 |
| 291 | 3300025900 | Ga0207710_10006649 | Ga0207710_100066492 | 343 |
| 292 | 3300025900 | Ga0207710_10014277 | Ga0207710_100142773 | 343 |
| 293 | 3300025903 | Ga0207680_10000117 | Ga0207680_1000011717 | 343 |
| 294 | 3300025913 | Ga0207695_10000023 | Ga0207695_1000002358 | 343 |
| 295 | 3300025913 | Ga0207695_10000110 | Ga0207695_10000110160 | 343 |
| 296 | 3300025913 | Ga0207695_10007801 | Ga0207695_100078012 | 343 |
| 297 | 3300025914 | Ga0207671_10001845 | Ga0207671_1000184514 | 343 |
| 298 | 3300025918 | Ga0207662_10047702 | Ga0207662_100477021 | 343 |
| 299 | 3300025923 | Ga0207681_10030545 | Ga0207681_100305453 | 343 |
| 300 | 3300025925 | Ga0207650_10001164 | Ga0207650_1000116417 | 343 |
| 301 | 3300025933 | Ga0207706_10033675 | Ga0207706_100336754 | 343 |
| 302 | 3300025940 | Ga0207691_10235387 | Ga0207691_102353871 | 343 |
| 303 | 3300025940 | Ga0207691_10262245 | Ga0207691_102622451 | 343 |
| 304 | 3300025942 | Ga0207689_10000260 | Ga0207689_1000026027 | 343 |
| 305 | 3300025944 | Ga0207661_10009921 | Ga0207661_100099214 | 343 |
| 306 | 3300025949 | Ga0207667_10001623 | Ga0207667_100016234 | 343 |
| 307 | 3300025949 | Ga0207667_10010568 | Ga0207667_100105687 | 343 |
| 308 | 3300025949 | Ga0207667_10274998 | Ga0207667_102749981 | 343 |
| 309 | 3300025960 | Ga0207651_10062849 | Ga0207651_100628492 | 343 |
| 310 | 3300025960 | Ga0207651_10152072 | Ga0207651_101520722 | 343 |
| 311 | 3300025961 | Ga0207712_10011421 | Ga0207712_100114216 | 343 |
| 312 | 3300025961 | Ga0207712_10090317 | Ga0207712_100903172 | 343 |
| 313 | 3300025986 | Ga0207658_10001959 | Ga0207658_1000195910 | 343 |
| 314 | 3300025986 | Ga0207658_10027157 | Ga0207658_100271571 | 343 |
| 315 | 3300026023 | Ga0207677_10042300 | Ga0207677_100423002 | 343 |
| 316 | 3300026035 | Ga0207703_10004860 | Ga0207703_100048606 | 343 |
| 317 | 3300026041 | Ga0207639_10002058 | Ga0207639_100020588 | 343 |
| 318 | 3300026088 | Ga0207641_10000061 | Ga0207641_10000061140 | 343 |
| 319 | 3300026088 | Ga0207641_10065798 | Ga0207641_100657982 | 343 |
| 320 | 3300026095 | Ga0207676_10030694 | Ga0207676_100306942 | 343 |
| 321 | 3300026142 | Ga0207698_10328129 | Ga0207698_103281291 | 343 |
| 322 | 3300028381 | Ga0268264_10001938 | Ga0268264_1000193810 | 343 |
| 323 | 3300028381 | Ga0268264_10002707 | Ga0268264_1000270713 | 343 |
| 324 | 3300030521 | Ga0307511_10004383 | Ga0307511_100043834 | 343 |
| 325 | 3300031456 | Ga0307513_10052042 | Ga0307513_100520422 | 343 |
| 326 | 3300031548 | Ga0307408_100000523 | Ga0307408_1000005231 | 343 |
| 327 | 3300031548 | Ga0307408_100002864 | Ga0307408_1000028648 | 343 |
| 328 | 3300031730 | Ga0307516_10000577 | Ga0307516_100005776 | 343 |
| 329 | 3300031911 | Ga0307412_10002513 | Ga0307412_100025132 | 343 |
| 330 | 3300032004 | Ga0307414_10071924 | Ga0307414_100719242 | 343 |
| 331 | 3300037471 | Ga0395905_0006439 | Ga0395905_0006439_10044_11234 | 343 |
| 332 | 3300037471 | Ga0395905_0180329 | Ga0395905_0180329_302_1477 | 343 |
| 333 | 3300041406 | Ga0439439_0017086 | Ga0439439_0017086_527_1693 | 343 |
| 334 | 3300041997 | Ga0439431_0000737 | Ga0439431_0000737_4583_5749 | 343 |
| 335 | 3300042004 | Ga0439445_0010751 | Ga0439445_0010751_135_1301 | 343 |
| 336 | 3300042435 | Ga0439434_0002205 | Ga0439434_0002205_1022_2188 | 343 |
| 337 | 3300044658 | Ga0466972_0003358 | Ga0466972_0003358_3804_4961 | 343 |
| 338 | 3300044672 | Ga0466982_0101498 | Ga0466982_0101498_605_1771 | 343 |
| 339 | 3300044735 | Ga0466968_0003823 | Ga0466968_0003823_2748_3905 | 343 |
| 340 | 3300045049 | Ga0466959_0062939 | Ga0466959_0062939_100_1266 | 343 |
| 341 | 3300046453 | Ga0495627_004222 | Ga0495627_004222_1084_2250 | 343 |
