F474609

General Info

Members Datasets Scaffolds Average Seq Length
677 312 1354 217

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0125426|Ga0496125_0125426_60_689
Length 209
Sequence MTTIGIIGAGHIGGQVARKAVELGYDVVISNSRGPETLGDLIAELGPKARAATPAEAAAAGDFAVVSVPLKSIRDVPVEPLAGKIVLDTNNYYWERDGHVPALDAGEDTTSGLLQKHLPQSKVAKAFNHIRFSGITTDGTPNRRALATASDFPEAAELVTRLYDEFGFDTVSMGPLSESWRTERDRPAYVIRQNAAELAENLAKAPRTI

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 6.94
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 3.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0125426 3300048928 Bacteria 1821
2 Ga0055540_1035338 3300003792 Bacteria 1118
3 Ga0065712_10068679 3300005290 Bacteria 9416
4 Ga0065712_10085881 3300005290 Bacteria 2668
5 Ga0065712_10229919 3300005290 Bacteria 1014
6 Ga0065715_10004798 3300005293 Bacteria 3798
7 Ga0065715_10043255 3300005293 Bacteria 1182
8 Ga0065715_10122497 3300005293 Bacteria 2203
9 Ga0065707_10002575 3300005295 Bacteria 6441
10 Ga0070676_10094013 3300005328 Bacteria 1841
11 Ga0070676_10371574 3300005328 Bacteria 988
12 Ga0070683_100081576 3300005329 Bacteria 3028
13 Ga0070683_100154300 3300005329 Unclassified 2178
14 Ga0070683_100374842 3300005329 Bacteria 1356
15 Ga0070690_100027653 3300005330 Bacteria 3507
16 Ga0070670_100016724 3300005331 Bacteria 6296
17 Ga0070670_100024449 3300005331 Bacteria 5195
18 Ga0070670_100055228 3300005331 Bacteria 3409
19 Ga0070670_100218053 3300005331 Bacteria 1659
20 Ga0070670_100311192 3300005331 Bacteria 1379
21 Ga0070670_100554735 3300005331 Bacteria 1025
22 Ga0070677_10007977 3300005333 Bacteria 3546
23 Ga0070677_10010613 3300005333 Bacteria 3154
24 Ga0070677_10317088 3300005333 Bacteria 797
25 Ga0068869_100016003 3300005334 Bacteria 5048
26 Ga0068869_100048829 3300005334 Bacteria 3062
27 Ga0070666_10039147 3300005335 Bacteria 3158
28 Ga0070666_10178345 3300005335 Bacteria 1489
29 Ga0070666_10191733 3300005335 Bacteria 1436
30 Ga0070666_10339338 3300005335 Bacteria 1074
31 Ga0070666_10595033 3300005335 Bacteria 807
32 Ga0070680_100211770 3300005336 Unclassified 1635
33 Ga0068868_100004008 3300005338 Bacteria 10284
34 Ga0068868_100055664 3300005338 Bacteria 3122
35 Ga0068868_100337892 3300005338 Bacteria 1287
36 Ga0068868_100569213 3300005338 Bacteria 1000
37 Ga0070660_100152853 3300005339 Bacteria 1856
38 Ga0070689_100107026 3300005340 Bacteria 2220
39 Ga0070689_100511646 3300005340 Bacteria 1030
40 Ga0070687_100050042 3300005343 Bacteria 2156
41 Ga0070661_100007213 3300005344 Bacteria 7662
42 Ga0070692_10109577 3300005345 Bacteria 1525
43 Ga0070668_100028220 3300005347 Bacteria 4261
44 Ga0070668_100363978 3300005347 Bacteria 1227
45 Ga0070669_100021630 3300005353 Bacteria 4597
46 Ga0070669_100159712 3300005353 Bacteria 1751
47 Ga0070675_100000457 3300005354 Bacteria 27848
48 Ga0070675_100000954 3300005354 Bacteria 20626
49 Ga0070675_100011573 3300005354 Bacteria 6910
50 Ga0070675_100028075 3300005354 Bacteria 4527
51 Ga0070675_100037255 3300005354 Bacteria 3961
52 Ga0070671_100003567 3300005355 Bacteria 12171
53 Ga0070671_100334037 3300005355 Bacteria 1292
54 Ga0070674_100001732 3300005356 Bacteria 11819
55 Ga0070674_100045712 3300005356 Bacteria 2992
56 Ga0070674_100072597 3300005356 Bacteria 2437
57 Ga0070674_100192586 3300005356 Bacteria 1569
58 Ga0070674_100368525 3300005356 Bacteria 1165
59 Ga0070673_100030143 3300005364 Bacteria 4054
60 Ga0070673_100129049 3300005364 Bacteria 2119
61 Ga0070673_100211162 3300005364 Bacteria 1676
62 Ga0070673_100232952 3300005364 Bacteria 1598
63 Ga0070688_100030660 3300005365 Bacteria 3229
64 Ga0070688_100076824 3300005365 Bacteria 2150
65 Ga0070659_100226035 3300005366 Bacteria 1546
66 Ga0070667_100010164 3300005367 Bacteria 7780
67 Ga0070709_10053725 3300005434 Bacteria 2537
68 Ga0070714_100268877 3300005435 Bacteria 1580
69 Ga0070714_100296450 3300005435 Bacteria 1506
70 Ga0070713_100048958 3300005436 Bacteria 3484
71 Ga0070710_10022770 3300005437 Bacteria 3283
72 Ga0070701_10170171 3300005438 Bacteria 1268
73 Ga0070701_10299103 3300005438 Bacteria 989
74 Ga0070711_100156144 3300005439 Bacteria 1725
75 Ga0070711_100230790 3300005439 Bacteria 1443
76 Ga0070700_100188074 3300005441 Bacteria 1442
77 Ga0070694_100337673 3300005444 Bacteria 1164
78 Ga0070708_100085595 3300005445 Bacteria 2861
79 Ga0070663_100234344 3300005455 Bacteria 1447
80 Ga0070663_100716428 3300005455 Bacteria 852
81 Ga0070678_100091956 3300005456 Bacteria 2330
82 Ga0070678_100193893 3300005456 Bacteria 1672
83 Ga0070678_100346179 3300005456 Bacteria 1276
84 Ga0070678_100361342 3300005456 Bacteria 1251
85 Ga0070662_100032019 3300005457 Bacteria 3695
86 Ga0070662_100142501 3300005457 Bacteria 1859
87 Ga0070662_100924957 3300005457 Bacteria 745
88 Ga0070681_10063783 3300005458 Bacteria 3656
89 Ga0070681_10066495 3300005458 Bacteria 3573
90 Ga0070681_10076530 3300005458 Unclassified 3304
91 Ga0070681_10146206 3300005458 Bacteria 2293
92 Ga0070681_10395788 3300005458 Unclassified 1292
93 Ga0068867_100152637 3300005459 Bacteria 1816
94 Ga0070685_10000630 3300005466 Bacteria 19290
95 Ga0070685_10048911 3300005466 Bacteria 2437
96 Ga0070685_10057218 3300005466 Bacteria 2269
97 Ga0070706_100073804 3300005467 Bacteria 3158
98 Ga0070706_100164898 3300005467 Bacteria 2069
99 Ga0070707_100048450 3300005468 Bacteria 4070
100 Ga0070707_100521257 3300005468 Bacteria 1150
101 Ga0070699_100073460 3300005518 Bacteria 2975
102 Ga0070699_100170452 3300005518 Bacteria 1929
103 Ga0070679_100289478 3300005530 Bacteria 1589
104 Ga0070679_100810043 3300005530 Bacteria 880
105 Ga0070684_100002298 3300005535 Bacteria 14096
106 Ga0070684_100631466 3300005535 Bacteria 996
107 Ga0070697_100100133 3300005536 Bacteria 2406
108 Ga0068853_100196490 3300005539 Bacteria 1835
109 Ga0068853_100282868 3300005539 Bacteria 1529
110 Ga0068853_100376665 3300005539 Unclassified 1325
111 Ga0070672_100015648 3300005543 Bacteria 5411
112 Ga0070672_100047204 3300005543 Bacteria 3341
113 Ga0070672_100089237 3300005543 Bacteria 2484
114 Ga0070672_100198297 3300005543 Bacteria 1678
115 Ga0070686_100000970 3300005544 Bacteria 16533
116 Ga0070686_100103022 3300005544 Bacteria 1931
117 Ga0070686_100123794 3300005544 Bacteria 1779
118 Ga0070695_100514379 3300005545 Bacteria 928
119 Ga0070696_100293183 3300005546 Bacteria 1243
120 Ga0070693_100023538 3300005547 Bacteria 3293
121 Ga0070693_100392445 3300005547 Bacteria 960
122 Ga0070665_100010538 3300005548 Bacteria 9355
123 Ga0070665_100018511 3300005548 Bacteria 6980
124 Ga0070665_100255485 3300005548 Bacteria 1753
125 Ga0070665_100405788 3300005548 Bacteria 1371
126 Ga0070665_101106831 3300005548 Bacteria 804
127 Ga0070704_100341679 3300005549 Bacteria 1261
128 Ga0068855_100579099 3300005563 Bacteria 1212
129 Ga0070664_100007175 3300005564 Bacteria 8982
130 Ga0070664_100016282 3300005564 Bacteria 6094
131 Ga0070664_100372278 3300005564 Bacteria 1302
132 Ga0068857_100047572 3300005577 Bacteria 3808
133 Ga0068857_100122941 3300005577 Bacteria 2338
134 Ga0068854_100085473 3300005578 Bacteria 2336
135 Ga0068854_100213561 3300005578 Bacteria 1523
136 Ga0068856_100015648 3300005614 Bacteria 7333
137 Ga0068856_100095377 3300005614 Bacteria 2963
138 Ga0068856_100650589 3300005614 Bacteria 1075
139 Ga0070702_100095390 3300005615 Bacteria 1813
140 Ga0070702_100097044 3300005615 Bacteria 1800
141 Ga0070702_100360438 3300005615 Bacteria 1027
142 Ga0068859_100091814 3300005617 Bacteria 3087
143 Ga0068859_100385987 3300005617 Bacteria 1496
144 Ga0068859_100395764 3300005617 Bacteria 1477
145 Ga0068859_100495122 3300005617 Bacteria 1317
146 Ga0068859_100683884 3300005617 Bacteria 1117
147 Ga0068864_100069957 3300005618 Bacteria 3053
148 Ga0068861_100119057 3300005719 Bacteria 2128
149 Ga0068861_100206736 3300005719 Bacteria 1651
150 Ga0068861_100698007 3300005719 Bacteria 943
151 Ga0068861_101079147 3300005719 Bacteria 771
152 Ga0068851_10096381 3300005834 Bacteria 1564
153 Ga0068851_10236254 3300005834 Bacteria 1032
154 Ga0068870_10027628 3300005840 Bacteria 2840
155 Ga0068870_10096227 3300005840 Bacteria 1664
156 Ga0068863_100370242 3300005841 Bacteria 1398
157 Ga0068858_100050353 3300005842 Bacteria 3855
158 Ga0068858_100067317 3300005842 Bacteria 3317
159 Ga0068858_100171613 3300005842 Bacteria 2045
160 Ga0068858_100270457 3300005842 Bacteria 1617
161 Ga0068860_100202263 3300005843 Bacteria 1925
162 Ga0068860_100734990 3300005843 Bacteria 998
163 Ga0068860_100977624 3300005843 Bacteria 864
164 Ga0068862_100054518 3300005844 Bacteria 3423
165 Ga0068862_100186770 3300005844 Bacteria 1863
166 Ga0068862_100299954 3300005844 Bacteria 1478
167 Ga0081455_10100595 3300005937 Bacteria 2322
168 Ga0081540_1130433 3300005983 Bacteria 1027
169 Ga0081539_10022420 3300005985 Bacteria 4178
170 Ga0075366_10250112 3300006195 Bacteria 1081
171 Ga0097621_100009332 3300006237 Bacteria 7122
172 Ga0097621_100012191 3300006237 Bacteria 6360
173 Ga0097621_100041683 3300006237 Bacteria 3696
174 Ga0097621_100192430 3300006237 Bacteria 1767
175 Ga0097621_100256874 3300006237 Bacteria 1532
176 Ga0068871_100021617 3300006358 Bacteria 4948
177 Ga0068871_100062261 3300006358 Bacteria 3049
178 Ga0068871_100096352 3300006358 Unclassified 2472
179 Ga0068871_100172004 3300006358 Bacteria 1857
180 Ga0068871_100225243 3300006358 Bacteria 1626
181 Ga0068871_100299423 3300006358 Bacteria 1411
182 Ga0068871_100387640 3300006358 Bacteria 1242
183 Ga0068871_100495960 3300006358 Bacteria 1100
184 Ga0075428_100022982 3300006844 Bacteria 6901
185 Ga0075428_100192762 3300006844 Bacteria 2204
186 Ga0075428_100667045 3300006844 Bacteria 1108
187 Ga0075428_101000810 3300006844 Bacteria 885
188 Ga0075430_100003765 3300006846 Bacteria 12753
189 Ga0075430_100091860 3300006846 Bacteria 2538
190 Ga0075430_100125070 3300006846 Bacteria 2143
191 Ga0075430_100316515 3300006846 Bacteria 1290
192 Ga0075431_100005364 3300006847 Bacteria 12654
193 Ga0075431_100006210 3300006847 Bacteria 11865
194 Ga0075431_100147277 3300006847 Bacteria 2426
195 Ga0075431_100517089 3300006847 Bacteria 1183
196 Ga0075433_10081273 3300006852 Bacteria 2857
197 Ga0075434_100010536 3300006871 Bacteria 8673
198 Ga0075434_100335192 3300006871 Bacteria 1533
199 Ga0075429_100055124 3300006880 Bacteria 3459
200 Ga0075429_100122863 3300006880 Bacteria 2270
201 Ga0068865_100038397 3300006881 Bacteria 3241
202 Ga0068865_100176139 3300006881 Bacteria 1644
203 Ga0097620_100091806 3300006931 Bacteria 3087
204 Ga0097620_100386016 3300006931 Bacteria 1496
205 Ga0097620_100395796 3300006931 Bacteria 1477
206 Ga0097620_100495131 3300006931 Bacteria 1317
207 Ga0097620_100683895 3300006931 Bacteria 1117
208 Ga0075435_100015696 3300007076 Bacteria 5698
209 Ga0099794_10024283 3300007265 Bacteria 2781
210 Ga0099795_10037141 3300007788 Bacteria 1713
211 Ga0105244_10115663 3300009036 Bacteria 1302
212 Ga0105240_10147440 3300009093 Bacteria 2806
213 Ga0105240_10234289 3300009093 Bacteria 2132
214 Ga0105240_10384754 3300009093 Bacteria 1583
215 Ga0111539_10046485 3300009094 Bacteria 5191
216 Ga0111539_10104399 3300009094 Bacteria 3325
217 Ga0111539_10142521 3300009094 Bacteria 2805
218 Ga0111539_10310542 3300009094 Bacteria 1835
219 Ga0111539_10705653 3300009094 Bacteria 1174
220 Ga0111539_10728133 3300009094 Bacteria 1155
221 Ga0105245_10141633 3300009098 Bacteria 2265
222 Ga0105245_10161489 3300009098 Bacteria 2127
223 Ga0105245_10335814 3300009098 Bacteria 1493
224 Ga0105245_10613613 3300009098 Bacteria 1115
225 Ga0105247_10130198 3300009101 Bacteria 1639
226 Ga0114129_10014770 3300009147 Bacteria 11125
227 Ga0114129_10053353 3300009147 Bacteria 5670
228 Ga0114129_10399552 3300009147 Bacteria 1811
229 Ga0114129_11609202 3300009147 Bacteria 795
230 Ga0105241_10032894 3300009174 Bacteria 3890
231 Ga0105241_10103324 3300009174 Bacteria 2269
232 Ga0105242_10006322 3300009176 Bacteria 9125
233 Ga0105242_10015529 3300009176 Bacteria 5916
234 Ga0105242_10204150 3300009176 Bacteria 1757
235 Ga0105242_11501246 3300009176 Bacteria 705
236 Ga0105248_10006922 3300009177 Bacteria 12426
237 Ga0105248_10009902 3300009177 Bacteria 10494
238 Ga0105248_10023782 3300009177 Bacteria 6809
239 Ga0105248_10030862 3300009177 Bacteria 5987
240 Ga0105248_10035043 3300009177 Bacteria 5615
241 Ga0105248_10055941 3300009177 Bacteria 4426
242 Ga0105248_10701534 3300009177 Bacteria 1142
243 Ga0105248_11269339 3300009177 Bacteria 833
244 Ga0105237_10011152 3300009545 Bacteria 9529
245 Ga0105237_10103255 3300009545 Bacteria 2842
246 Ga0105237_10107452 3300009545 Bacteria 2782
247 Ga0105237_10524618 3300009545 Bacteria 1191
248 Ga0105238_10252200 3300009551 Unclassified 1743
249 Ga0105238_10257095 3300009551 Bacteria 1726
250 Ga0105238_10531582 3300009551 Bacteria 1179