| 342 | 3300046492 | Ga0495585_0000132 | Ga0495585_0000132_59716_60909 | 343 |
| 343 | 3300046512 | Ga0495610_0002154 | Ga0495610_0002154_3508_4701 | 343 |
| 344 | 3300046520 | Ga0495637_0063719 | Ga0495637_0063719_169_1362 | 343 |
| 345 | 3300046558 | Ga0495633_0000175 | Ga0495633_0000175_63138_64304 | 343 |
| 346 | 3300046558 | Ga0495633_0013201 | Ga0495633_0013201_1795_2988 | 343 |
| 347 | 3300047443 | Ga0495687_001120 | Ga0495687_001120_828_2021 | 343 |
| 348 | 3300047472 | Ga0495686_0027606 | Ga0495686_0027606_470_1663 | 343 |
| 349 | 3300049571 | Ga0501034_0009656 | Ga0501034_0009656_2205_3392 | 343 |
| 350 | 3300049571 | Ga0501034_0037269 | Ga0501034_0037269_552_1709 | 343 |
| 351 | 3300049703 | Ga0501219_000576 | Ga0501219_000576_677_1837 | 343 |
| 352 | 3300049758 | Ga0501241_000121 | Ga0501241_000121_5551_6717 | 343 |
| 353 | 3300049823 | Ga0501044_0011376 | Ga0501044_0011376_4629_5798 | 343 |
| 354 | 3300050005 | Ga0501284_00011 | Ga0501284_00011_89321_90481 | 343 |
| 355 | 3300050493 | nmdc:mga0k408_73788_c2 | nmdc:mga0k408_73788_c2_356_1549 | 343 |
| 356 | 3300050507 | nmdc:mga05p37_3494_c1 | nmdc:mga05p37_3494_c1_12436_13593 | 343 |
| 357 | 3300053088 | Ga0500644_0000182 | Ga0500644_0000182_3049_4224 | 343 |
| 358 | 3300053090 | Ga0500646_0008069 | Ga0500646_0008069_261_1436 | 343 |
| 359 | 3300053092 | Ga0500583_0007260 | Ga0500583_0007260_2222_3397 | 343 |
| 360 | 3300053108 | Ga0500562_000111 | Ga0500562_000111_13581_14798 | 343 |
| 361 | 3300053121 | Ga0500607_072770 | Ga0500607_072770_260_1435 | 343 |
| 362 | 3300053125 | Ga0500618_017274 | Ga0500618_017274_531_1694 | 343 |
| 363 | 3300053136 | Ga0500559_0016298 | Ga0500559_0016298_1772_2947 | 343 |
| 364 | 3300053139 | Ga0500568_0016532 | Ga0500568_0016532_659_1816 | 343 |
| 365 | 3300053142 | Ga0500577_0005308 | Ga0500577_0005308_376_1551 | 343 |
| 366 | 3300053156 | Ga0500622_0001039 | Ga0500622_0001039_13886_15052 | 343 |
| 367 | 3300054114 | Ga0501084_0012175 | Ga0501084_0012175_1867_3078 | 343 |
| 368 | 3300055283 | Ga0500661_010844 | Ga0500661_010844_58_1224 | 343 |
| 369 | iso_pu_bacteria | 2599185184 | 2599477153 | 343 |
| 370 | iso_pu_bacteria | 2818991442 | 2819573222 | 343 |
| 371 | iso_pu_bacteria | 2842903701 | 2842909586 | 343 |
| 372 | iso_pu_bacteria | 2902048731 | 2902050799 | 343 |
| 373 | iso_pu_bacteria | 2928078545 | 2928079066 | 343 |
| 374 | iso_pu_bacteria | 2928147474 | 2928148563 | 343 |
| 375 | iso_pu_bacteria | 2929239360 | 2929240829 | 343 |
| 376 | iso_pu_bacteria | 2932082852 | 2932085857 | 343 |
| 377 | 3300003320 | rootH2_10007188 | rootH2_1000718841 | 344 |
| 378 | 3300005543 | Ga0070672_100157263 | Ga0070672_1001572632 | 344 |
| 379 | 3300005577 | Ga0068857_100004433 | Ga0068857_10000443313 | 344 |
| 380 | 3300005578 | Ga0068854_100001289 | Ga0068854_1000012893 | 344 |
| 381 | 3300005614 | Ga0068856_100038584 | Ga0068856_1000385846 | 344 |
| 382 | 3300006237 | Ga0097621_100145627 | Ga0097621_1001456272 | 344 |
| 383 | 3300009148 | Ga0105243_10000011 | Ga0105243_100000112 | 344 |
| 384 | 3300009551 | Ga0105238_10190251 | Ga0105238_101902512 | 344 |
| 385 | 3300013100 | Ga0157373_10139449 | Ga0157373_101394492 | 344 |
| 386 | 3300013104 | Ga0157370_10002675 | Ga0157370_1000267525 | 344 |
| 387 | 3300013307 | Ga0157372_10003589 | Ga0157372_1000358914 | 344 |
| 388 | 3300013307 | Ga0157372_10012503 | Ga0157372_100125033 | 344 |
| 389 | 3300025935 | Ga0207709_10000034 | Ga0207709_100000343 | 344 |
| 390 | 3300025949 | Ga0207667_10015148 | Ga0207667_100151486 | 344 |
| 391 | 3300025981 | Ga0207640_10014455 | Ga0207640_100144552 | 344 |
| 392 | 3300026041 | Ga0207639_10081046 | Ga0207639_100810462 | 344 |
| 393 | 3300026078 | Ga0207702_10169950 | Ga0207702_101699502 | 344 |
| 394 | 3300026116 | Ga0207674_10003174 | Ga0207674_1000317413 | 344 |
| 395 | 3300026142 | Ga0207698_10031882 | Ga0207698_100318825 | 344 |
| 396 | 3300031548 | Ga0307408_100001044 | Ga0307408_1000010449 | 344 |
| 397 | 3300031548 | Ga0307408_100044263 | Ga0307408_1000442632 | 344 |
| 398 | 3300044693 | Ga0466961_0009882 | Ga0466961_0009882_4267_5439 | 344 |
| 399 | 3300044765 | Ga0466970_0009210 | Ga0466970_0009210_786_1958 | 344 |
| 400 | 3300045049 | Ga0466959_0005372 | Ga0466959_0005372_4768_5940 | 344 |
| 401 | 3300045836 | Ga0466958_0008462 | Ga0466958_0008462_1169_2341 | 344 |
| 402 | 3300045976 | Ga0466967_0130616 | Ga0466967_0130616_1026_2240 | 344 |
| 403 | 3300048919 | Ga0496116_0002724 | Ga0496116_0002724_1919_3079 | 344 |
| 404 | 3300048920 | Ga0496117_0014391 | Ga0496117_0014391_3490_4650 | 344 |
| 405 | 3300048925 | Ga0496122_0010272 | Ga0496122_0010272_6453_7613 | 344 |
| 406 | 3300048926 | Ga0496123_0028896 | Ga0496123_0028896_1711_2871 | 344 |
| 407 | 3300049670 | Ga0501236_001008 | Ga0501236_001008_96_1259 | 344 |
| 408 | 3300049686 | Ga0501257_000372 | Ga0501257_000372_6911_8074 | 344 |
| 409 | 3300053151 | Ga0500604_0006093 | Ga0500604_0006093_996_2189 | 344 |
| 410 | iso_pu_bacteria | 2585427687 | 2586206915 | 344 |
| 411 | iso_pu_bacteria | 2739367651 | 2739588974 | 344 |
| 412 | iso_pu_bacteria | 2739367656 | 2739618038 | 344 |
| 413 | iso_pu_bacteria | 2739367663 | 2739644949 | 344 |
| 414 | iso_pu_bacteria | 2818991437 | 2819547950 | 344 |
| 415 | iso_pu_bacteria | 2842722452 | 2842726401 | 344 |
| 416 | iso_pu_bacteria | 2849281842 | 2849284587 | 344 |
| 417 | iso_pu_bacteria | 2857627736 | 2857630926 | 344 |
| 418 | iso_pu_bacteria | 2896317667 | 2896321235 | 344 |
| 419 | 3300001904 | JGI24736J21556_1004506 | JGI24736J21556_10045064 | 345 |
| 420 | 3300002773 | JGI25152J39213_1000128 | JGI25152J39213_100012810 | 345 |
| 421 | 3300002774 | JGI25150J39212_1000021 | JGI25150J39212_100002162 | 345 |
| 422 | 3300003187 | JGI25151J46595_10000078 | JGI25151J46595_1000007862 | 345 |
| 423 | 3300003203 | JGI25406J46586_10000521 | JGI25406J46586_100005216 | 345 |
| 424 | 3300003215 | JGI25153J46596_10000057 | JGI25153J46596_1000005762 | 345 |
| 425 | 3300003322 | rootL2_10040843 | rootL2_100408435 | 345 |
| 426 | 3300003323 | rootH1_10006645 | rootH1_1000664587 | 345 |
| 427 | 3300003781 | Ga0055536_1000009 | Ga0055536_1000009127 | 345 |
| 428 | 3300003781 | Ga0055536_1000018 | Ga0055536_100001816 | 345 |
| 429 | 3300003781 | Ga0055536_1000038 | Ga0055536_100003881 | 345 |
| 430 | 3300003791 | Ga0055530_10001763 | Ga0055530_100017637 | 345 |
| 431 | 3300003791 | Ga0055530_10002626 | Ga0055530_100026268 | 345 |
| 432 | 3300003791 | Ga0055530_10010075 | Ga0055530_100100752 | 345 |
| 433 | 3300003794 | Ga0055531_10000061 | Ga0055531_1000006142 | 345 |
| 434 | 3300005288 | Ga0065714_10002374 | Ga0065714_1000237425 | 345 |
| 435 | 3300005288 | Ga0065714_10010603 | Ga0065714_100106033 | 345 |
| 436 | 3300005288 | Ga0065714_10064467 | Ga0065714_1006446726 | 345 |
| 437 | 3300005288 | Ga0065714_10104306 | Ga0065714_101043061 | 345 |
| 438 | 3300005327 | Ga0070658_10003995 | Ga0070658_100039957 | 345 |
| 439 | 3300005328 | Ga0070676_10000736 | Ga0070676_1000073611 | 345 |
| 440 | 3300005328 | Ga0070676_10001877 | Ga0070676_100018773 | 345 |
| 441 | 3300005334 | Ga0068869_100048050 | Ga0068869_1000480502 | 345 |
| 442 | 3300005335 | Ga0070666_10000474 | Ga0070666_1000047411 | 345 |
| 443 | 3300005335 | Ga0070666_10104599 | Ga0070666_101045991 | 345 |
| 444 | 3300005338 | Ga0068868_100002213 | Ga0068868_1000022138 | 345 |