251 Ga0105249_10207004 3300009553 Bacteria 1923
252 Ga0105249_10227463 3300009553 Bacteria 1838
253 Ga0105249_11192875 3300009553 Bacteria 832
254 Ga0099796_10027933 3300010159 Bacteria 1807
255 Ga0105246_10077667 3300011119 Unclassified 2356
256 Ga0157373_10130604 3300013100 Bacteria 1767
257 Ga0157370_10020122 3300013104 Bacteria 6673
258 Ga0157370_10436513 3300013104 Bacteria 1204
259 Ga0157370_10666123 3300013104 Unclassified 951
260 Ga0157369_10674407 3300013105 Bacteria 1065
261 Ga0157374_10063753 3300013296 Bacteria 3457
262 Ga0157374_10992097 3300013296 Bacteria 859
263 Ga0157378_10031782 3300013297 Bacteria 4663
264 Ga0163162_10000247 3300013306 Bacteria 48957
265 Ga0163162_10022968 3300013306 Bacteria 6152
266 Ga0163162_10051648 3300013306 Bacteria 4125
267 Ga0163162_10257003 3300013306 Bacteria 1878
268 Ga0163162_10462451 3300013306 Bacteria 1400
269 Ga0163162_10541306 3300013306 Bacteria 1293
270 Ga0163162_10875367 3300013306 Bacteria 1012
271 Ga0157372_10369497 3300013307 Bacteria 1671
272 Ga0157372_10452679 3300013307 Bacteria 1496
273 Ga0157375_10211992 3300013308 Bacteria 2094
274 Ga0157375_10362740 3300013308 Bacteria 1615
275 Ga0157375_10983426 3300013308 Bacteria 984
276 Ga0157380_10058798 3300014326 Bacteria 3066
277 Ga0157380_10084734 3300014326 Bacteria 2599
278 Ga0157380_10156070 3300014326 Bacteria 1978
279 Ga0157380_10742924 3300014326 Bacteria 992
280 Ga0157377_10010138 3300014745 Bacteria 4649
281 Ga0157377_10514545 3300014745 Bacteria 839
282 Ga0157379_10052237 3300014968 Bacteria 3651
283 Ga0157379_10379598 3300014968 Bacteria 1297
284 Ga0157379_11101039 3300014968 Bacteria 761
285 Ga0157376_10062421 3300014969 Bacteria 3135
286 Ga0157376_10064775 3300014969 Unclassified 3083
287 Ga0157376_10113325 3300014969 Bacteria 2391
288 Ga0157376_10199962 3300014969 Bacteria 1838
289 Ga0157376_10204710 3300014969 Bacteria 1818
290 Ga0157376_10437000 3300014969 Bacteria 1273
291 Ga0163161_10009406 3300017792 Bacteria 6764
292 Ga0197907_10509953 3300020069 Bacteria 1387
293 Ga0224712_10066905 3300022467 Bacteria 1448
294 Ga0209051_1003284 3300025303 Bacteria 10725
295 Ga0207697_10004748 3300025315 Bacteria 6436
296 Ga0207697_10028656 3300025315 Bacteria 2278
297 Ga0207697_10184941 3300025315 Bacteria 914
298 Ga0207697_10198220 3300025315 Bacteria 883
299 Ga0207653_10170542 3300025885 Bacteria 810
300 Ga0207692_10058941 3300025898 Bacteria 1980
301 Ga0207642_10032199 3300025899 Bacteria 2205
302 Ga0207688_10001716 3300025901 Bacteria 11624
303 Ga0207688_10040367 3300025901 Bacteria 2593
304 Ga0207680_10010291 3300025903 Bacteria 4674
305 Ga0207680_10146838 3300025903 Bacteria 1569
306 Ga0207680_10169644 3300025903 Bacteria 1469
307 Ga0207680_10257118 3300025903 Bacteria 1208
308 Ga0207680_10491119 3300025903 Bacteria 874
309 Ga0207647_10173682 3300025904 Bacteria 1254
310 Ga0207685_10056448 3300025905 Bacteria 1537
311 Ga0207645_10044415 3300025907 Bacteria 2844
312 Ga0207645_10111781 3300025907 Bacteria 1769
313 Ga0207643_10000841 3300025908 Bacteria 18619
314 Ga0207643_10056337 3300025908 Bacteria 2236
315 Ga0207705_10204130 3300025909 Bacteria 1498
316 Ga0207684_10084411 3300025910 Unclassified 2705
317 Ga0207654_10027669 3300025911 Bacteria 3083
318 Ga0207707_10295336 3300025912 Bacteria 1402
319 Ga0207695_10003044 3300025913 Bacteria 24027
320 Ga0207695_10472843 3300025913 Bacteria 1136
321 Ga0207671_10031176 3300025914 Bacteria 3973
322 Ga0207671_10556031 3300025914 Bacteria 915
323 Ga0207663_10150153 3300025916 Bacteria 1634
324 Ga0207663_10219860 3300025916 Bacteria 1381
325 Ga0207663_10558222 3300025916 Bacteria 896
326 Ga0207660_10308670 3300025917 Unclassified 1261
327 Ga0207662_10006176 3300025918 Bacteria 6448
328 Ga0207662_10082228 3300025918 Bacteria 1967
329 Ga0207657_10008309 3300025919 Bacteria 10562
330 Ga0207657_10428733 3300025919 Bacteria 1039
331 Ga0207657_10568357 3300025919 Bacteria 886
332 Ga0207649_10387991 3300025920 Unclassified 1042
333 Ga0207652_10596439 3300025921 Bacteria 991
334 Ga0207646_10055546 3300025922 Bacteria 3540
335 Ga0207681_10221040 3300025923 Bacteria 1465
336 Ga0207681_10360119 3300025923 Bacteria 1166
337 Ga0207694_10010739 3300025924 Bacteria 6916
338 Ga0207694_10012164 3300025924 Bacteria 6490
339 Ga0207694_10106991 3300025924 Unclassified 2222
340 Ga0207694_10356433 3300025924 Unclassified 1211
341 Ga0207650_10006077 3300025925 Bacteria 8235
342 Ga0207650_10023602 3300025925 Bacteria 4364
343 Ga0207650_10106136 3300025925 Bacteria 2169
344 Ga0207650_10457295 3300025925 Bacteria 1063
345 Ga0207650_10719637 3300025925 Bacteria 844
346 Ga0207659_10012767 3300025926 Bacteria 5362
347 Ga0207659_10046561 3300025926 Bacteria 3064
348 Ga0207659_10062748 3300025926 Bacteria 2683
349 Ga0207659_10881305 3300025926 Unclassified 769
350 Ga0207687_10731800 3300025927 Bacteria 841
351 Ga0207664_10144543 3300025929 Bacteria 2016
352 Ga0207644_10012902 3300025931 Bacteria 5555
353 Ga0207644_10061858 3300025931 Bacteria 2713
354 Ga0207706_10034306 3300025933 Bacteria 4515
355 Ga0207706_10040459 3300025933 Bacteria 4131
356 Ga0207706_10176926 3300025933 Bacteria 1874
357 Ga0207706_10246320 3300025933 Bacteria 1562
358 Ga0207706_10358638 3300025933 Bacteria 1267
359 Ga0207706_10522258 3300025933 Bacteria 1024
360 Ga0207686_10013792 3300025934 Bacteria 4483
361 Ga0207670_10098864 3300025936 Bacteria 2080
362 Ga0207669_10002787 3300025937 Bacteria 7493
363 Ga0207669_10202070 3300025937 Bacteria 1443
364 Ga0207704_10011919 3300025938 Bacteria 4299
365 Ga0207704_10160260 3300025938 Bacteria 1600
366 Ga0207691_10008817 3300025940 Bacteria 9675
367 Ga0207691_10021141 3300025940 Bacteria 6149
368 Ga0207691_10043061 3300025940 Bacteria 4161
369 Ga0207691_10045300 3300025940 Bacteria 4044
370 Ga0207691_10212473 3300025940 Bacteria 1680
371 Ga0207711_10003614 3300025941 Bacteria 13374
372 Ga0207711_10025458 3300025941 Bacteria 4964
373 Ga0207711_10031730 3300025941 Bacteria 4462
374 Ga0207711_10046366 3300025941 Bacteria 3713
375 Ga0207711_10078290 3300025941 Bacteria 2884
376 Ga0207711_10664442 3300025941 Bacteria 972
377 Ga0207689_10017101 3300025942 Bacteria 6138
378 Ga0207689_10102797 3300025942 Bacteria 2348
379 Ga0207661_10484362 3300025944 Bacteria 1129
380 Ga0207679_10014494 3300025945 Bacteria 5186
381 Ga0207667_10015759 3300025949 Bacteria 8571