| 445 | 3300005338 | Ga0068868_100002884 | Ga0068868_1000028846 | 345 |
| 446 | 3300005338 | Ga0068868_100044373 | Ga0068868_1000443733 | 345 |
| 447 | 3300005340 | Ga0070689_100038133 | Ga0070689_1000381331 | 345 |
| 448 | 3300005347 | Ga0070668_100000876 | Ga0070668_1000008762 | 345 |
| 449 | 3300005353 | Ga0070669_100001647 | Ga0070669_1000016474 | 345 |
| 450 | 3300005354 | Ga0070675_100050426 | Ga0070675_1000504262 | 345 |
| 451 | 3300005354 | Ga0070675_100204859 | Ga0070675_1002048592 | 345 |
| 452 | 3300005364 | Ga0070673_100001104 | Ga0070673_1000011042 | 345 |
| 453 | 3300005364 | Ga0070673_100203869 | Ga0070673_1002038692 | 345 |
| 454 | 3300005365 | Ga0070688_100081557 | Ga0070688_1000815573 | 345 |
| 455 | 3300005365 | Ga0070688_100112236 | Ga0070688_1001122362 | 345 |
| 456 | 3300005367 | Ga0070667_100000588 | Ga0070667_10000058820 | 345 |
| 457 | 3300005367 | Ga0070667_100027924 | Ga0070667_1000279243 | 345 |
| 458 | 3300005455 | Ga0070663_100046592 | Ga0070663_1000465922 | 345 |
| 459 | 3300005457 | Ga0070662_100013592 | Ga0070662_1000135924 | 345 |
| 460 | 3300005459 | Ga0068867_100035423 | Ga0068867_1000354232 | 345 |
| 461 | 3300005459 | Ga0068867_100136493 | Ga0068867_1001364931 | 345 |
| 462 | 3300005539 | Ga0068853_100021933 | Ga0068853_1000219332 | 345 |
| 463 | 3300005543 | Ga0070672_100000511 | Ga0070672_1000005118 | 345 |
| 464 | 3300005543 | Ga0070672_100148887 | Ga0070672_1001488872 | 345 |
| 465 | 3300005548 | Ga0070665_100001321 | Ga0070665_10000132112 | 345 |
| 466 | 3300005563 | Ga0068855_100151087 | Ga0068855_1001510872 | 345 |
| 467 | 3300005564 | Ga0070664_100184146 | Ga0070664_1001841462 | 345 |
| 468 | 3300005577 | Ga0068857_100144436 | Ga0068857_1001444363 | 345 |
| 469 | 3300005616 | Ga0068852_100010804 | Ga0068852_1000108048 | 345 |
| 470 | 3300005616 | Ga0068852_100049983 | Ga0068852_1000499832 | 345 |
| 471 | 3300005616 | Ga0068852_100109176 | Ga0068852_1001091762 | 345 |
| 472 | 3300005617 | Ga0068859_100015843 | Ga0068859_1000158433 | 345 |
| 473 | 3300005618 | Ga0068864_100002120 | Ga0068864_1000021203 | 345 |
| 474 | 3300005719 | Ga0068861_100000923 | Ga0068861_10000092310 | 345 |
| 475 | 3300005719 | Ga0068861_100073932 | Ga0068861_1000739322 | 345 |
| 476 | 3300005834 | Ga0068851_10000384 | Ga0068851_100003849 | 345 |
| 477 | 3300005841 | Ga0068863_100001340 | Ga0068863_10000134011 | 345 |
| 478 | 3300005841 | Ga0068863_100141315 | Ga0068863_1001413152 | 345 |
| 479 | 3300005842 | Ga0068858_100004360 | Ga0068858_1000043602 | 345 |
| 480 | 3300005843 | Ga0068860_100044232 | Ga0068860_1000442323 | 345 |
| 481 | 3300005843 | Ga0068860_100077080 | Ga0068860_1000770805 | 345 |
| 482 | 3300005844 | Ga0068862_100063199 | Ga0068862_1000631992 | 345 |
| 483 | 3300005985 | Ga0081539_10000147 | Ga0081539_1000014715 | 345 |
| 484 | 3300006358 | Ga0068871_100001314 | Ga0068871_1000013143 | 345 |
| 485 | 3300006358 | Ga0068871_100025101 | Ga0068871_1000251013 | 345 |
| 486 | 3300006847 | Ga0075431_100024145 | Ga0075431_1000241454 | 345 |
| 487 | 3300006880 | Ga0075429_100009693 | Ga0075429_1000096933 | 345 |
| 488 | 3300006881 | Ga0068865_100030969 | Ga0068865_1000309692 | 345 |
| 489 | 3300006881 | Ga0068865_100184774 | Ga0068865_1001847741 | 345 |
| 490 | 3300006931 | Ga0097620_100015843 | Ga0097620_1000158433 | 345 |
| 491 | 3300006946 | Ga0079104_1000691 | Ga0079104_10006916 | 345 |
| 492 | 3300006948 | Ga0099826_10002736 | Ga0099826_100027369 | 345 |
| 493 | 3300009011 | Ga0105251_10033920 | Ga0105251_100339202 | 345 |
| 494 | 3300009093 | Ga0105240_10000195 | Ga0105240_1000019522 | 345 |
| 495 | 3300009093 | Ga0105240_10001517 | Ga0105240_1000151727 | 345 |
| 496 | 3300009093 | Ga0105240_10003007 | Ga0105240_100030078 | 345 |
| 497 | 3300009093 | Ga0105240_10009054 | Ga0105240_100090548 | 345 |
| 498 | 3300009093 | Ga0105240_10012381 | Ga0105240_100123819 | 345 |
| 499 | 3300009094 | Ga0111539_10002087 | Ga0111539_1000208720 | 345 |
| 500 | 3300009101 | Ga0105247_10000793 | Ga0105247_100007935 | 345 |
| 501 | 3300009174 | Ga0105241_10000254 | Ga0105241_100002543 | 345 |
| 502 | 3300009176 | Ga0105242_10020788 | Ga0105242_100207882 | 345 |
| 503 | 3300009177 | Ga0105248_10067327 | Ga0105248_100673272 | 345 |
| 504 | 3300009545 | Ga0105237_10002105 | Ga0105237_1000210516 | 345 |
| 505 | 3300009545 | Ga0105237_10024976 | Ga0105237_100249764 | 345 |
| 506 | 3300009545 | Ga0105237_10033300 | Ga0105237_100333002 | 345 |
| 507 | 3300009551 | Ga0105238_10000496 | Ga0105238_1000049623 | 345 |
| 508 | 3300009551 | Ga0105238_10002761 | Ga0105238_100027611 | 345 |
| 509 | 3300009553 | Ga0105249_10004284 | Ga0105249_100042848 | 345 |
| 510 | 3300009553 | Ga0105249_10038377 | Ga0105249_100383773 | 345 |
| 511 | 3300009553 | Ga0105249_10047688 | Ga0105249_100476883 | 345 |
| 512 | 3300009553 | Ga0105249_10176696 | Ga0105249_101766962 | 345 |
| 513 | 3300010375 | Ga0105239_10185231 | Ga0105239_101852312 | 345 |
| 514 | 3300010375 | Ga0105239_10468354 | Ga0105239_104683542 | 345 |
| 515 | 3300011119 | Ga0105246_10015666 | Ga0105246_100156664 | 345 |
| 516 | 3300013100 | Ga0157373_10001036 | Ga0157373_100010367 | 345 |
| 517 | 3300013102 | Ga0157371_10000034 | Ga0157371_10000034180 | 345 |
| 518 | 3300013102 | Ga0157371_10005972 | Ga0157371_100059722 | 345 |
| 519 | 3300013102 | Ga0157371_10038726 | Ga0157371_100387262 | 345 |
| 520 | 3300013104 | Ga0157370_10000405 | Ga0157370_1000040521 | 345 |
| 521 | 3300013104 | Ga0157370_10000640 | Ga0157370_1000064023 | 345 |
| 522 | 3300013104 | Ga0157370_10000920 | Ga0157370_100009207 | 345 |
| 523 | 3300013104 | Ga0157370_10002194 | Ga0157370_1000219411 | 345 |
| 524 | 3300013104 | Ga0157370_10002625 | Ga0157370_100026258 | 345 |
| 525 | 3300013104 | Ga0157370_10003317 | Ga0157370_100033172 | 345 |
| 526 | 3300013104 | Ga0157370_10004387 | Ga0157370_100043871 | 345 |
| 527 | 3300013104 | Ga0157370_10004945 | Ga0157370_100049453 | 345 |
| 528 | 3300013104 | Ga0157370_10007720 | Ga0157370_100077206 | 345 |
| 529 | 3300013104 | Ga0157370_10024727 | Ga0157370_100247275 | 345 |
| 530 | 3300013104 | Ga0157370_10027437 | Ga0157370_100274374 | 345 |
| 531 | 3300013104 | Ga0157370_10097344 | Ga0157370_100973442 | 345 |
| 532 | 3300013104 | Ga0157370_10348614 | Ga0157370_103486142 | 345 |
| 533 | 3300013105 | Ga0157369_10000002 | Ga0157369_1000000299 | 345 |
| 534 | 3300013105 | Ga0157369_10193466 | Ga0157369_101934661 | 345 |
| 535 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001126 | 345 |
| 536 | 3300013296 | Ga0157374_10043822 | Ga0157374_100438223 | 345 |
| 537 | 3300013297 | Ga0157378_10058343 | Ga0157378_100583432 | 345 |
| 538 | 3300013297 | Ga0157378_10076231 | Ga0157378_100762312 | 345 |
| 539 | 3300013297 | Ga0157378_10299420 | Ga0157378_102994201 | 345 |
| 540 | 3300013306 | Ga0163162_10000674 | Ga0163162_100006749 | 345 |
| 541 | 3300013306 | Ga0163162_10001501 | Ga0163162_1000150115 | 345 |
| 542 | 3300013306 | Ga0163162_10005335 | Ga0163162_100053353 | 345 |
| 543 | 3300013306 | Ga0163162_10019498 | Ga0163162_100194983 | 345 |
| 544 | 3300013307 | Ga0157372_10072036 | Ga0157372_100720363 | 345 |
| 545 | 3300013307 | Ga0157372_10095794 | Ga0157372_100957942 | 345 |
| 546 | 3300013307 | Ga0157372_10104462 | Ga0157372_101044622 | 345 |
| 547 | 3300013307 | Ga0157372_10112438 | Ga0157372_101124382 | 345 |