382 Ga0207651_10081678 3300025960 Bacteria 2330
383 Ga0207651_10202016 3300025960 Bacteria 1593
384 Ga0207651_10250379 3300025960 Bacteria 1449
385 Ga0207651_10278636 3300025960 Bacteria 1381
386 Ga0207651_10431690 3300025960 Bacteria 1127
387 Ga0207712_10055401 3300025961 Bacteria 2789
388 Ga0207668_10067351 3300025972 Bacteria 2542
389 Ga0207668_10151811 3300025972 Bacteria 1794
390 Ga0207668_10469029 3300025972 Bacteria 1078
391 Ga0207640_10039017 3300025981 Bacteria 3002
392 Ga0207640_10093160 3300025981 Bacteria 2092
393 Ga0207658_10059588 3300025986 Bacteria 2845
394 Ga0207658_10501565 3300025986 Bacteria 1081
395 Ga0207677_10011863 3300026023 Bacteria 4987
396 Ga0207677_10133679 3300026023 Bacteria 1888
397 Ga0207703_10155140 3300026035 Bacteria 2000
398 Ga0207703_10165062 3300026035 Bacteria 1942
399 Ga0207703_10370743 3300026035 Bacteria 1322
400 Ga0207639_10179133 3300026041 Bacteria 1802
401 Ga0207639_10253758 3300026041 Unclassified 1535
402 Ga0207639_10376440 3300026041 Bacteria 1274
403 Ga0207678_10309097 3300026067 Bacteria 1359
404 Ga0207708_10037265 3300026075 Bacteria 3704
405 Ga0207708_10106685 3300026075 Unclassified 2172
406 Ga0207702_10013022 3300026078 Bacteria 6918
407 Ga0207702_10273207 3300026078 Bacteria 1595
408 Ga0207641_10003015 3300026088 Bacteria 15204
409 Ga0207641_10084297 3300026088 Bacteria 2766
410 Ga0207641_10343543 3300026088 Bacteria 1421
411 Ga0207641_10366342 3300026088 Bacteria 1377
412 Ga0207648_10013509 3300026089 Bacteria 7595
413 Ga0207648_10042857 3300026089 Bacteria 3974
414 Ga0207676_10074978 3300026095 Bacteria 2728
415 Ga0207676_10166261 3300026095 Bacteria 1917
416 Ga0207676_10617580 3300026095 Bacteria 1043
417 Ga0207674_10087321 3300026116 Bacteria 3112
418 Ga0207674_10111942 3300026116 Bacteria 2704
419 Ga0207674_10185993 3300026116 Bacteria 2028
420 Ga0207675_100004111 3300026118 Bacteria 14082
421 Ga0207675_100030019 3300026118 Bacteria 5061
422 Ga0207675_100234571 3300026118 Bacteria 1771
423 Ga0207675_100255228 3300026118 Bacteria 1698
424 Ga0207675_100277222 3300026118 Bacteria 1628
425 Ga0207675_100449663 3300026118 Bacteria 1276
426 Ga0207675_100693729 3300026118 Bacteria 1027
427 Ga0207683_10015175 3300026121 Bacteria 6555
428 Ga0207683_10101656 3300026121 Bacteria 2567
429 Ga0207683_10122554 3300026121 Bacteria 2335
430 Ga0207683_10257303 3300026121 Bacteria 1594
431 Ga0207683_10331492 3300026121 Bacteria 1395
432 Ga0207683_10359214 3300026121 Bacteria 1338
433 Ga0207428_10068488 3300027907 Bacteria 2791
434 Ga0268266_10049853 3300028379 Bacteria 3591
435 Ga0268266_10103584 3300028379 Bacteria 2511
436 Ga0268266_10886994 3300028379 Bacteria 862
437 Ga0268265_10628854 3300028380 Bacteria 1029
438 Ga0268264_10016080 3300028381 Bacteria 6131
439 Ga0268264_10168929 3300028381 Bacteria 1976
440 Ga0268264_10900281 3300028381 Bacteria 888
441 Ga0265337_1066381 3300028556 Bacteria 995
442 Ga0265334_10026961 3300028573 Bacteria 2316
443 Ga0265323_10029659 3300028653 Bacteria 2044
444 Ga0265330_10044498 3300031235 Bacteria 1959
445 Ga0265339_10054078 3300031249 Bacteria 2182
446 Ga0265316_10137642 3300031344 Bacteria 1836
447 Ga0265342_10250614 3300031712 Bacteria 945
448 Ga0307412_10084135 3300031911 Bacteria 2208
449 Ga0307409_100385926 3300031995 Bacteria 1333
450 Ga0307416_100915579 3300032002 Bacteria 977
451 Ga0307411_10241535 3300032005 Bacteria 1414
452 Ga0373950_0010470 3300034818 Bacteria 1498
453 Ga0373958_0010774 3300034819 Bacteria 1531
454 Ga0373959_0001097 3300034820 Bacteria 4432
455 Ga0373938_0002012 3300034957 Bacteria 3255
456 Ga0373938_0022410 3300034957 Bacteria 1290
457 Ga0373929_0031868 3300035085 Bacteria 1131
458 Ga0373934_0040329 3300035086 Bacteria 1841
459 Ga0373934_0085773 3300035086 Bacteria 1267
460 Ga0373940_0001150 3300035088 Bacteria 4630
461 Ga0373940_0146359 3300035088 Bacteria 750
462 Ga0373949_0004491 3300035090 Bacteria 3193
463 Ga0373951_0041259 3300035091 Bacteria 1114
464 Ga0373952_0005553 3300035092 Bacteria 2309
465 Ga0373923_0059570 3300035111 Bacteria 1619
466 Ga0373932_0008028 3300035112 Bacteria 2518
467 Ga0373936_0083400 3300035113 Bacteria 1333
468 Ga0373939_0006814 3300035114 Bacteria 2760
469 Ga0373945_0084755 3300035116 Bacteria 1219
470 Ga0373956_0100633 3300035119 Bacteria 1340
471 Ga0373960_0001408 3300035121 Bacteria 5327
472 Ga0373946_0006124 3300035171 Bacteria 4357
473 Ga0373955_0062491 3300035172 Bacteria 2060
474 Ga0373955_0073523 3300035172 Bacteria 1916
475 Ga0373955_0163055 3300035172 Bacteria 1317
476 Ga0373961_0001952 3300035241 Bacteria 5586
477 Ga0373962_0007204 3300035242 Bacteria 2720
478 Ga0373931_0002762 3300035691 Bacteria 7811
479 Ga0373931_0362403 3300035691 Bacteria 910
480 Ga0373935_0397406 3300035692 Bacteria 989
481 Ga0373933_0530983 3300035724 Bacteria 771
482 Ga0373947_0063248 3300035725 Bacteria 2254
483 Ga0373937_0011909 3300036401 Bacteria 7633
484 Ga0316582_0142582 3300036647 Bacteria 1616
485 Ga0373925_0186982 3300037068 Bacteria 1642
486 Ga0395905_0891317 3300037471 Bacteria 793
487 Ga0439464_0017577 3300042439 Bacteria 1941
488 Ga0439464_0074856 3300042439 Bacteria 1005
489 Ga0451576_0061552 3300045051 Unclassified 3914
490 Ga0451576_0272439 3300045051 Bacteria 1769
491 Ga0495592_0181994 3300046454 Bacteria 1431
492 Ga0495603_0093733 3300046455 Bacteria 1755
493 Ga0495629_0384152 3300046459 Bacteria 955
494 Ga0495651_0000580 3300046462 Bacteria 28404
495 Ga0495651_0231841 3300046462 Bacteria 1271
496 Ga0495628_0192794 3300046516 Bacteria 1538
497 Ga0495630_0037450 3300046517 Bacteria 3627
498 Ga0495652_0160122 3300046529 Unclassified 1749
499 Ga0495598_0040969 3300046537 Bacteria 1353
500 Ga0495621_0049026 3300046539 Bacteria 1506
501 Ga0495633_0101040 3300046558 Bacteria 1339
502 Ga0495667_0003340 3300046559 Bacteria 10745
503 Ga0495656_0015596 3300046615 Bacteria 2871
504 Ga0495634_0005175 3300046642 Bacteria 10077
505 Ga0495635_0559745 3300046663 Bacteria 749
506 Ga0495659_0086915 3300046664 Bacteria 1195
507 Ga0495599_0243059 3300046678 Bacteria 1097
508 Ga0495647_0012622 3300046681 Bacteria 2913
509 Ga0495613_0055898 3300046689 Bacteria 2899
510 Ga0495600_0175609 3300046809 Bacteria 1381
511 Ga0495600_0349195 3300046809 Bacteria 927
512 Ga0495674_0000853 3300047319 Bacteria 29112
513 Ga0495674_0507533 3300047319 Bacteria 964