| 548 | 3300013307 | Ga0157372_10410641 | Ga0157372_104106411 | 345 |
| 549 | 3300013308 | Ga0157375_10004612 | Ga0157375_100046123 | 345 |
| 550 | 3300013308 | Ga0157375_10025638 | Ga0157375_100256382 | 345 |
| 551 | 3300014325 | Ga0163163_10003420 | Ga0163163_100034203 | 345 |
| 552 | 3300014326 | Ga0157380_10284510 | Ga0157380_102845101 | 345 |
| 553 | 3300014497 | Ga0182008_10000335 | Ga0182008_1000033523 | 345 |
| 554 | 3300014497 | Ga0182008_10000613 | Ga0182008_1000061321 | 345 |
| 555 | 3300014497 | Ga0182008_10016639 | Ga0182008_100166392 | 345 |
| 556 | 3300014497 | Ga0182008_10050526 | Ga0182008_100505262 | 345 |
| 557 | 3300014745 | Ga0157377_10036152 | Ga0157377_100361521 | 345 |
| 558 | 3300014968 | Ga0157379_10000571 | Ga0157379_100005714 | 345 |
| 559 | 3300014968 | Ga0157379_10023146 | Ga0157379_100231462 | 345 |
| 560 | 3300014968 | Ga0157379_10176621 | Ga0157379_101766212 | 345 |
| 561 | 3300014969 | Ga0157376_10002660 | Ga0157376_100026608 | 345 |
| 562 | 3300014969 | Ga0157376_10088822 | Ga0157376_100888222 | 345 |
| 563 | 3300015261 | Ga0182006_1000770 | Ga0182006_10007706 | 345 |
| 564 | 3300015261 | Ga0182006_1001696 | Ga0182006_10016964 | 345 |
| 565 | 3300015261 | Ga0182006_1002006 | Ga0182006_10020067 | 345 |
| 566 | 3300015261 | Ga0182006_1005799 | Ga0182006_10057992 | 345 |
| 567 | 3300015261 | Ga0182006_1007598 | Ga0182006_10075984 | 345 |
| 568 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001678 | 345 |
| 569 | 3300015682 | Ga0183373_1003 | Ga0183373_1003140 | 345 |
| 570 | 3300017792 | Ga0163161_10000108 | Ga0163161_100001081 | 345 |
| 571 | 3300017792 | Ga0163161_10000913 | Ga0163161_100009139 | 345 |
| 572 | 3300017792 | Ga0163161_10008720 | Ga0163161_100087205 | 345 |
| 573 | 3300017792 | Ga0163161_10017167 | Ga0163161_100171676 | 345 |
| 574 | 3300017792 | Ga0163161_10072957 | Ga0163161_100729572 | 345 |
| 575 | 3300025245 | Ga0207425_1000004 | Ga0207425_100000460 | 345 |
| 576 | 3300025258 | Ga0209129_1000048 | Ga0209129_100004860 | 345 |
| 577 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001112 | 345 |
| 578 | 3300025292 | Ga0209676_1000001 | Ga0209676_10000011224 | 345 |
| 579 | 3300025292 | Ga0209676_1000201 | Ga0209676_100020129 | 345 |
| 580 | 3300025294 | Ga0209025_1000009 | Ga0209025_100000960 | 345 |
| 581 | 3300025297 | Ga0209758_1000010 | Ga0209758_100001061 | 345 |
| 582 | 3300025298 | Ga0209050_1000018 | Ga0209050_1000018360 | 345 |
| 583 | 3300025298 | Ga0209050_1000114 | Ga0209050_1000114140 | 345 |
| 584 | 3300025298 | Ga0209050_1000203 | Ga0209050_100020329 | 345 |
| 585 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006212 | 345 |
| 586 | 3300025903 | Ga0207680_10000801 | Ga0207680_100008014 | 345 |
| 587 | 3300025908 | Ga0207643_10010554 | Ga0207643_100105543 | 345 |
| 588 | 3300025909 | Ga0207705_10003352 | Ga0207705_100033528 | 345 |
| 589 | 3300025909 | Ga0207705_10022080 | Ga0207705_100220802 | 345 |
| 590 | 3300025911 | Ga0207654_10016425 | Ga0207654_100164254 | 345 |
| 591 | 3300025911 | Ga0207654_10098384 | Ga0207654_100983841 | 345 |
| 592 | 3300025913 | Ga0207695_10000229 | Ga0207695_1000022983 | 345 |
| 593 | 3300025913 | Ga0207695_10035045 | Ga0207695_100350455 | 345 |
| 594 | 3300025914 | Ga0207671_10002829 | Ga0207671_1000282919 | 345 |
| 595 | 3300025914 | Ga0207671_10003885 | Ga0207671_100038853 | 345 |
| 596 | 3300025914 | Ga0207671_10039435 | Ga0207671_100394352 | 345 |
| 597 | 3300025919 | Ga0207657_10261809 | Ga0207657_102618091 | 345 |
| 598 | 3300025920 | Ga0207649_10089604 | Ga0207649_100896042 | 345 |
| 599 | 3300025921 | Ga0207652_10001773 | Ga0207652_100017734 | 345 |
| 600 | 3300025923 | Ga0207681_10040645 | Ga0207681_100406452 | 345 |
| 601 | 3300025924 | Ga0207694_10010106 | Ga0207694_100101062 | 345 |
| 602 | 3300025925 | Ga0207650_10124656 | Ga0207650_101246561 | 345 |
| 603 | 3300025932 | Ga0207690_10099092 | Ga0207690_100990923 | 345 |
| 604 | 3300025933 | Ga0207706_10013982 | Ga0207706_100139824 | 345 |
| 605 | 3300025938 | Ga0207704_10003386 | Ga0207704_100033863 | 345 |
| 606 | 3300025940 | Ga0207691_10054945 | Ga0207691_100549452 | 345 |
| 607 | 3300025942 | Ga0207689_10063560 | Ga0207689_100635602 | 345 |
| 608 | 3300025942 | Ga0207689_10141868 | Ga0207689_101418681 | 345 |
| 609 | 3300025949 | Ga0207667_10123376 | Ga0207667_101233762 | 345 |
| 610 | 3300025960 | Ga0207651_10000857 | Ga0207651_100008573 | 345 |
| 611 | 3300025960 | Ga0207651_10039267 | Ga0207651_100392672 | 345 |
| 612 | 3300025972 | Ga0207668_10001121 | Ga0207668_100011212 | 345 |
| 613 | 3300025972 | Ga0207668_10046723 | Ga0207668_100467232 | 345 |
| 614 | 3300025986 | Ga0207658_10001753 | Ga0207658_1000175311 | 345 |
| 615 | 3300026023 | Ga0207677_10001454 | Ga0207677_100014543 | 345 |
| 616 | 3300026023 | Ga0207677_10042300 | Ga0207677_100423001 | 345 |
| 617 | 3300026023 | Ga0207677_10052126 | Ga0207677_100521262 | 345 |
| 618 | 3300026035 | Ga0207703_10010647 | Ga0207703_100106475 | 345 |
| 619 | 3300026041 | Ga0207639_10029547 | Ga0207639_100295472 | 345 |
| 620 | 3300026088 | Ga0207641_10038139 | Ga0207641_100381392 | 345 |
| 621 | 3300026089 | Ga0207648_10050290 | Ga0207648_100502903 | 345 |
| 622 | 3300026089 | Ga0207648_10156527 | Ga0207648_101565272 | 345 |
| 623 | 3300026116 | Ga0207674_10033080 | Ga0207674_100330801 | 345 |
| 624 | 3300026116 | Ga0207674_10267925 | Ga0207674_102679251 | 345 |
| 625 | 3300026118 | Ga0207675_100005957 | Ga0207675_1000059576 | 345 |
| 626 | 3300026118 | Ga0207675_100090022 | Ga0207675_1000900223 | 345 |
| 627 | 3300026142 | Ga0207698_10037794 | Ga0207698_100377942 | 345 |
| 628 | 3300026142 | Ga0207698_10168944 | Ga0207698_101689441 | 345 |
| 629 | 3300027111 | Ga0209281_1000037 | Ga0209281_10000376 | 345 |
| 630 | 3300027666 | Ga0209282_1006995 | Ga0209282_10069953 | 345 |
| 631 | 3300028379 | Ga0268266_10003239 | Ga0268266_100032397 | 345 |
| 632 | 3300028381 | Ga0268264_10004286 | Ga0268264_100042866 | 345 |
| 633 | 3300028381 | Ga0268264_10072295 | Ga0268264_100722953 | 345 |
| 634 | 3300028794 | Ga0307515_10270711 | Ga0307515_102707112 | 345 |
| 635 | 3300030731 | Ga0316177_1078287 | Ga0316177_10782872 | 345 |
| 636 | 3300030732 | Ga0316176_1082807 | Ga0316176_108280714 | 345 |
| 637 | 3300030742 | Ga0316183_1015945 | Ga0316183_10159455 | 345 |
| 638 | 3300030744 | Ga0316181_1158450 | Ga0316181_11584505 | 345 |
| 639 | 3300031731 | Ga0307405_10000031 | Ga0307405_1000003127 | 345 |
| 640 | 3300031903 | Ga0307407_10000065 | Ga0307407_100000657 | 345 |
| 641 | 3300032002 | Ga0307416_100000146 | Ga0307416_10000014628 | 345 |
| 642 | 3300032002 | Ga0307416_100146571 | Ga0307416_1001465712 | 345 |
| 643 | 3300032004 | Ga0307414_10001598 | Ga0307414_1000159811 | 345 |
| 644 | 3300032004 | Ga0307414_10011142 | Ga0307414_100111422 | 345 |
| 645 | 3300032004 | Ga0307414_10013353 | Ga0307414_100133532 | 345 |
| 646 | 3300033180 | Ga0307510_10022799 | Ga0307510_100227992 | 345 |
| 647 | 3300036401 | Ga0373937_0035884 | Ga0373937_0035884_1311_2489 | 345 |
| 648 | 3300038443 | Ga0395901_0416372 | Ga0395901_0416372_46_1230 | 345 |
| 649 | 3300039437 | Ga0436365_0920295 | Ga0436365_0920295_42591_43754 | 345 |
| 650 | 3300041997 | Ga0439431_0018540 | Ga0439431_0018540_142_1305 | 345 |
| 651 | 3300042135 | Ga0450899_003127 | Ga0450899_003127_504_1667 | 345 |