514 Ga0495680_0000568 3300047322 Bacteria 41591
515 Ga0495680_0077376 3300047322 Bacteria 2520
516 Ga0495675_0015061 3300047444 Unclassified 4891
517 Ga0495602_0348295 3300048088 Bacteria 1070
518 Ga0496100_0008205 3300048903 Bacteria 5816
519 Ga0496100_0025184 3300048903 Bacteria 3637
520 Ga0496100_0102986 3300048903 Bacteria 1970
521 Ga0496101_0000588 3300048904 Bacteria 22146
522 Ga0496101_0406412 3300048904 Bacteria 1072
523 Ga0496102_0011157 3300048905 Bacteria 7737
524 Ga0496102_0409766 3300048905 Bacteria 1273
525 Ga0496103_0005302 3300048906 Bacteria 7737
526 Ga0496104_0011653 3300048907 Bacteria 7882
527 Ga0496104_0062587 3300048907 Bacteria 3528
528 Ga0496104_0132345 3300048907 Bacteria 2396
529 Ga0496104_0345500 3300048907 Bacteria 1401
530 Ga0496105_0162795 3300048908 Bacteria 1831
531 Ga0496106_0002854 3300048909 Bacteria 12837
532 Ga0496106_0217397 3300048909 Bacteria 1523
533 Ga0496106_0463464 3300048909 Bacteria 1018
534 Ga0496106_0679734 3300048909 Bacteria 821
535 Ga0496107_0005055 3300048910 Bacteria 8993
536 Ga0496107_0056587 3300048910 Bacteria 2834
537 Ga0496107_0451293 3300048910 Bacteria 955
538 Ga0496107_0468635 3300048910 Bacteria 935
539 Ga0496107_0519635 3300048910 Bacteria 883
540 Ga0496107_0534032 3300048910 Bacteria 869
541 Ga0496108_0123019 3300048911 Bacteria 2226
542 Ga0496108_0277258 3300048911 Bacteria 1460
543 Ga0496108_0821114 3300048911 Bacteria 801
544 Ga0496109_0004945 3300048912 Bacteria 11127
545 Ga0496109_0023682 3300048912 Bacteria 5451
546 Ga0496109_0103483 3300048912 Bacteria 2643
547 Ga0496109_0227179 3300048912 Bacteria 1756
548 Ga0496109_0283189 3300048912 Bacteria 1562
549 Ga0496110_0003517 3300048913 Bacteria 12021
550 Ga0496110_0040839 3300048913 Bacteria 4044
551 Ga0496110_0155723 3300048913 Bacteria 2070
552 Ga0496110_0427383 3300048913 Bacteria 1208
553 Ga0496110_0508344 3300048913 Bacteria 1096
554 Ga0496110_0518990 3300048913 Bacteria 1084
555 Ga0496111_0035800 3300048914 Bacteria 3549
556 Ga0496111_0057591 3300048914 Bacteria 2813
557 Ga0496111_0116377 3300048914 Bacteria 1971
558 Ga0496111_0476305 3300048914 Bacteria 920
559 Ga0496112_0015730 3300048915 Bacteria 7067
560 Ga0496112_0547176 3300048915 Bacteria 1091
561 Ga0496114_0000669 3300048917 Bacteria 25425
562 Ga0496114_0009157 3300048917 Bacteria 7851
563 Ga0496114_0014814 3300048917 Bacteria 6266
564 Ga0496114_0255963 3300048917 Bacteria 1541
565 Ga0496119_0112833 3300048922 Bacteria 1506
566 Ga0496121_0445167 3300048924 Bacteria 836
567 Ga0496122_0048170 3300048925 Bacteria 3281
568 Ga0501031_0000683 3300049568 Bacteria 20253
569 Ga0501032_0000291 3300049569 Bacteria 42013
570 Ga0501032_0139083 3300049569 Bacteria 1599
571 Ga0501033_0006274 3300049570 Bacteria 9321
572 Ga0501034_0003908 3300049571 Bacteria 16740
573 Ga0501034_0504396 3300049571 Bacteria 1123
574 Ga0501036_0001130 3300049572 Bacteria 20310
575 Ga0501036_0409351 3300049572 Unclassified 1131
576 Ga0501037_0000280 3300049573 Bacteria 43512
577 Ga0501037_0002250 3300049573 Bacteria 13949
578 Ga0501038_0000883 3300049574 Bacteria 26567
579 Ga0501038_0014572 3300049574 Bacteria 7166
580 Ga0501038_0119553 3300049574 Bacteria 2175
581 Ga0501038_0397307 3300049574 Bacteria 1067
582 Ga0501039_0000382 3300049575 Bacteria 31795
583 Ga0501039_0088995 3300049575 Bacteria 2405
584 Ga0501039_0105211 3300049575 Bacteria 2204
585 Ga0501040_0004968 3300049576 Bacteria 8603
586 Ga0501040_0028422 3300049576 Bacteria 3770
587 Ga0501040_0055027 3300049576 Bacteria 2728
588 Ga0501041_0370825 3300049577 Bacteria 905
589 Ga0501042_0354773 3300049578 Bacteria 1061
590 Ga0501043_0009099 3300049579 Bacteria 7811
591 Ga0501043_0044754 3300049579 Bacteria 3480
592 Ga0501043_0146495 3300049579 Bacteria 1849
593 Ga0501043_0346360 3300049579 Bacteria 1129
594 Ga0501046_0000442 3300049580 Bacteria 41660
595 Ga0501046_0087409 3300049580 Bacteria 2402
596 Ga0501046_0131341 3300049580 Bacteria 1899
597 Ga0501047_0002814 3300049581 Bacteria 16515
598 Ga0501047_0007236 3300049581 Bacteria 10431
599 Ga0501047_0303821 3300049581 Bacteria 1437
600 Ga0501048_0001572 3300049582 Bacteria 17352
601 Ga0501048_0051679 3300049582 Bacteria 2925
602 Ga0501048_0318877 3300049582 Bacteria 1107
603 Ga0501067_0036768 3300049583 Bacteria 2718
604 Ga0501068_0015218 3300049584 Bacteria 4415
605 Ga0501068_0259075 3300049584 Bacteria 1109
606 Ga0501068_0297223 3300049584 Unclassified 1033
607 Ga0501069_0000958 3300049585 Bacteria 13759
608 Ga0501070_0003700 3300049586 Bacteria 13210
609 Ga0501070_0030200 3300049586 Bacteria 4541
610 Ga0501070_0276484 3300049586 Bacteria 1370
611 Ga0501072_0034519 3300049588 Bacteria 3965
612 Ga0501072_0057285 3300049588 Bacteria 3071
613 Ga0501073_0008166 3300049589 Bacteria 7764
614 Ga0501074_0000718 3300049590 Bacteria 20753
615 Ga0501074_0078541 3300049590 Unclassified 2368
616 Ga0501074_0565211 3300049590 Bacteria 805
617 Ga0501075_0028717 3300049591 Bacteria 4108
618 Ga0501075_0070786 3300049591 Bacteria 2636
619 Ga0501076_0053189 3300049592 Bacteria 3208
620 Ga0501076_0070255 3300049592 Bacteria 2799
621 Ga0501076_0913936 3300049592 Bacteria 724
622 Ga0501077_0101718 3300049593 Bacteria 1821
623 Ga0501079_0056701 3300049741 Bacteria 3023
624 Ga0501079_0306553 3300049741 Bacteria 1242
625 Ga0501080_0001004 3300049742 Bacteria 23167
626 Ga0501080_0386946 3300049742 Bacteria 1259
627 Ga0501081_0051390 3300049743 Bacteria 2843
628 Ga0501081_0051848 3300049743 Bacteria 2830
629 Ga0501083_0008115 3300049744 Bacteria 7425
630 Ga0501083_0299007 3300049744 Bacteria 1047
631 Ga0501035_0002957 3300049822 Bacteria 16341
632 Ga0501035_0003827 3300049822 Bacteria 14343
633 Ga0501035_0528317 3300049822 Bacteria 968
634 Ga0501044_0002104 3300049823 Bacteria 22907
635 Ga0501044_0398285 3300049823 Bacteria 1289
636 Ga0501044_0731927 3300049823 Bacteria 872
637 Ga0501045_0036310 3300049824 Bacteria 3578
638 Ga0501045_0063127 3300049824 Bacteria 2718
639 Ga0501045_0080533 3300049824 Bacteria 2401
640 nmdc:mga0k408_203329_c1 3300050493 Bacteria 1182
641 nmdc:mga05p37_6795_c1 3300050507 Bacteria 13482
642 nmdc:mga09592_117753_c1 3300050508 Bacteria 2280
643 nmdc:mga09592_41357_c1 3300050508 Bacteria 3876
644 nmdc:mga09592_51472_c1 3300050508 Bacteria 3474
645 nmdc:mga0qj67_64561_c1 3300050509 Bacteria 2912
646 nmdc:mga0qj67_99538_c1 3300050509 Bacteria 2343
647 nmdc:mga06r32_200554_c1 3300050510 Bacteria 1983
648 nmdc:mga06r32_24761_c1 3300050510 Bacteria 5577
649 nmdc:mga06r32_404966_c1 3300050510 Unclassified 1346
650 nmdc:mga06r32_638139_c1 3300050510 Bacteria 1034
651 nmdc:mga06r32_8997_c1 3300050510 Bacteria 8998
652 nmdc:mga08y16_364084_c1 3300050511 Bacteria 1484
653 nmdc:mga08y16_432165_c1 3300050511 Bacteria 1344
654 nmdc:mga08y16_64196_c1 3300050511 Bacteria 3835
655 nmdc:mga0n895_173627_c1 3300050512 Bacteria 2187
656 nmdc:mga0n895_222861_c1 3300050512 Bacteria 1914
657 nmdc:mga0n895_784186_c1 3300050512 Bacteria 944
658 nmdc:mga0n895_82681_c1 3300050512 Bacteria 3201
659 nmdc:mga0rr50_2174_c1 3300050513 Bacteria 10978
660 nmdc:mga0rr50_446276_c1 3300050513 Unclassified 1096
661 nmdc:mga08x19_221436_c1 3300050514 Bacteria 1300
662 nmdc:mga0a205_702467_c1 3300050515 Bacteria 861
663 nmdc:mga0a205_89037_c1 3300050515 Bacteria 2984
664 Ga0495601_0023281 3300053077 Bacteria 3806
665 Ga0495601_0098925 3300053077 Bacteria 1883
666 Ga0495619_0205296 3300053085 Bacteria 1364
667 Ga0495619_0318445 3300053085 Bacteria 1077
668 Ga0501084_0121695 3300054114 Bacteria 2194
669 Ga0501084_0148621 3300054114 Bacteria 1974
670 Ga0590075_000036 3300059424 Bacteria 35258
671 Ga0590077_000618 3300059426 Bacteria 9561
672 Ga0501082_0122796 3300060353 Bacteria 2252
673 Ga0501082_0164096 3300060353 Bacteria 1930
674 Ga0501082_0665445 3300060353 Bacteria 911
675 Ga0530510_0005362 3300061734 Bacteria 8875
676 Ga0530510_0027287 3300061734 Bacteria 4092
677 Ga0530510_0695888 3300061734 Bacteria 774
678 Ga0496125_0125426
679 Ga0055540_1035338
680 Ga0065712_10068679
681 Ga0065712_10085881
682 Ga0065712_10229919
683 Ga0065715_10004798
684 Ga0065715_10043255
685 Ga0065715_10122497
686 Ga0065707_10002575
687 Ga0070676_10094013
688 Ga0070676_10371574
689 Ga0070683_100081576
690 Ga0070683_100154300
691 Ga0070683_100374842
692 Ga0070690_100027653
693 Ga0070670_100016724
694 Ga0070670_100024449
695 Ga0070670_100055228
696 Ga0070670_100218053
697 Ga0070670_100311192
698 Ga0070670_100554735
699 Ga0070677_10007977
700 Ga0070677_10010613
701 Ga0070677_10317088
702 Ga0068869_100016003
703 Ga0068869_100048829
704 Ga0070666_10039147
705 Ga0070666_10178345
706 Ga0070666_10191733
707 Ga0070666_10339338
708 Ga0070666_10595033
709 Ga0070680_100211770
710 Ga0068868_100004008
711 Ga0068868_100055664
712 Ga0068868_100337892
713 Ga0068868_100569213
714 Ga0070660_100152853
715 Ga0070689_100107026
716 Ga0070689_100511646
717 Ga0070687_100050042
718 Ga0070661_100007213
719 Ga0070692_10109577
720 Ga0070668_100028220
721 Ga0070668_100363978
722 Ga0070669_100021630
723 Ga0070669_100159712
724 Ga0070675_100000457
725 Ga0070675_100000954
726 Ga0070675_100011573
727 Ga0070675_100028075
728 Ga0070675_100037255
729 Ga0070671_100003567
730 Ga0070671_100334037
731 Ga0070674_100001732
732 Ga0070674_100045712
733 Ga0070674_100072597
734 Ga0070674_100192586
735 Ga0070674_100368525
736 Ga0070673_100030143
737 Ga0070673_100129049
738 Ga0070673_100211162
739 Ga0070673_100232952
740 Ga0070688_100030660
741 Ga0070688_100076824
742 Ga0070659_100226035
743 Ga0070667_100010164
744 Ga0070709_10053725
745 Ga0070714_100268877
746 Ga0070714_100296450
747 Ga0070713_100048958
748 Ga0070710_10022770
749 Ga0070701_10170171
750 Ga0070701_10299103
751 Ga0070711_100156144
752 Ga0070711_100230790
753 Ga0070700_100188074
754 Ga0070694_100337673
755 Ga0070708_100085595
756 Ga0070663_100234344
757 Ga0070663_100716428
758 Ga0070678_100091956
759 Ga0070678_100193893
760 Ga0070678_100346179
761 Ga0070678_100361342
762 Ga0070662_100032019
763 Ga0070662_100142501
764 Ga0070662_100924957
765 Ga0070681_10063783
766 Ga0070681_10066495
767 Ga0070681_10076530
768 Ga0070681_10146206
769 Ga0070681_10395788
770 Ga0068867_100152637
771 Ga0070685_10000630
772 Ga0070685_10048911
773 Ga0070685_10057218
774 Ga0070706_100073804
775 Ga0070706_100164898
776 Ga0070707_100048450
777 Ga0070707_100521257
778 Ga0070699_100073460
779 Ga0070699_100170452
780 Ga0070679_100289478
781 Ga0070679_100810043
782 Ga0070684_100002298
783 Ga0070684_100631466
784 Ga0070697_100100133
785 Ga0068853_100196490
786 Ga0068853_100282868
787 Ga0068853_100376665
788 Ga0070672_100015648
789 Ga0070672_100047204
790 Ga0070672_100089237
791 Ga0070672_100198297
792 Ga0070686_100000970
793 Ga0070686_100103022
794 Ga0070686_100123794
795 Ga0070695_100514379
796 Ga0070696_100293183
797 Ga0070693_100023538
798 Ga0070693_100392445
799 Ga0070665_100010538
800 Ga0070665_100018511
801 Ga0070665_100255485
802 Ga0070665_100405788
803 Ga0070665_101106831
804 Ga0070704_100341679
805 Ga0068855_100579099
806 Ga0070664_100007175
807 Ga0070664_100016282
808 Ga0070664_100372278
809 Ga0068857_100047572
810 Ga0068857_100122941
811 Ga0068854_100085473
812 Ga0068854_100213561
813 Ga0068856_100015648
814 Ga0068856_100095377
815 Ga0068856_100650589
816 Ga0070702_100095390
817 Ga0070702_100097044
818 Ga0070702_100360438
819 Ga0068859_100091814
820 Ga0068859_100385987
821 Ga0068859_100395764
822 Ga0068859_100495122
823 Ga0068859_100683884
824 Ga0068864_100069957
825 Ga0068861_100119057
826 Ga0068861_100206736
827 Ga0068861_100698007
828 Ga0068861_101079147
829 Ga0068851_10096381
830 Ga0068851_10236254
831 Ga0068870_10027628
832 Ga0068870_10096227
833 Ga0068863_100370242
834 Ga0068858_100050353
835 Ga0068858_100067317
836 Ga0068858_100171613
837 Ga0068858_100270457
838 Ga0068860_100202263
839 Ga0068860_100734990
840 Ga0068860_100977624
841 Ga0068862_100054518
842 Ga0068862_100186770
843 Ga0068862_100299954
844 Ga0081455_10100595
845 Ga0081540_1130433
846 Ga0081539_10022420
847 Ga0075366_10250112
848 Ga0097621_100009332
849 Ga0097621_100012191
850 Ga0097621_100041683
851 Ga0097621_100192430
852 Ga0097621_100256874
853 Ga0068871_100021617
854 Ga0068871_100062261
855 Ga0068871_100096352
856 Ga0068871_100172004
857 Ga0068871_100225243
858 Ga0068871_100299423
859 Ga0068871_100387640
860 Ga0068871_100495960
861 Ga0075428_100022982
862 Ga0075428_100192762
863 Ga0075428_100667045
864 Ga0075428_101000810
865 Ga0075430_100003765
866 Ga0075430_100091860
867 Ga0075430_100125070
868 Ga0075430_100316515
869 Ga0075431_100005364
870 Ga0075431_100006210
871 Ga0075431_100147277
872 Ga0075431_100517089
873 Ga0075433_10081273
874 Ga0075434_100010536
875 Ga0075434_100335192
876 Ga0075429_100055124
877 Ga0075429_100122863
878 Ga0068865_100038397
879 Ga0068865_100176139
880 Ga0097620_100091806
881 Ga0097620_100386016
882 Ga0097620_100395796
883 Ga0097620_100495131
884 Ga0097620_100683895
885 Ga0075435_100015696
886 Ga0099794_10024283
887 Ga0099795_10037141
888 Ga0105244_10115663
889 Ga0105240_10147440
890 Ga0105240_10234289
891 Ga0105240_10384754
892 Ga0111539_10046485
893 Ga0111539_10104399
894 Ga0111539_10142521
895 Ga0111539_10310542
896 Ga0111539_10705653
897 Ga0111539_10728133
898 Ga0105245_10141633
899 Ga0105245_10161489
900 Ga0105245_10335814
901 Ga0105245_10613613
902 Ga0105247_10130198
903 Ga0114129_10014770
904 Ga0114129_10053353
905 Ga0114129_10399552
906 Ga0114129_11609202
907 Ga0105241_10032894
908 Ga0105241_10103324
909 Ga0105242_10006322
910 Ga0105242_10015529
911 Ga0105242_10204150
912 Ga0105242_11501246
913 Ga0105248_10006922
914 Ga0105248_10009902
915 Ga0105248_10023782
916 Ga0105248_10030862
917 Ga0105248_10035043
918 Ga0105248_10055941
919 Ga0105248_10701534
920 Ga0105248_11269339
921 Ga0105237_10011152
922 Ga0105237_10103255
923 Ga0105237_10107452
924 Ga0105237_10524618
925 Ga0105238_10252200
926 Ga0105238_10257095
927 Ga0105238_10531582
928 Ga0105249_10207004
929 Ga0105249_10227463
930 Ga0105249_11192875
931 Ga0099796_10027933
932 Ga0105246_10077667
933 Ga0157373_10130604
934 Ga0157370_10020122
935 Ga0157370_10436513
936 Ga0157370_10666123
937 Ga0157369_10674407
938 Ga0157374_10063753
939 Ga0157374_10992097
940 Ga0157378_10031782
941 Ga0163162_10000247
942 Ga0163162_10022968
943 Ga0163162_10051648
944 Ga0163162_10257003
945 Ga0163162_10462451
946 Ga0163162_10541306
947 Ga0163162_10875367
948 Ga0157372_10369497
949 Ga0157372_10452679
950 Ga0157375_10211992
951 Ga0157375_10362740
952 Ga0157375_10983426
953 Ga0157380_10058798
954 Ga0157380_10084734
955 Ga0157380_10156070
956 Ga0157380_10742924
957 Ga0157377_10010138
958 Ga0157377_10514545
959 Ga0157379_10052237
960 Ga0157379_10379598
961 Ga0157379_11101039
962 Ga0157376_10062421
963 Ga0157376_10064775
964 Ga0157376_10113325
965 Ga0157376_10199962
966 Ga0157376_10204710
967 Ga0157376_10437000
968 Ga0163161_10009406
969 Ga0197907_10509953
970 Ga0224712_10066905
971 Ga0209051_1003284
972 Ga0207697_10004748
973 Ga0207697_10028656
974 Ga0207697_10184941
975 Ga0207697_10198220
976 Ga0207653_10170542
977 Ga0207692_10058941
978 Ga0207642_10032199
979 Ga0207688_10001716
980 Ga0207688_10040367
981 Ga0207680_10010291
982 Ga0207680_10146838
983 Ga0207680_10169644
984 Ga0207680_10257118
985 Ga0207680_10491119
986 Ga0207647_10173682
987 Ga0207685_10056448
988 Ga0207645_10044415
989 Ga0207645_10111781
990 Ga0207643_10000841
991 Ga0207643_10056337
992 Ga0207705_10204130
993 Ga0207684_10084411
994 Ga0207654_10027669
995 Ga0207707_10295336
996 Ga0207695_10003044
997 Ga0207695_10472843
998 Ga0207671_10031176
999 Ga0207671_10556031
1000 Ga0207663_10150153
1001 Ga0207663_10219860
1002 Ga0207663_10558222
1003 Ga0207660_10308670
1004 Ga0207662_10006176
1005 Ga0207662_10082228
1006 Ga0207657_10008309
1007 Ga0207657_10428733
1008 Ga0207657_10568357
1009 Ga0207649_10387991
1010 Ga0207652_10596439
1011 Ga0207646_10055546
1012 Ga0207681_10221040
1013 Ga0207681_10360119
1014 Ga0207694_10010739
1015 Ga0207694_10012164
1016 Ga0207694_10106991
1017 Ga0207694_10356433
1018 Ga0207650_10006077
1019 Ga0207650_10023602
1020 Ga0207650_10106136
1021 Ga0207650_10457295
1022 Ga0207650_10719637
1023 Ga0207659_10012767
1024 Ga0207659_10046561
1025 Ga0207659_10062748
1026 Ga0207659_10881305
1027 Ga0207687_10731800
1028 Ga0207664_10144543
1029 Ga0207644_10012902
1030 Ga0207644_10061858
1031 Ga0207706_10034306
1032 Ga0207706_10040459
1033 Ga0207706_10176926
1034 Ga0207706_10246320
1035 Ga0207706_10358638
1036 Ga0207706_10522258
1037 Ga0207686_10013792
1038 Ga0207670_10098864
1039 Ga0207669_10002787
1040 Ga0207669_10202070
1041 Ga0207704_10011919
1042 Ga0207704_10160260
1043 Ga0207691_10008817
1044 Ga0207691_10021141
1045 Ga0207691_10043061
1046 Ga0207691_10045300
1047 Ga0207691_10212473
1048 Ga0207711_10003614
1049 Ga0207711_10025458
1050 Ga0207711_10031730
1051 Ga0207711_10046366
1052 Ga0207711_10078290
1053 Ga0207711_10664442
1054 Ga0207689_10017101
1055 Ga0207689_10102797
1056 Ga0207661_10484362
1057 Ga0207679_10014494
1058 Ga0207667_10015759
1059 Ga0207651_10081678
1060 Ga0207651_10202016
1061 Ga0207651_10250379
1062 Ga0207651_10278636
1063 Ga0207651_10431690
1064 Ga0207712_10055401
1065 Ga0207668_10067351
1066 Ga0207668_10151811
1067 Ga0207668_10469029
1068 Ga0207640_10039017
1069 Ga0207640_10093160
1070 Ga0207658_10059588
1071 Ga0207658_10501565
1072 Ga0207677_10011863
1073 Ga0207677_10133679
1074 Ga0207703_10155140
1075 Ga0207703_10165062
1076 Ga0207703_10370743
1077 Ga0207639_10179133
1078 Ga0207639_10253758
1079 Ga0207639_10376440
1080 Ga0207678_10309097
1081 Ga0207708_10037265
1082 Ga0207708_10106685
1083 Ga0207702_10013022
1084 Ga0207702_10273207
1085 Ga0207641_10003015
1086 Ga0207641_10084297
1087 Ga0207641_10343543
1088 Ga0207641_10366342
1089 Ga0207648_10013509
1090 Ga0207648_10042857
1091 Ga0207676_10074978
1092 Ga0207676_10166261
1093 Ga0207676_10617580
1094 Ga0207674_10087321
1095 Ga0207674_10111942
1096 Ga0207674_10185993
1097 Ga0207675_100004111
1098 Ga0207675_100030019
1099 Ga0207675_100234571
1100 Ga0207675_100255228
1101 Ga0207675_100277222
1102 Ga0207675_100449663
1103 Ga0207675_100693729
1104 Ga0207683_10015175
1105 Ga0207683_10101656
1106 Ga0207683_10122554
1107 Ga0207683_10257303
1108 Ga0207683_10331492
1109 Ga0207683_10359214
1110 Ga0207428_10068488
1111 Ga0268266_10049853
1112 Ga0268266_10103584
1113 Ga0268266_10886994
1114 Ga0268265_10628854
1115 Ga0268264_10016080
1116 Ga0268264_10168929
1117 Ga0268264_10900281
1118 Ga0265337_1066381
1119 Ga0265334_10026961
1120 Ga0265323_10029659
1121 Ga0265330_10044498
1122 Ga0265339_10054078
1123 Ga0265316_10137642
1124 Ga0265342_10250614
1125 Ga0307412_10084135
1126 Ga0307409_100385926
1127 Ga0307416_100915579
1128 Ga0307411_10241535
1129 Ga0373950_0010470
1130 Ga0373958_0010774
1131 Ga0373959_0001097
1132 Ga0373938_0002012
1133 Ga0373938_0022410
1134 Ga0373929_0031868
1135 Ga0373934_0040329
1136 Ga0373934_0085773
1137 Ga0373940_0001150
1138 Ga0373940_0146359
1139 Ga0373949_0004491
1140 Ga0373951_0041259
1141 Ga0373952_0005553
1142 Ga0373923_0059570
1143 Ga0373932_0008028
1144 Ga0373936_0083400
1145 Ga0373939_0006814
1146 Ga0373945_0084755
1147 Ga0373956_0100633
1148 Ga0373960_0001408
1149 Ga0373946_0006124
1150 Ga0373955_0062491
1151 Ga0373955_0073523
1152 Ga0373955_0163055
1153 Ga0373961_0001952
1154 Ga0373962_0007204
1155 Ga0373931_0002762
1156 Ga0373931_0362403
1157 Ga0373935_0397406
1158 Ga0373933_0530983
1159 Ga0373947_0063248
1160 Ga0373937_0011909
1161 Ga0316582_0142582
1162 Ga0373925_0186982
1163 Ga0395905_0891317
1164 Ga0439464_0017577
1165 Ga0439464_0074856
1166 Ga0451576_0061552
1167 Ga0451576_0272439
1168 Ga0495592_0181994
1169 Ga0495603_0093733
1170 Ga0495629_0384152
1171 Ga0495651_0000580
1172 Ga0495651_0231841
1173 Ga0495628_0192794
1174 Ga0495630_0037450
1175 Ga0495652_0160122
1176 Ga0495598_0040969
1177 Ga0495621_0049026
1178 Ga0495633_0101040
1179 Ga0495667_0003340
1180 Ga0495656_0015596
1181 Ga0495634_0005175
1182 Ga0495635_0559745
1183 Ga0495659_0086915
1184 Ga0495599_0243059
1185 Ga0495647_0012622
1186 Ga0495613_0055898
1187 Ga0495600_0175609
1188 Ga0495600_0349195
1189 Ga0495674_0000853
1190 Ga0495674_0507533
1191 Ga0495680_0000568
1192 Ga0495680_0077376
1193 Ga0495675_0015061
1194 Ga0495602_0348295
1195 Ga0496100_0008205
1196 Ga0496100_0025184
1197 Ga0496100_0102986
1198 Ga0496101_0000588
1199 Ga0496101_0406412
1200 Ga0496102_0011157
1201 Ga0496102_0409766
1202 Ga0496103_0005302
1203 Ga0496104_0011653
1204 Ga0496104_0062587
1205 Ga0496104_0132345
1206 Ga0496104_0345500
1207 Ga0496105_0162795
1208 Ga0496106_0002854
1209 Ga0496106_0217397
1210 Ga0496106_0463464
1211 Ga0496106_0679734
1212 Ga0496107_0005055
1213 Ga0496107_0056587
1214 Ga0496107_0451293
1215 Ga0496107_0468635
1216 Ga0496107_0519635
1217 Ga0496107_0534032
1218 Ga0496108_0123019
1219 Ga0496108_0277258
1220 Ga0496108_0821114
1221 Ga0496109_0004945
1222 Ga0496109_0023682
1223 Ga0496109_0103483
1224 Ga0496109_0227179
1225 Ga0496109_0283189
1226 Ga0496110_0003517
1227 Ga0496110_0040839
1228 Ga0496110_0155723
1229 Ga0496110_0427383
1230 Ga0496110_0508344
1231 Ga0496110_0518990
1232 Ga0496111_0035800
1233 Ga0496111_0057591
1234 Ga0496111_0116377
1235 Ga0496111_0476305
1236 Ga0496112_0015730
1237 Ga0496112_0547176
1238 Ga0496114_0000669
1239 Ga0496114_0009157
1240 Ga0496114_0014814
1241 Ga0496114_0255963
1242 Ga0496119_0112833
1243 Ga0496121_0445167
1244 Ga0496122_0048170
1245 Ga0501031_0000683
1246 Ga0501032_0000291
1247 Ga0501032_0139083
1248 Ga0501033_0006274
1249 Ga0501034_0003908
1250 Ga0501034_0504396
1251 Ga0501036_0001130
1252 Ga0501036_0409351
1253 Ga0501037_0000280
1254 Ga0501037_0002250
1255 Ga0501038_0000883
1256 Ga0501038_0014572
1257 Ga0501038_0119553
1258 Ga0501038_0397307
1259 Ga0501039_0000382
1260 Ga0501039_0088995
1261 Ga0501039_0105211
1262 Ga0501040_0004968
1263 Ga0501040_0028422
1264 Ga0501040_0055027
1265 Ga0501041_0370825
1266 Ga0501042_0354773
1267 Ga0501043_0009099
1268 Ga0501043_0044754
1269 Ga0501043_0146495
1270 Ga0501043_0346360
1271 Ga0501046_0000442
1272 Ga0501046_0087409
1273 Ga0501046_0131341
1274 Ga0501047_0002814
1275 Ga0501047_0007236
1276 Ga0501047_0303821
1277 Ga0501048_0001572
1278 Ga0501048_0051679
1279 Ga0501048_0318877
1280 Ga0501067_0036768
1281 Ga0501068_0015218
1282 Ga0501068_0259075
1283 Ga0501068_0297223
1284 Ga0501069_0000958
1285 Ga0501070_0003700
1286 Ga0501070_0030200
1287 Ga0501070_0276484
1288 Ga0501072_0034519
1289 Ga0501072_0057285
1290 Ga0501073_0008166
1291 Ga0501074_0000718
1292 Ga0501074_0078541
1293 Ga0501074_0565211
1294 Ga0501075_0028717
1295 Ga0501075_0070786
1296 Ga0501076_0053189
1297 Ga0501076_0070255
1298 Ga0501076_0913936
1299 Ga0501077_0101718
1300 Ga0501079_0056701
1301 Ga0501079_0306553
1302 Ga0501080_0001004
1303 Ga0501080_0386946
1304 Ga0501081_0051390
1305 Ga0501081_0051848
1306 Ga0501083_0008115
1307 Ga0501083_0299007
1308 Ga0501035_0002957
1309 Ga0501035_0003827
1310 Ga0501035_0528317
1311 Ga0501044_0002104
1312 Ga0501044_0398285
1313 Ga0501044_0731927
1314 Ga0501045_0036310
1315 Ga0501045_0063127
1316 Ga0501045_0080533
1317 nmdc:mga0k408_203329_c1
1318 nmdc:mga05p37_6795_c1
1319 nmdc:mga09592_117753_c1
1320 nmdc:mga09592_41357_c1
1321 nmdc:mga09592_51472_c1
1322 nmdc:mga0qj67_64561_c1
1323 nmdc:mga0qj67_99538_c1
1324 nmdc:mga06r32_200554_c1
1325 nmdc:mga06r32_24761_c1
1326 nmdc:mga06r32_404966_c1
1327 nmdc:mga06r32_638139_c1
1328 nmdc:mga06r32_8997_c1
1329 nmdc:mga08y16_364084_c1
1330 nmdc:mga08y16_432165_c1
1331 nmdc:mga08y16_64196_c1
1332 nmdc:mga0n895_173627_c1
1333 nmdc:mga0n895_222861_c1
1334 nmdc:mga0n895_784186_c1
1335 nmdc:mga0n895_82681_c1
1336 nmdc:mga0rr50_2174_c1
1337 nmdc:mga0rr50_446276_c1
1338 nmdc:mga08x19_221436_c1
1339 nmdc:mga0a205_702467_c1
1340 nmdc:mga0a205_89037_c1
1341 Ga0495601_0023281
1342 Ga0495601_0098925
1343 Ga0495619_0205296
1344 Ga0495619_0318445
1345 Ga0501084_0121695
1346 Ga0501084_0148621
1347 Ga0590075_000036
1348 Ga0590077_000618
1349 Ga0501082_0122796
1350 Ga0501082_0164096
1351 Ga0501082_0665445
1352 Ga0530510_0005362
1353 Ga0530510_0027287
1354 Ga0530510_0695888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

3

92

0.97

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

3

92

0.88

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

1

74

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fp1-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9882 3 30
6fox-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with kynurenine 0.9877 3 30
6pvj-assembly1.cif.gz_A crystal structure of phqk in complex with malbrancheamide c 0.9872 2 31
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9862 1 30
5y7a-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn 0.9855 1 30
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9737 2 32 3.50.50.60
af_A0A2R8RWQ2_2_283_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9694 2 30 3.50.50.60
af_P49086_94_556_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9674 2 32 3.50.50.60
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9616 2 31 3.50.50.60
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9616 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1G7MG79-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 1.005 1 69
AF-J7LZ42-F1-model_v4 deleted 1.003 1 213
AF-A0A4Y3NHL4-F1-model_v4 NADP oxidoreductase 1.002 30 213
AF-A0A3D0R1J7-F1-model_v4 NADP oxidoreductase 1.002 3 86
AF-A0A6I2F6K3-F1-model_v4 NADP oxidoreductase 1 2 212

Map