| 652 | 3300042876 | Ga0451577_0016763 | Ga0451577_0016763_3760_4935 | 345 |
| 653 | 3300044683 | Ga0466965_0021300 | Ga0466965_0021300_253_1434 | 345 |
| 654 | 3300044712 | Ga0453684_0001775 | Ga0453684_0001775_332_1507 | 345 |
| 655 | 3300045051 | Ga0451576_0006920 | Ga0451576_0006920_2092_3261 | 345 |
| 656 | 3300046512 | Ga0495610_0000064 | Ga0495610_0000064_38061_39224 | 345 |
| 657 | 3300046512 | Ga0495610_0001020 | Ga0495610_0001020_4503_5666 | 345 |
| 658 | 3300046512 | Ga0495610_0005260 | Ga0495610_0005260_2399_3562 | 345 |
| 659 | 3300046524 | Ga0495648_0007897 | Ga0495648_0007897_676_1851 | 345 |
| 660 | 3300046558 | Ga0495633_0000223 | Ga0495633_0000223_7246_8430 | 345 |
| 661 | 3300046616 | Ga0495668_0000191 | Ga0495668_0000191_57869_59035 | 345 |
| 662 | 3300047320 | Ga0495672_0015522 | Ga0495672_0015522_539_1702 | 345 |
| 663 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_238786_240036 | 345 |
| 664 | 3300047472 | Ga0495686_0004164 | Ga0495686_0004164_10455_11636 | 345 |
| 665 | 3300048925 | Ga0496122_0000765 | Ga0496122_0000765_44047_45222 | 345 |
| 666 | 3300048926 | Ga0496123_0005845 | Ga0496123_0005845_3751_4926 | 345 |
| 667 | 3300049679 | Ga0501249_000005 | Ga0501249_000005_48030_49211 | 345 |
| 668 | 3300050508 | nmdc:mga09592_198153_c1 | nmdc:mga09592_198153_c1_452_1618 | 345 |
| 669 | 3300053096 | Ga0500641_0000117 | Ga0500641_0000117_17695_18897 | 345 |
| 670 | 3300053156 | Ga0500622_0000026 | Ga0500622_0000026_219996_221165 | 345 |
| 671 | 3300053156 | Ga0500622_0000365 | Ga0500622_0000365_14502_15671 | 345 |
| 672 | 3300053156 | Ga0500622_0021016 | Ga0500622_0021016_1076_2251 | 345 |
| 673 | iso_pu_bacteria | 2519899754 | 2520878058 | 345 |
| 674 | iso_pu_bacteria | 2738541283 | 2738759709 | 345 |
| 675 | iso_pu_bacteria | 2738543023 | 2739304614 | 345 |
| 676 | iso_pu_bacteria | 2852627209 | 2852628563 | 345 |
| 677 | iso_pu_bacteria | 2919186247 | 2919186934 | 345 |
| 678 | iso_pu_bacteria | 2939664404 | 2939665797 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ban-assembly1.cif.gz_B | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.7617 | 2 | 344 |
| 3ban-assembly1.cif.gz_A | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.7551 | 1 | 344 |
| 4eay-assembly1.cif.gz_A | crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate | 0.7512 | 1 | 345 |
| 4eay-assembly1.cif.gz_A | crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate | 0.7492 | 1 | 345 |
| 1tz9-assembly1.cif.gz_B | crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 | 0.7353 | 3 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8376 | 1 | 345 | 3.20.20.150 |
| af_P24215_172_393_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8316 | 131 | 345 | 3.20.20.150 |
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8252 | 1 | 345 | 3.20.20.150 |
| af_P24215_172_393_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7996 | 131 | 345 | 3.20.20.150 |
| 3banB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7617 | 2 | 344 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530M004-F1-model_v4 | deleted | 0.9912 | 217 | 297 |
|
| AF-A0A4U9D021-F1-model_v4 | Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) | 0.9796 | 208 | 297 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A060CDP4-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9737 | 3 | 68 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A349W3N1-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9727 | 206 | 285 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A520IDC8-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9697 | 214 | 345 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar