F474600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 677 | 268 | 1354 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0366449|Ga0495651_0366449_341_850 |
| Length | 169 |
| Sequence | MRSERPMREALEVWISAELVEKIGEHGAKTYPHECCGALLGRENWAAGSEELGGXXXXSSREVVALFPLVNRRDDSPRNRFSVTAEDVREAEKAANAQGMEVIGWYHSHPDHPARPSEYDREHAWPWYSYVIVSVRAGVAQEMTSWRLKNDRSRFEEERIEAARVSAAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 59 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 137 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 177 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 178 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.82 |
| Metatranscriptomes | 1.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.51 |
| Rhizosphere | 97.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495651_0366449 | 3300046462 | Unclassified | 948 |
| 2 | rootH2_10199925 | 3300003320 | Bacteria | 1078 |
| 3 | rootL2_10246079 | 3300003322 | Bacteria | 1803 |
| 4 | Ga0058863_11605999 | 3300004799 | Bacteria | 2143 |
| 5 | Ga0065707_10607157 | 3300005295 | Unclassified | 681 |
| 6 | Ga0070658_10258783 | 3300005327 | Bacteria | 1478 |
| 7 | Ga0070683_100008264 | 3300005329 | Bacteria | 8843 |
| 8 | Ga0070683_100011263 | 3300005329 | Bacteria | 7719 |
| 9 | Ga0070683_100016614 | 3300005329 | Bacteria | 6494 |
| 10 | Ga0070683_100021118 | 3300005329 | Bacteria | 5806 |
| 11 | Ga0070670_100004107 | 3300005331 | Bacteria | 12167 |
| 12 | Ga0068869_100013389 | 3300005334 | Bacteria | 5454 |
| 13 | Ga0070666_10192247 | 3300005335 | Bacteria | 1434 |
| 14 | Ga0070680_100399436 | 3300005336 | Bacteria | 1172 |
| 15 | Ga0068868_100019486 | 3300005338 | Bacteria | 5083 |
| 16 | Ga0070661_100012678 | 3300005344 | Bacteria | 5897 |
| 17 | Ga0070661_100111862 | 3300005344 | Unclassified | 2040 |
| 18 | Ga0070661_100318208 | 3300005344 | Bacteria | 1215 |
| 19 | Ga0070661_100512781 | 3300005344 | Bacteria | 961 |
| 20 | Ga0070671_100024373 | 3300005355 | Bacteria | 4952 |
| 21 | Ga0070709_10020038 | 3300005434 | Bacteria | 3876 |
| 22 | Ga0070709_10049113 | 3300005434 | Bacteria | 2636 |
| 23 | Ga0070709_10077053 | 3300005434 | Unclassified | 2167 |
| 24 | Ga0070709_10119198 | 3300005434 | Bacteria | 1786 |
| 25 | Ga0070714_101238363 | 3300005435 | Unclassified | 728 |
| 26 | Ga0070713_100098044 | 3300005436 | Bacteria | 2534 |
| 27 | Ga0070713_100116677 | 3300005436 | Bacteria | 2335 |
| 28 | Ga0070713_100153545 | 3300005436 | Bacteria | 2050 |
| 29 | Ga0070713_100389605 | 3300005436 | Unclassified | 1300 |
| 30 | Ga0070713_101114221 | 3300005436 | Unclassified | 763 |
| 31 | Ga0070713_101114631 | 3300005436 | Bacteria | 763 |
| 32 | Ga0070710_10104944 | 3300005437 | Bacteria | 1689 |
| 33 | Ga0070710_10335222 | 3300005437 | Unclassified | 997 |
| 34 | Ga0070710_10356281 | 3300005437 | Bacteria | 970 |
| 35 | Ga0070711_100023435 | 3300005439 | Bacteria | 4014 |
| 36 | Ga0070711_100080987 | 3300005439 | Bacteria | 2313 |
| 37 | Ga0070711_100141898 | 3300005439 | Bacteria | 1802 |
| 38 | Ga0070711_100348838 | 3300005439 | Unclassified | 1190 |
| 39 | Ga0070711_100579371 | 3300005439 | Bacteria | 934 |
| 40 | Ga0070711_100593705 | 3300005439 | Bacteria | 923 |
| 41 | Ga0070711_101313255 | 3300005439 | Unclassified | 628 |
| 42 | Ga0070694_101196361 | 3300005444 | Unclassified | 637 |
| 43 | Ga0070708_100019803 | 3300005445 | Bacteria | 5660 |
| 44 | Ga0070708_100044919 | 3300005445 | Bacteria | 3889 |
| 45 | Ga0070708_100061638 | 3300005445 | Bacteria | 3351 |
| 46 | Ga0070708_100141526 | 3300005445 | Bacteria | 2231 |
| 47 | Ga0070708_101000672 | 3300005445 | Bacteria | 784 |
| 48 | Ga0070708_101519981 | 3300005445 | Bacteria | 624 |
| 49 | Ga0070663_100741937 | 3300005455 | Bacteria | 838 |
| 50 | Ga0070706_100769765 | 3300005467 | Unclassified | 892 |
| 51 | Ga0070706_100784833 | 3300005467 | Unclassified | 882 |
| 52 | Ga0070706_100789137 | 3300005467 | Bacteria | 879 |
| 53 | Ga0070707_100000431 | 3300005468 | Bacteria | 41512 |
| 54 | Ga0070707_100013899 | 3300005468 | Bacteria | 7540 |
| 55 | Ga0070707_100294932 | 3300005468 | Bacteria | 1576 |
| 56 | Ga0070707_100303243 | 3300005468 | Bacteria | 1552 |
| 57 | Ga0070707_100825329 | 3300005468 | Unclassified | 891 |
| 58 | Ga0070707_101012747 | 3300005468 | Bacteria | 796 |
| 59 | Ga0070707_101073318 | 3300005468 | Bacteria | 771 |
| 60 | Ga0070698_100019225 | 3300005471 | Bacteria | 7177 |
| 61 | Ga0070698_100114902 | 3300005471 | Bacteria | 2656 |
| 62 | Ga0070698_100323648 | 3300005471 | Unclassified | 1473 |
| 63 | Ga0070699_100093961 | 3300005518 | Bacteria | 2624 |
| 64 | Ga0070699_100708696 | 3300005518 | Bacteria | 920 |
| 65 | Ga0070699_101184055 | 3300005518 | Unclassified | 701 |
| 66 | Ga0070684_100009424 | 3300005535 | Bacteria | 7689 |
| 67 | Ga0070684_100013697 | 3300005535 | Bacteria | 6544 |
| 68 | Ga0070684_100072152 | 3300005535 | Bacteria | 3039 |
| 69 | Ga0070684_100086693 | 3300005535 | Bacteria | 2779 |
| 70 | Ga0070697_100076172 | 3300005536 | Bacteria | 2759 |
| 71 | Ga0070697_100474859 | 3300005536 | Bacteria | 1091 |
| 72 | Ga0068853_100463841 | 3300005539 | Unclassified | 1192 |
| 73 | Ga0070693_101321048 | 3300005547 | Bacteria | 558 |
| 74 | Ga0070665_100001094 | 3300005548 | Bacteria | 33493 |
| 75 | Ga0070665_100064862 | 3300005548 | Bacteria | 3664 |
| 76 | Ga0070665_101204793 | 3300005548 | Bacteria | 768 |
| 77 | Ga0070704_100429438 | 3300005549 | Bacteria | 1133 |
| 78 | Ga0068855_100009736 | 3300005563 | Bacteria | 11593 |
| 79 | Ga0068855_100020319 | 3300005563 | Bacteria | 7967 |
| 80 | Ga0068855_100092795 | 3300005563 | Bacteria | 3482 |
| 81 | Ga0068855_100143942 | 3300005563 | Bacteria | 2715 |
| 82 | Ga0070664_100515712 | 3300005564 | Bacteria | 1103 |
| 83 | Ga0068857_100086014 | 3300005577 | Bacteria | 2811 |
| 84 | Ga0068857_100150454 | 3300005577 | Bacteria | 2108 |
| 85 | Ga0068854_100035457 | 3300005578 | Bacteria | 3492 |
| 86 | Ga0068854_100285554 | 3300005578 | Unclassified | 1330 |
| 87 | Ga0068854_100360080 | 3300005578 | Bacteria | 1193 |
| 88 | Ga0068856_100015444 | 3300005614 | Bacteria | 7378 |
| 89 | Ga0068856_100018943 | 3300005614 | Bacteria | 6678 |
| 90 | Ga0068856_100036617 | 3300005614 | Unclassified | 4811 |
| 91 | Ga0068856_100050127 | 3300005614 | Bacteria | 4115 |
| 92 | Ga0068856_100103712 | 3300005614 | Bacteria | 2837 |
| 93 | Ga0068856_100181463 | 3300005614 | Bacteria | 2118 |
| 94 | Ga0068856_100650182 | 3300005614 | Bacteria | 1075 |
| 95 | Ga0068856_101608623 | 3300005614 | Bacteria | 663 |
| 96 | Ga0068852_100000027 | 3300005616 | Bacteria | 113819 |
| 97 | Ga0068852_100001031 | 3300005616 | Bacteria | 18329 |
| 98 | Ga0068852_100485643 | 3300005616 | Unclassified | 1228 |
| 99 | Ga0068859_100025020 | 3300005617 | Bacteria | 5992 |
| 100 | Ga0068859_100425046 | 3300005617 | Bacteria | 1425 |
| 101 | Ga0068859_101469553 | 3300005617 | Unclassified | 752 |
| 102 | Ga0068864_100104895 | 3300005618 | Bacteria | 2512 |
| 103 | Ga0068851_10083468 | 3300005834 | Bacteria | 1672 |
| 104 | Ga0068851_10416521 | 3300005834 | Bacteria | 793 |
| 105 | Ga0068863_100011627 | 3300005841 | Bacteria | 8515 |
| 106 | Ga0068863_100056888 | 3300005841 | Bacteria | 3702 |
| 107 | Ga0068858_100214743 | 3300005842 | Eukaryota | 1821 |
| 108 | Ga0068860_100336290 | 3300005843 | Unclassified | 1484 |
| 109 | Ga0068860_100745095 | 3300005843 | Bacteria | 991 |
| 110 | Ga0068862_100017528 | 3300005844 | Bacteria | 5964 |
| 111 | Ga0081455_10168891 | 3300005937 | Unclassified | 1668 |
| 112 | Ga0070717_10276245 | 3300006028 | Bacteria | 1489 |
| 113 | Ga0070717_10545355 | 3300006028 | Bacteria | 1050 |
| 114 | Ga0070717_10703607 | 3300006028 | Bacteria | 918 |
| 115 | Ga0070715_10023904 | 3300006163 | Unclassified | 2400 |
| 116 | Ga0070715_10362735 | 3300006163 | Unclassified | 795 |
| 117 | Ga0070715_10638107 | 3300006163 | Unclassified | 629 |
| 118 | Ga0070716_100013287 | 3300006173 | Unclassified | 4194 |
| 119 | Ga0070716_100019546 | 3300006173 | Bacteria | 3541 |
| 120 | Ga0070716_100037814 | 3300006173 | Unclassified | 2669 |
| 121 | Ga0070716_100065902 | 3300006173 | Bacteria | 2110 |
| 122 | Ga0070712_100043588 | 3300006175 | Bacteria | 3089 |
| 123 | Ga0070712_100050252 | 3300006175 | Bacteria | 2900 |
| 124 | Ga0070712_100054192 | 3300006175 | Bacteria | 2803 |
| 125 | Ga0070712_100056014 | 3300006175 | Bacteria | 2764 |
| 126 | Ga0070712_100080094 | 3300006175 | Bacteria | 2363 |
| 127 | Ga0070712_100153092 | 3300006175 | Bacteria | 1773 |
| 128 | Ga0070712_100158200 | 3300006175 | Bacteria | 1747 |
| 129 | Ga0070712_100161970 | 3300006175 | Bacteria | 1728 |
| 130 | Ga0070712_101649400 | 3300006175 | Unclassified | 561 |
| 131 | Ga0097621_100011589 | 3300006237 | Bacteria | 6499 |
| 132 | Ga0097621_100411103 | 3300006237 | Bacteria | 1213 |
| 133 | Ga0068871_100003269 | 3300006358 | Bacteria | 11117 |
| 134 | Ga0068871_100066745 | 3300006358 | Bacteria | 2949 |
| 135 | Ga0068871_100263825 | 3300006358 | Bacteria | 1503 |
| 136 | Ga0068871_100301668 | 3300006358 | Bacteria | 1406 |
| 137 | Ga0075433_10607402 | 3300006852 | Unclassified | 960 |
| 138 | Ga0075434_100032294 | 3300006871 | Bacteria | 5163 |
| 139 | Ga0075434_100045338 | 3300006871 | Bacteria | 4362 |
| 140 | Ga0075434_100255245 | 3300006871 | Bacteria | 1772 |
| 141 | Ga0075436_100066362 | 3300006914 | Bacteria | 2494 |
| 142 | Ga0075436_100444580 | 3300006914 | Unclassified | 943 |
| 143 | Ga0075436_100630467 | 3300006914 | Unclassified | 791 |
| 144 | Ga0075436_101275320 | 3300006914 | Unclassified | 555 |
| 145 | Ga0097620_100025019 | 3300006931 | Bacteria | 5992 |
| 146 | Ga0097620_100425024 | 3300006931 | Bacteria | 1425 |
| 147 | Ga0097620_101469345 | 3300006931 | Unclassified | 752 |
| 148 | Ga0075435_100011740 | 3300007076 | Bacteria | 6463 |
| 149 | Ga0075435_100030126 | 3300007076 | Unclassified | 4263 |
| 150 | Ga0075435_100608019 | 3300007076 | Unclassified | 948 |
| 151 | Ga0099794_10006038 | 3300007265 | Bacteria | 4890 |
| 152 | Ga0099794_10010358 | 3300007265 | Unclassified | 3956 |
| 153 | Ga0099794_10011444 | 3300007265 | Bacteria | 3799 |
| 154 | Ga0099794_10015811 | 3300007265 | Bacteria | 3337 |
| 155 | Ga0099794_10018947 | 3300007265 | Bacteria | 3093 |
| 156 | Ga0099794_10021825 | 3300007265 | Bacteria | 2912 |
| 157 | Ga0099794_10024858 | 3300007265 | Bacteria | 2753 |
| 158 | Ga0099794_10159537 | 3300007265 | Unclassified | 1147 |
| 159 | Ga0099794_10191722 | 3300007265 | Unclassified | 1045 |
| 160 | Ga0099794_10371623 | 3300007265 | Unclassified | 745 |
| 161 | Ga0099794_10433810 | 3300007265 | Unclassified | 688 |
| 162 | Ga0099795_10006131 | 3300007788 | Bacteria | 3256 |
| 163 | Ga0105240_10000222 | 3300009093 | Bacteria | 113825 |
| 164 | Ga0105240_10009545 | 3300009093 | Bacteria | 13738 |
| 165 | Ga0105240_10017302 | 3300009093 | Bacteria | 9719 |
| 166 | Ga0105240_10022449 | 3300009093 | Bacteria | 8364 |
| 167 | Ga0105240_10036406 | 3300009093 | Bacteria | 6331 |
| 168 | Ga0105240_10037854 | 3300009093 | Bacteria | 6195 |
| 169 | Ga0105240_10057777 | 3300009093 | Bacteria | 4845 |
| 170 | Ga0105240_10094409 | 3300009093 | Bacteria | 3649 |
| 171 | Ga0105240_10135919 | 3300009093 | Bacteria | 2944 |
| 172 | Ga0105240_10163842 | 3300009093 | Bacteria | 2638 |
| 173 | Ga0105245_10013731 | 3300009098 | Bacteria | 7054 |
| 174 | Ga0105245_10386963 | 3300009098 | Archaea | 1394 |
| 175 | Ga0105245_11165211 | 3300009098 | Bacteria | 818 |
| 176 | Ga0105247_10049229 | 3300009101 | Bacteria | 2591 |
| 177 | Ga0105241_10013924 | 3300009174 | Bacteria | 5894 |
| 178 | Ga0105241_10026446 | 3300009174 | Bacteria | 4318 |
| 179 | Ga0105241_10028981 | 3300009174 | Bacteria | 4126 |
| 180 | Ga0105242_10190777 | 3300009176 | Bacteria | 1814 |
| 181 | Ga0105248_10004245 | 3300009177 | Bacteria | 15856 |
| 182 | Ga0105248_10083347 | 3300009177 | Bacteria | 3597 |
| 183 | Ga0105248_10230390 | 3300009177 | Unclassified | 2085 |
| 184 | Ga0105248_10243342 | 3300009177 | Bacteria | 2025 |
| 185 | Ga0105248_10598913 | 3300009177 | Bacteria | 1244 |
| 186 | Ga0105237_10049734 | 3300009545 | Bacteria | 4212 |
| 187 | Ga0105237_10164145 | 3300009545 | Bacteria | 2220 |
| 188 | Ga0105237_10853268 | 3300009545 | Bacteria | 917 |
| 189 | Ga0105238_10003154 | 3300009551 | Bacteria | 16457 |
| 190 | Ga0105238_10003324 | 3300009551 | Bacteria | 16047 |
| 191 | Ga0105238_10003810 | 3300009551 | Bacteria | 14979 |
| 192 | Ga0105238_10018040 | 3300009551 | Bacteria | 7173 |
| 193 | Ga0099796_10002148 | 3300010159 | Bacteria | 4248 |
| 194 | Ga0099796_10195063 | 3300010159 | Unclassified | 819 |
| 195 | Ga0099796_10343592 | 3300010159 | Unclassified | 642 |
| 196 | Ga0105239_10002686 | 3300010375 | Bacteria | 22390 |
| 197 | Ga0105239_10818175 | 3300010375 | Bacteria | 1067 |
| 198 | Ga0157373_10050643 | 3300013100 | Bacteria | 2957 |
| 199 | Ga0157373_10697413 | 3300013100 | Bacteria | 744 |
| 200 | Ga0157370_10000012 | 3300013104 | Bacteria | 201181 |
| 201 | Ga0157369_10000112 | 3300013105 | Bacteria | 114309 |
| 202 | Ga0157369_10003619 | 3300013105 | Bacteria | 18362 |
| 203 | Ga0157369_10007463 | 3300013105 | Bacteria | 12592 |
| 204 | Ga0157369_10042848 | 3300013105 | Bacteria | 4937 |
| 205 | Ga0157369_11103806 | 3300013105 | Bacteria | 811 |
| 206 | Ga0157374_10003427 | 3300013296 | Bacteria | 13327 |
| 207 | Ga0157374_10018378 | 3300013296 | Bacteria | 6168 |
| 208 | Ga0157374_10431015 | 3300013296 | Bacteria | 1318 |
| 209 | Ga0157374_11659537 | 3300013296 | Unclassified | 664 |
| 210 | Ga0157378_10004815 | 3300013297 | Bacteria | 11831 |
| 211 | Ga0157378_10008730 | 3300013297 | Bacteria | 8820 |
| 212 | Ga0157378_10016708 | 3300013297 | Bacteria | 6431 |
| 213 | Ga0157378_10692887 | 3300013297 | Unclassified | 1038 |
| 214 | Ga0163162_10002090 | 3300013306 | Bacteria | 18750 |
| 215 | Ga0163162_10020335 | 3300013306 | Bacteria | 6521 |
| 216 | Ga0163162_10080351 | 3300013306 | Bacteria | 3328 |
| 217 | Ga0157372_10000111 | 3300013307 | Bacteria | 86033 |
| 218 | Ga0157372_10005629 | 3300013307 | Bacteria | 13320 |
| 219 | Ga0157372_10200131 | 3300013307 | Bacteria | 2314 |
| 220 | Ga0157372_10264778 | 3300013307 | Unclassified | 1996 |
| 221 | Ga0157372_10326125 | 3300013307 | Bacteria | 1788 |
| 222 | Ga0157372_10553446 | 3300013307 | Bacteria | 1341 |
| 223 | Ga0157372_10904655 | 3300013307 | Bacteria | 1024 |
| 224 | Ga0157375_10091391 | 3300013308 | Bacteria | 3105 |
| 225 | Ga0157375_10136245 | 3300013308 | Unclassified | 2579 |
| 226 | Ga0157375_10814970 | 3300013308 | Unclassified | 1082 |
| 227 | Ga0163163_10105291 | 3300014325 | Bacteria | 2847 |
| 228 | Ga0157379_10014423 | 3300014968 | Bacteria | 6933 |
| 229 | Ga0157379_10107169 | 3300014968 | Bacteria | 2509 |
| 230 | Ga0157379_10120873 | 3300014968 | Bacteria | 2356 |
| 231 | Ga0157379_10355627 | 3300014968 | Bacteria | 1341 |
| 232 | Ga0157376_10000050 | 3300014969 | Bacteria | 104192 |
| 233 | Ga0157376_10013325 | 3300014969 | Bacteria | 6133 |
| 234 | Ga0157376_10019536 | 3300014969 | Bacteria | 5225 |
| 235 | Ga0206356_10885676 | 3300020070 | Bacteria | 726 |
| 236 | Ga0206356_11019469 | 3300020070 | Bacteria | 1539 |
| 237 | Ga0206349_1762153 | 3300020075 | Unclassified | 969 |
| 238 | Ga0206350_11179382 | 3300020080 | Bacteria | 1445 |
| 239 | Ga0207692_10124375 | 3300025898 | Bacteria | 1448 |
| 240 | Ga0207692_10341710 | 3300025898 | Bacteria | 921 |
| 241 | Ga0207642_10587265 | 3300025899 | Unclassified | 692 |
| 242 | Ga0207710_10005185 | 3300025900 | Bacteria | 5634 |
| 243 | Ga0207685_10304423 | 3300025905 | Unclassified | 790 |
| 244 | Ga0207685_10517407 | 3300025905 | Unclassified | 630 |
| 245 | Ga0207699_10028329 | 3300025906 | Bacteria | 3112 |
| 246 | Ga0207699_10104299 | 3300025906 | Unclassified | 1805 |
| 247 | Ga0207699_10144802 | 3300025906 | Unclassified | 1565 |
| 248 | Ga0207699_10165376 | 3300025906 | Bacteria | 1476 |
| 249 | Ga0207699_10177236 | 3300025906 | Bacteria | 1430 |
| 250 | Ga0207705_10491120 | 3300025909 | Unclassified | 953 |
| 251 | Ga0207684_10295727 | 3300025910 | Bacteria | 1396 |
| 252 | Ga0207654_10048037 | 3300025911 | Bacteria | 2441 |
| 253 | Ga0207654_10715390 | 3300025911 | Unclassified | 720 |
| 254 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 255 | Ga0207695_10000814 | 3300025913 | Bacteria | 58050 |
| 256 | Ga0207695_10001044 | 3300025913 | Bacteria | 48722 |
| 257 | Ga0207695_10010410 | 3300025913 | Bacteria | 11379 |
| 258 | Ga0207695_10023756 | 3300025913 | Bacteria | 6918 |
| 259 | Ga0207695_10088037 | 3300025913 | Bacteria | 3126 |
| 260 | Ga0207695_10091340 | 3300025913 | Unclassified | 3059 |
| 261 | Ga0207695_10140393 | 3300025913 | Bacteria | 2365 |
| 262 | Ga0207695_10203628 | 3300025913 | Bacteria | 1892 |
| 263 | Ga0207695_10695778 | 3300025913 | Unclassified | 897 |
| 264 | Ga0207671_10009652 | 3300025914 | Bacteria | 8044 |
| 265 | Ga0207671_10046798 | 3300025914 | Bacteria | 3201 |
| 266 | Ga0207671_10226218 | 3300025914 | Bacteria | 1467 |
| 267 | Ga0207671_10301744 | 3300025914 | Bacteria | 1265 |
| 268 | Ga0207693_10011413 | 3300025915 | Bacteria | 7193 |
| 269 | Ga0207693_10039952 | 3300025915 | Unclassified | 3694 |
| 270 | Ga0207693_10056083 | 3300025915 | Bacteria | 3089 |
| 271 | Ga0207693_10089142 | 3300025915 | Bacteria | 2418 |
| 272 | Ga0207693_10089610 | 3300025915 | Bacteria | 2411 |
| 273 | Ga0207693_10104954 | 3300025915 | Bacteria | 2216 |
| 274 | Ga0207693_10526336 | 3300025915 | Bacteria | 922 |
| 275 | Ga0207693_10577355 | 3300025915 | Bacteria | 876 |
| 276 | Ga0207663_10030334 | 3300025916 | Bacteria | 3189 |
| 277 | Ga0207663_10204799 | 3300025916 | Bacteria | 1426 |
| 278 | Ga0207649_10064142 | 3300025920 | Unclassified | 2322 |
| 279 | Ga0207649_10075809 | 3300025920 | Bacteria | 2162 |
| 280 | Ga0207649_10377851 | 3300025920 | Bacteria | 1055 |
| 281 | Ga0207646_10000801 | 3300025922 | Bacteria | 40960 |
| 282 | Ga0207646_10023069 | 3300025922 | Bacteria | 5721 |
| 283 | Ga0207646_10092749 | 3300025922 | Bacteria | 2703 |
| 284 | Ga0207646_10338727 | 3300025922 | Unclassified | 1359 |
| 285 | Ga0207694_10000209 | 3300025924 | Bacteria | 57282 |
| 286 | Ga0207694_10008257 | 3300025924 | Bacteria | 7870 |
| 287 | Ga0207694_10017631 | 3300025924 | Bacteria | 5397 |
| 288 | Ga0207694_10018694 | 3300025924 | Bacteria | 5238 |
| 289 | Ga0207694_10027390 | 3300025924 | Bacteria | 4340 |
| 290 | Ga0207650_10389745 | 3300025925 | Bacteria | 1151 |
| 291 | Ga0207687_10053184 | 3300025927 | Bacteria | 2828 |
| 292 | Ga0207700_10049753 | 3300025928 | Unclassified | 3119 |
| 293 | Ga0207700_10078787 | 3300025928 | Bacteria | 2565 |
| 294 | Ga0207700_10130114 | 3300025928 | Bacteria | 2054 |
| 295 | Ga0207700_10502725 | 3300025928 | Bacteria | 1073 |
| 296 | Ga0207664_10651834 | 3300025929 | Bacteria | 946 |
| 297 | Ga0207644_10188777 | 3300025931 | Unclassified | 1619 |
| 298 | Ga0207644_10406722 | 3300025931 | Bacteria | 1113 |
| 299 | Ga0207686_11281442 | 3300025934 | Unclassified | 601 |
| 300 | Ga0207704_10273753 | 3300025938 | Bacteria | 1280 |
| 301 | Ga0207665_10000310 | 3300025939 | Bacteria | 33756 |
| 302 | Ga0207665_10004114 | 3300025939 | Bacteria | 9701 |
| 303 | Ga0207665_10065972 | 3300025939 | Bacteria | 2462 |
| 304 | Ga0207665_10092321 | 3300025939 | Bacteria | 2100 |
| 305 | Ga0207665_10390038 | 3300025939 | Bacteria | 1058 |
| 306 | Ga0207711_10000016 | 3300025941 | Bacteria | 486741 |
| 307 | Ga0207711_10010564 | 3300025941 | Bacteria | 7674 |
| 308 | Ga0207711_10152689 | 3300025941 | Unclassified | 2085 |
| 309 | Ga0207711_10169706 | 3300025941 | Bacteria | 1979 |
| 310 | Ga0207689_10010248 | 3300025942 | Bacteria | 8074 |
| 311 | Ga0207661_10007289 | 3300025944 | Bacteria | 7869 |
| 312 | Ga0207661_10053174 | 3300025944 | Bacteria | 3239 |
| 313 | Ga0207667_10030755 | 3300025949 | Bacteria | 5802 |
| 314 | Ga0207667_10855253 | 3300025949 | Unclassified | 903 |
| 315 | Ga0207651_11734815 | 3300025960 | Unclassified | 562 |
| 316 | Ga0207640_10013935 | 3300025981 | Bacteria | 4616 |
| 317 | Ga0207640_10041411 | 3300025981 | Bacteria | 2929 |
| 318 | Ga0207703_10203708 | 3300026035 | Eukaryota | 1760 |
| 319 | Ga0207639_10000123 | 3300026041 | Bacteria | 57693 |
| 320 | Ga0207678_10010432 | 3300026067 | Bacteria | 8156 |
| 321 | Ga0207678_10568622 | 3300026067 | Unclassified | 992 |
| 322 | Ga0207702_10002242 | 3300026078 | Bacteria | 18547 |
| 323 | Ga0207702_10032038 | 3300026078 | Bacteria | 4385 |
| 324 | Ga0207702_10172625 | 3300026078 | Bacteria | 1984 |
| 325 | Ga0207702_10196271 | 3300026078 | Bacteria | 1868 |
| 326 | Ga0207702_10200418 | 3300026078 | Bacteria | 1850 |
| 327 | Ga0207702_10375579 | 3300026078 | Unclassified | 1366 |
| 328 | Ga0207702_11330133 | 3300026078 | Bacteria | 712 |
| 329 | Ga0207641_10002903 | 3300026088 | Bacteria | 15505 |
| 330 | Ga0207641_10215551 | 3300026088 | Bacteria | 1777 |
| 331 | Ga0207676_10040093 | 3300026095 | Bacteria | 3587 |
| 332 | Ga0207674_10005850 | 3300026116 | Bacteria | 14584 |
| 333 | Ga0207674_10016521 | 3300026116 | Bacteria | 8075 |
| 334 | Ga0207674_10099817 | 3300026116 | Unclassified | 2885 |
| 335 | Ga0207698_10000021 | 3300026142 | Bacteria | 133280 |
| 336 | Ga0209179_1017755 | 3300027512 | Unclassified | 1352 |
| 337 | Ga0209588_1001083 | 3300027671 | Bacteria | 6993 |
| 338 | Ga0209588_1003500 | 3300027671 | Bacteria | 4363 |
| 339 | Ga0209588_1005643 | 3300027671 | Unclassified | 3596 |
| 340 | Ga0209588_1017715 | 3300027671 | Bacteria | 2210 |
| 341 | Ga0209588_1076607 | 3300027671 | Bacteria | 1081 |
| 342 | Ga0268266_10001110 | 3300028379 | Bacteria | 33674 |
| 343 | Ga0268266_10044705 | 3300028379 | Bacteria | 3786 |
| 344 | Ga0268266_11102229 | 3300028379 | Bacteria | 768 |
| 345 | Ga0268265_10527185 | 3300028380 | Bacteria | 1117 |
| 346 | Ga0268264_10069624 | 3300028381 | Bacteria | 2976 |
| 347 | Ga0265319_1000229 | 3300028563 | Bacteria | 42103 |
| 348 | Ga0265318_10000111 | 3300028577 | Bacteria | 75372 |
| 349 | Ga0265338_10089086 | 3300028800 | Bacteria | 2558 |
| 350 | Ga0265338_10158728 | 3300028800 | Bacteria | 1749 |
| 351 | Ga0265338_10158906 | 3300028800 | Bacteria | 1748 |
| 352 | Ga0265338_10198175 | 3300028800 | Unclassified | 1516 |
| 353 | Ga0265338_10565930 | 3300028800 | Unclassified | 794 |
| 354 | Ga0265338_10838858 | 3300028800 | Unclassified | 628 |
| 355 | Ga0265324_10070705 | 3300029957 | Unclassified | 1189 |
| 356 | Ga0265770_1001674 | 3300030878 | Bacteria | 3036 |
| 357 | Ga0265760_10073886 | 3300031090 | Bacteria | 1049 |
| 358 | Ga0265760_10094213 | 3300031090 | Bacteria | 940 |
| 359 | Ga0265330_10297321 | 3300031235 | Bacteria | 680 |
| 360 | Ga0265332_10032746 | 3300031238 | Bacteria | 2264 |
| 361 | Ga0265328_10020083 | 3300031239 | Bacteria | 2560 |
| 362 | Ga0265328_10043345 | 3300031239 | Unclassified | 1655 |
| 363 | Ga0265320_10000087 | 3300031240 | Bacteria | 77435 |
| 364 | Ga0265325_10008582 | 3300031241 | Bacteria | 6022 |
| 365 | Ga0265325_10068265 | 3300031241 | Bacteria | 1790 |
| 366 | Ga0265325_10095008 | 3300031241 | Bacteria | 1465 |
| 367 | Ga0265325_10170887 | 3300031241 | Unclassified | 1017 |
| 368 | Ga0265325_10384388 | 3300031241 | Bacteria | 616 |
| 369 | Ga0265329_10000111 | 3300031242 | Bacteria | 38630 |
| 370 | Ga0265329_10007569 | 3300031242 | Bacteria | 4187 |
| 371 | Ga0265340_10016482 | 3300031247 | Bacteria | 3825 |
| 372 | Ga0265340_10040866 | 3300031247 | Bacteria | 2282 |
| 373 | Ga0265339_10000011 | 3300031249 | Bacteria | 206284 |
| 374 | Ga0265339_10002905 | 3300031249 | Bacteria | 12128 |
| 375 | Ga0265339_10014051 | 3300031249 | Bacteria | 4836 |
| 376 | Ga0265339_10088354 | 3300031249 | Bacteria | 1628 |
| 377 | Ga0265339_10201934 | 3300031249 | Unclassified | 980 |
| 378 | Ga0265331_10000169 | 3300031250 | Bacteria | 80399 |
| 379 | Ga0265331_10007640 | 3300031250 | Bacteria | 6228 |
| 380 | Ga0265331_10010096 | 3300031250 | Bacteria | 5244 |
| 381 | Ga0265316_10000220 | 3300031344 | Bacteria | 66743 |
| 382 | Ga0265316_10006161 | 3300031344 | Bacteria | 11506 |
| 383 | Ga0265316_10013059 | 3300031344 | Bacteria | 7407 |
| 384 | Ga0265316_10105563 | 3300031344 | Bacteria | 2137 |
| 385 | Ga0265316_10150592 | 3300031344 | Bacteria | 1743 |
| 386 | Ga0265316_10278820 | 3300031344 | Bacteria | 1222 |
| 387 | Ga0265316_10304206 | 3300031344 | Bacteria | 1161 |
| 388 | Ga0265316_10606667 | 3300031344 | Bacteria | 776 |
| 389 | Ga0307408_100018791 | 3300031548 | Bacteria | 4645 |
| 390 | Ga0265313_10000867 | 3300031595 | Bacteria | 30533 |
| 391 | Ga0265313_10230301 | 3300031595 | Unclassified | 761 |
| 392 | Ga0265314_10000067 | 3300031711 | Bacteria | 156225 |
| 393 | Ga0265314_10032239 | 3300031711 | Bacteria | 3856 |
| 394 | Ga0265314_10348274 | 3300031711 | Unclassified | 816 |
| 395 | Ga0265342_10000435 | 3300031712 | Bacteria | 45794 |
| 396 | Ga0265342_10002210 | 3300031712 | Bacteria | 17081 |
| 397 | Ga0265342_10044490 | 3300031712 | Bacteria | 2676 |
| 398 | Ga0265342_10260940 | 3300031712 | Bacteria | 922 |
| 399 | Ga0307405_10544192 | 3300031731 | Bacteria | 938 |
| 400 | Ga0307413_10025902 | 3300031824 | Unclassified | 3224 |
| 401 | Ga0307410_10004263 | 3300031852 | Bacteria | 7362 |
| 402 | Ga0307406_10087875 | 3300031901 | Bacteria | 2084 |
| 403 | Ga0307407_10137989 | 3300031903 | Unclassified | 1569 |
| 404 | Ga0307409_100064241 | 3300031995 | Bacteria | 2882 |
| 405 | Ga0307416_100027929 | 3300032002 | Bacteria | 4187 |
| 406 | Ga0307414_10054871 | 3300032004 | Unclassified | 2787 |
| 407 | Ga0307411_10014131 | 3300032005 | Bacteria | 4433 |
| 408 | Ga0307415_100059623 | 3300032126 | Bacteria | 2633 |
| 409 | Ga0373928_0051974 | 3300035084 | Unclassified | 970 |
| 410 | Ga0373934_0006003 | 3300035086 | Bacteria | 4497 |
| 411 | Ga0373934_0153821 | 3300035086 | Unclassified | 943 |
| 412 | Ga0373923_0007982 | 3300035111 | Bacteria | 3751 |
| 413 | Ga0373923_0297370 | 3300035111 | Unclassified | 763 |
| 414 | Ga0373953_0012970 | 3300035117 | Bacteria | 2965 |
| 415 | Ga0373954_0020195 | 3300035118 | Bacteria | 3011 |
| 416 | Ga0373954_0049523 | 3300035118 | Viruses | 1969 |
| 417 | Ga0373954_0137668 | 3300035118 | Unclassified | 1190 |
| 418 | Ga0373954_0224918 | 3300035118 | Unclassified | 923 |
| 419 | Ga0373956_0005154 | 3300035119 | Bacteria | 5229 |
| 420 | Ga0373956_0010163 | 3300035119 | Bacteria | 3846 |
| 421 | Ga0373957_0002993 | 3300035120 | Bacteria | 4905 |
| 422 | Ga0373943_0329915 | 3300035170 | Bacteria | 871 |
| 423 | Ga0373946_0121661 | 3300035171 | Unclassified | 1192 |
| 424 | Ga0373955_0001650 | 3300035172 | Bacteria | 9544 |
| 425 | Ga0373955_0032672 | 3300035172 | Bacteria | 2734 |
| 426 | Ga0373955_0066929 | 3300035172 | Bacteria | 1998 |
| 427 | Ga0373962_0032310 | 3300035242 | Unclassified | 1439 |
| 428 | Ga0373924_0072411 | 3300035410 | Viruses | 1455 |
| 429 | Ga0373924_0081420 | 3300035410 | Unclassified | 1377 |
| 430 | Ga0373931_0096756 | 3300035691 | Bacteria | 1654 |
| 431 | Ga0373935_0018181 | 3300035692 | Bacteria | 4273 |
| 432 | Ga0373935_0374271 | 3300035692 | Unclassified | 1019 |
| 433 | Ga0373927_0011505 | 3300035695 | Bacteria | 5895 |
| 434 | Ga0373927_0039773 | 3300035695 | Bacteria | 3052 |
| 435 | Ga0373933_0000255 | 3300035724 | Bacteria | 34942 |
| 436 | Ga0373933_0004034 | 3300035724 | Bacteria | 8096 |
| 437 | Ga0373933_0086464 | 3300035724 | Bacteria | 1929 |
| 438 | Ga0373933_0743180 | 3300035724 | Unclassified | 645 |
| 439 | Ga0373947_0096831 | 3300035725 | Bacteria | 1848 |
| 440 | Ga0373937_0000024 | 3300036401 | Bacteria | 125736 |
| 441 | Ga0373937_0015332 | 3300036401 | Bacteria | 6777 |
| 442 | Ga0373937_0047142 | 3300036401 | Bacteria | 3942 |
| 443 | Ga0373937_0115271 | 3300036401 | Bacteria | 2502 |
| 444 | Ga0373925_0073852 | 3300037068 | Bacteria | 2582 |
| 445 | Ga0395898_0685395 | 3300037466 | Unclassified | 967 |
| 446 | Ga0439461_0082996 | 3300041410 | Bacteria | 759 |
| 447 | Ga0439462_0152725 | 3300042015 | Bacteria | 649 |
| 448 | Ga0439446_0033792 | 3300042156 | Bacteria | 1487 |
| 449 | Ga0451577_0206459 | 3300042876 | Bacteria | 1774 |
| 450 | Ga0451577_0982769 | 3300042876 | Unclassified | 758 |
| 451 | Ga0453683_0011965 | 3300044673 | Bacteria | 5701 |
| 452 | Ga0453683_0027338 | 3300044673 | Bacteria | 3620 |
| 453 | Ga0453683_0821980 | 3300044673 | Unclassified | 612 |
| 454 | Ga0466961_0077997 | 3300044693 | Unclassified | 2098 |
| 455 | Ga0466963_0005734 | 3300044694 | Bacteria | 7303 |
| 456 | Ga0453684_0331051 | 3300044712 | Unclassified | 1722 |
| 457 | Ga0451576_0334077 | 3300045051 | Bacteria | 1586 |
| 458 | Ga0451576_0688039 | 3300045051 | Unclassified | 1074 |
| 459 | Ga0495592_0059748 | 3300046454 | Bacteria | 2806 |
| 460 | Ga0495592_0104540 | 3300046454 | Unclassified | 2013 |
| 461 | Ga0495592_0225459 | 3300046454 | Unclassified | 1250 |
| 462 | Ga0495592_0233257 | 3300046454 | Bacteria | 1224 |
| 463 | Ga0495603_0071842 | 3300046455 | Bacteria | 2033 |
| 464 | Ga0495603_0108752 | 3300046455 | Unclassified | 1618 |
| 465 | Ga0495629_0048557 | 3300046459 | Bacteria | 2975 |
| 466 | Ga0495629_0138716 | 3300046459 | Bacteria | 1692 |
| 467 | Ga0495641_0299236 | 3300046461 | Bacteria | 725 |
| 468 | Ga0495651_0000623 | 3300046462 | Bacteria | 27451 |
| 469 | Ga0495651_0001179 | 3300046462 | Bacteria | 20176 |
| 470 | Ga0495651_0002622 | 3300046462 | Bacteria | 13922 |
| 471 | Ga0495651_0015777 | 3300046462 | Bacteria | 5848 |
| 472 | Ga0495651_0067015 | 3300046462 | Bacteria | 2739 |
| 473 | Ga0495653_0005696 | 3300046463 | Bacteria | 10179 |
| 474 | Ga0495653_0021341 | 3300046463 | Bacteria | 5247 |
| 475 | Ga0495653_0091773 | 3300046463 | Bacteria | 2219 |
| 476 | Ga0495653_0096768 | 3300046463 | Bacteria | 2146 |
| 477 | Ga0495653_0619620 | 3300046463 | Unclassified | 663 |
| 478 | Ga0495580_0001722 | 3300046472 | Bacteria | 19228 |
| 479 | Ga0495580_0005362 | 3300046472 | Bacteria | 10619 |
| 480 | Ga0495580_0012721 | 3300046472 | Bacteria | 6450 |
| 481 | Ga0495580_0191241 | 3300046472 | Bacteria | 1411 |
| 482 | Ga0495580_0199996 | 3300046472 | Bacteria | 1377 |
| 483 | Ga0495582_0002504 | 3300046473 | Bacteria | 10226 |
| 484 | Ga0495582_0014596 | 3300046473 | Bacteria | 4315 |
| 485 | Ga0495582_0085591 | 3300046473 | Unclassified | 1754 |
| 486 | Ga0495639_0002454 | 3300046475 | Bacteria | 8100 |
| 487 | Ga0495639_0032953 | 3300046475 | Unclassified | 2312 |
| 488 | Ga0495662_0008869 | 3300046476 | Bacteria | 4939 |
| 489 | Ga0495662_0160156 | 3300046476 | Bacteria | 1109 |
| 490 | Ga0495664_0000812 | 3300046477 | Bacteria | 15991 |
| 491 | Ga0495664_0029033 | 3300046477 | Bacteria | 3233 |
| 492 | Ga0495664_0033167 | 3300046477 | Bacteria | 3034 |
| 493 | Ga0495664_0064146 | 3300046477 | Unclassified | 2190 |
| 494 | Ga0495594_0003417 | 3300046499 | Bacteria | 8196 |
| 495 | Ga0495594_0084851 | 3300046499 | Bacteria | 1771 |
| 496 | Ga0495606_0020034 | 3300046507 | Bacteria | 4948 |
| 497 | Ga0495608_0016322 | 3300046511 | Bacteria | 5137 |
| 498 | Ga0495608_0029946 | 3300046511 | Bacteria | 3688 |
| 499 | Ga0495608_0075491 | 3300046511 | Bacteria | 2197 |
| 500 | Ga0495608_0089977 | 3300046511 | Unclassified | 1986 |
| 501 | Ga0495608_0344127 | 3300046511 | Unclassified | 918 |
| 502 | Ga0495618_0330700 | 3300046514 | Unclassified | 942 |
| 503 | Ga0495618_0580429 | 3300046514 | Bacteria | 669 |
| 504 | Ga0495628_0001969 | 3300046516 | Bacteria | 18613 |
| 505 | Ga0495628_0004301 | 3300046516 | Bacteria | 12658 |
| 506 | Ga0495628_0026320 | 3300046516 | Bacteria | 4745 |
| 507 | Ga0495628_0055808 | 3300046516 | Bacteria | 3111 |
| 508 | Ga0495628_0161800 | 3300046516 | Bacteria | 1701 |
| 509 | Ga0495630_0009732 | 3300046517 | Bacteria | 6915 |
| 510 | Ga0495630_0049799 | 3300046517 | Bacteria | 3135 |
| 511 | Ga0495630_0053224 | 3300046517 | Bacteria | 3030 |
| 512 | Ga0495630_0138825 | 3300046517 | Bacteria | 1847 |
| 513 | Ga0495630_0207808 | 3300046517 | Unclassified | 1494 |
| 514 | Ga0495666_0005082 | 3300046526 | Bacteria | 6655 |
| 515 | Ga0495666_0011777 | 3300046526 | Bacteria | 4360 |
| 516 | Ga0495652_0000918 | 3300046529 | Bacteria | 33886 |
| 517 | Ga0495652_0176320 | 3300046529 | Bacteria | 1645 |
| 518 | Ga0495665_0014946 | 3300046531 | Bacteria | 4180 |
| 519 | Ga0495665_0041902 | 3300046531 | Bacteria | 2437 |
| 520 | Ga0495665_0073987 | 3300046531 | Unclassified | 1794 |
| 521 | Ga0495640_0002656 | 3300046533 | Bacteria | 14364 |
| 522 | Ga0495640_0007941 | 3300046533 | Bacteria | 8344 |
| 523 | Ga0495640_0087190 | 3300046533 | Bacteria | 2065 |
| 524 | Ga0495640_0368222 | 3300046533 | Unclassified | 885 |
| 525 | Ga0495586_0002041 | 3300046535 | Bacteria | 10968 |
| 526 | Ga0495586_0014590 | 3300046535 | Bacteria | 4174 |
| 527 | Ga0495586_0017786 | 3300046535 | Bacteria | 3783 |
| 528 | Ga0495586_0077642 | 3300046535 | Bacteria | 1821 |
| 529 | Ga0495587_0000573 | 3300046536 | Bacteria | 25271 |
| 530 | Ga0495587_0003343 | 3300046536 | Bacteria | 10700 |
| 531 | Ga0495587_0018078 | 3300046536 | Bacteria | 4372 |
| 532 | Ga0495587_0045468 | 3300046536 | Bacteria | 2609 |
| 533 | Ga0495587_0126868 | 3300046536 | Bacteria | 1460 |
| 534 | Ga0495587_0388892 | 3300046536 | Unclassified | 775 |
| 535 | Ga0495609_0057022 | 3300046538 | Bacteria | 1730 |
| 536 | Ga0495645_0035887 | 3300046543 | Bacteria | 3615 |
| 537 | Ga0495645_0067833 | 3300046543 | Bacteria | 2576 |
| 538 | Ga0495645_0442991 | 3300046543 | Bacteria | 820 |
| 539 | Ga0495667_0009115 | 3300046559 | Bacteria | 6738 |
| 540 | Ga0495667_0069082 | 3300046559 | Bacteria | 2306 |
| 541 | Ga0495667_0243759 | 3300046559 | Bacteria | 1144 |
| 542 | Ga0495667_0327584 | 3300046559 | Bacteria | 969 |
| 543 | Ga0495634_0006936 | 3300046642 | Bacteria | 8555 |
| 544 | Ga0495634_0111873 | 3300046642 | Bacteria | 1755 |
| 545 | Ga0495634_0398682 | 3300046642 | Unclassified | 818 |
| 546 | Ga0495635_0009814 | 3300046663 | Bacteria | 6694 |
| 547 | Ga0495635_0017279 | 3300046663 | Bacteria | 5039 |
| 548 | Ga0495635_0029105 | 3300046663 | Bacteria | 3839 |
| 549 | Ga0495659_0030765 | 3300046664 | Bacteria | 1870 |
| 550 | Ga0495657_0027842 | 3300046675 | Bacteria | 3982 |
| 551 | Ga0495657_0045942 | 3300046675 | Bacteria | 2961 |
| 552 | Ga0495657_0075228 | 3300046675 | Viruses | 2195 |
| 553 | Ga0495657_0391973 | 3300046675 | Unclassified | 818 |
| 554 | Ga0495599_0005602 | 3300046678 | Bacteria | 7529 |
| 555 | Ga0495599_0084721 | 3300046678 | Bacteria | 1980 |
| 556 | Ga0495599_0139618 | 3300046678 | Unclassified | 1503 |
| 557 | Ga0495599_0236968 | 3300046678 | Unclassified | 1113 |
| 558 | Ga0495623_0015868 | 3300046679 | Unclassified | 4869 |
| 559 | Ga0495623_0046380 | 3300046679 | Unclassified | 2759 |
| 560 | Ga0495623_0070670 | 3300046679 | Bacteria | 2174 |
| 561 | Ga0495623_0176355 | 3300046679 | Unclassified | 1245 |
| 562 | Ga0495623_0184652 | 3300046679 | Viruses | 1209 |
| 563 | Ga0495646_0002387 | 3300046680 | Bacteria | 11511 |
| 564 | Ga0495646_0007192 | 3300046680 | Bacteria | 7070 |
| 565 | Ga0495646_0105179 | 3300046680 | Bacteria | 1613 |
| 566 | Ga0495647_0005307 | 3300046681 | Bacteria | 4222 |
| 567 | Ga0495658_0040294 | 3300046683 | Unclassified | 2596 |
| 568 | Ga0495658_0092685 | 3300046683 | Bacteria | 1791 |
| 569 | Ga0495658_0458330 | 3300046683 | Bacteria | 815 |
| 570 | Ga0495658_0993084 | 3300046683 | Unclassified | 536 |
| 571 | Ga0495613_0036320 | 3300046689 | Bacteria | 3653 |
| 572 | Ga0495613_0072320 | 3300046689 | Unclassified | 2513 |
| 573 | Ga0495613_0153578 | 3300046689 | Bacteria | 1640 |
| 574 | Ga0495613_0284377 | 3300046689 | Unclassified | 1148 |
| 575 | Ga0495624_0001182 | 3300046690 | Bacteria | 20650 |
| 576 | Ga0495624_0462745 | 3300046690 | Bacteria | 760 |
| 577 | Ga0495624_0648640 | 3300046690 | Bacteria | 628 |
| 578 | Ga0495600_0001600 | 3300046809 | Bacteria | 12600 |
| 579 | Ga0495581_0030499 | 3300047315 | Bacteria | 3124 |
| 580 | Ga0495581_0075734 | 3300047315 | Bacteria | 1946 |
| 581 | Ga0495581_0132027 | 3300047315 | Unclassified | 1455 |
| 582 | Ga0495604_0001035 | 3300047317 | Bacteria | 23212 |
| 583 | Ga0495604_0014816 | 3300047317 | Bacteria | 6217 |
| 584 | Ga0495604_0021772 | 3300047317 | Bacteria | 5118 |
| 585 | Ga0495604_0022367 | 3300047317 | Bacteria | 5049 |
| 586 | Ga0495604_0060643 | 3300047317 | Bacteria | 2896 |
| 587 | Ga0495604_0148307 | 3300047317 | Bacteria | 1669 |
| 588 | Ga0495604_0159631 | 3300047317 | Bacteria | 1594 |
| 589 | Ga0495636_0126624 | 3300047318 | Bacteria | 1134 |
| 590 | Ga0495674_0010925 | 3300047319 | Bacteria | 8577 |
| 591 | Ga0495674_0023040 | 3300047319 | Bacteria | 5738 |
| 592 | Ga0495674_0024764 | 3300047319 | Bacteria | 5510 |
| 593 | Ga0495674_0083505 | 3300047319 | Bacteria | 2738 |
| 594 | Ga0495674_1160984 | 3300047319 | Unclassified | 585 |
| 595 | Ga0495676_0001718 | 3300047321 | Bacteria | 19121 |
| 596 | Ga0495676_0144047 | 3300047321 | Bacteria | 1704 |
| 597 | Ga0495680_0000563 | 3300047322 | Bacteria | 41798 |
| 598 | Ga0495680_0010317 | 3300047322 | Bacteria | 8334 |
| 599 | Ga0495680_0063033 | 3300047322 | Bacteria | 2848 |
| 600 | Ga0495680_0274693 | 3300047322 | Bacteria | 1189 |
| 601 | Ga0495675_0000574 | 3300047444 | Bacteria | 23687 |
| 602 | Ga0495675_0001186 | 3300047444 | Bacteria | 15779 |
| 603 | Ga0495675_0006663 | 3300047444 | Bacteria | 7074 |
| 604 | Ga0495675_0123451 | 3300047444 | Bacteria | 1612 |
| 605 | Ga0495675_0244518 | 3300047444 | Unclassified | 1079 |
| 606 | Ga0495675_0249878 | 3300047444 | Bacteria | 1065 |
| 607 | Ga0495684_0008499 | 3300047471 | Bacteria | 7952 |
| 608 | Ga0495684_0012723 | 3300047471 | Bacteria | 6496 |
| 609 | Ga0495684_0030409 | 3300047471 | Bacteria | 4146 |
| 610 | Ga0495593_0002996 | 3300047673 | Bacteria | 10176 |
| 611 | Ga0495602_0000047 | 3300048088 | Bacteria | 117038 |
| 612 | Ga0495602_0003057 | 3300048088 | Bacteria | 17176 |
| 613 | Ga0495602_0071686 | 3300048088 | Bacteria | 2957 |
| 614 | Ga0495602_0398438 | 3300048088 | Bacteria | 982 |
| 615 | Ga0495614_0000733 | 3300048089 | Bacteria | 13876 |
| 616 | Ga0495614_0002554 | 3300048089 | Bacteria | 8092 |
| 617 | Ga0495614_0176351 | 3300048089 | Unclassified | 960 |
| 618 | Ga0496101_0947963 | 3300048904 | Unclassified | 677 |
| 619 | Ga0496104_0107781 | 3300048907 | Bacteria | 2670 |
| 620 | Ga0496104_0285101 | 3300048907 | Bacteria | 1564 |
| 621 | Ga0496104_1025096 | 3300048907 | Bacteria | 729 |
| 622 | Ga0496106_0049126 | 3300048909 | Bacteria | 3178 |
| 623 | Ga0496107_0076157 | 3300048910 | Bacteria | 2443 |
| 624 | Ga0496107_0628882 | 3300048910 | Bacteria | 792 |
| 625 | Ga0496110_0875501 | 3300048913 | Bacteria | 804 |
| 626 | Ga0496111_0444081 | 3300048914 | Bacteria | 957 |
| 627 | Ga0496114_0036229 | 3300048917 | Bacteria | 4077 |
| 628 | Ga0496114_0036346 | 3300048917 | Bacteria | 4071 |
| 629 | Ga0496114_0105574 | 3300048917 | Bacteria | 2409 |
| 630 | Ga0496115_0005161 | 3300048918 | Bacteria | 9502 |
| 631 | Ga0496115_0023845 | 3300048918 | Bacteria | 4752 |
| 632 | Ga0496115_0065421 | 3300048918 | Bacteria | 2936 |
| 633 | Ga0496115_0549124 | 3300048918 | Bacteria | 924 |
| 634 | Ga0496115_0584050 | 3300048918 | Unclassified | 890 |
| 635 | Ga0501031_0214406 | 3300049568 | Bacteria | 1254 |
| 636 | Ga0501036_0145616 | 3300049572 | Bacteria | 1998 |
| 637 | Ga0501038_0135544 | 3300049574 | Bacteria | 2018 |
| 638 | Ga0501039_0509463 | 3300049575 | Bacteria | 945 |
| 639 | Ga0501039_0723051 | 3300049575 | Bacteria | 778 |
| 640 | Ga0501040_0203983 | 3300049576 | Bacteria | 1404 |
| 641 | Ga0501046_0036234 | 3300049580 | Bacteria | 3972 |
| 642 | Ga0501046_0219723 | 3300049580 | Bacteria | 1407 |
| 643 | Ga0501071_0019679 | 3300049587 | Bacteria | 4686 |
| 644 | Ga0501072_0107026 | 3300049588 | Bacteria | 2224 |
| 645 | Ga0501075_0126752 | 3300049591 | Bacteria | 1944 |
| 646 | Ga0501075_0182803 | 3300049591 | Bacteria | 1599 |
| 647 | Ga0501076_0051885 | 3300049592 | Bacteria | 3247 |
| 648 | Ga0501076_0178514 | 3300049592 | Bacteria | 1731 |
| 649 | Ga0501216_183812 | 3300049660 | Bacteria | 511 |
| 650 | Ga0501224_060748 | 3300049664 | Bacteria | 589 |
| 651 | Ga0501079_0862364 | 3300049741 | Bacteria | 713 |
| 652 | Ga0501080_0335051 | 3300049742 | Bacteria | 1368 |
| 653 | Ga0501081_0199973 | 3300049743 | Bacteria | 1449 |
| 654 | Ga0501083_0524799 | 3300049744 | Bacteria | 771 |
| 655 | Ga0501273_018928 | 3300049770 | Bacteria | 920 |
| 656 | Ga0501045_0423525 | 3300049824 | Bacteria | 990 |
| 657 | Ga0501045_0953036 | 3300049824 | Bacteria | 630 |
| 658 | Ga0501204_026486 | 3300049850 | Bacteria | 785 |
| 659 | nmdc:mga0n895_148529_c1 | 3300050512 | Bacteria | 2373 |
| 660 | nmdc:mga0n895_38954_c1 | 3300050512 | Bacteria | 4608 |
| 661 | nmdc:mga0rr50_11971_c1 | 3300050513 | Bacteria | 5582 |
| 662 | nmdc:mga0rr50_76805_c1 | 3300050513 | Bacteria | 2565 |
| 663 | nmdc:mga08x19_11823_c1 | 3300050514 | Bacteria | 5252 |
| 664 | nmdc:mga08x19_1318917_c1 | 3300050514 | Unclassified | 511 |
| 665 | nmdc:mga08x19_201380_c1 | 3300050514 | Bacteria | 1365 |
| 666 | nmdc:mga08x19_427254_c1 | 3300050514 | Unclassified | 931 |
| 667 | nmdc:mga0a205_1335152_c1 | 3300050515 | Unclassified | 565 |
| 668 | nmdc:mga0a205_838018_c1 | 3300050515 | Bacteria | 767 |
| 669 | Ga0495601_0304446 | 3300053077 | Unclassified | 1038 |
| 670 | Ga0495601_0860052 | 3300053077 | Unclassified | 574 |
| 671 | Ga0495612_0011530 | 3300053078 | Bacteria | 3562 |
| 672 | Ga0495619_0024584 | 3300053085 | Bacteria | 3865 |
| 673 | Ga0495619_1130526 | 3300053085 | Unclassified | 520 |
| 674 | Ga0501084_0087325 | 3300054114 | Bacteria | 2619 |
| 675 | Ga0501084_1501958 | 3300054114 | Bacteria | 564 |
| 676 | Ga0501082_0039709 | 3300060353 | Bacteria | 4060 |
| 677 | Ga0501082_0677027 | 3300060353 | Bacteria | 903 |
| 678 | Ga0495651_0366449 | |||
| 679 | rootH2_10199925 | |||
| 680 | rootL2_10246079 | |||
| 681 | Ga0058863_11605999 | |||
| 682 | Ga0065707_10607157 | |||
| 683 | Ga0070658_10258783 | |||
| 684 | Ga0070683_100008264 | |||
| 685 | Ga0070683_100011263 | |||
| 686 | Ga0070683_100016614 | |||
| 687 | Ga0070683_100021118 | |||
| 688 | Ga0070670_100004107 | |||
| 689 | Ga0068869_100013389 | |||
| 690 | Ga0070666_10192247 | |||
| 691 | Ga0070680_100399436 | |||
| 692 | Ga0068868_100019486 | |||
| 693 | Ga0070661_100012678 | |||
| 694 | Ga0070661_100111862 | |||
| 695 | Ga0070661_100318208 | |||
| 696 | Ga0070661_100512781 | |||
| 697 | Ga0070671_100024373 | |||
| 698 | Ga0070709_10020038 | |||
| 699 | Ga0070709_10049113 | |||
| 700 | Ga0070709_10077053 | |||
| 701 | Ga0070709_10119198 | |||
| 702 | Ga0070714_101238363 | |||
| 703 | Ga0070713_100098044 | |||
| 704 | Ga0070713_100116677 | |||
| 705 | Ga0070713_100153545 | |||
| 706 | Ga0070713_100389605 | |||
| 707 | Ga0070713_101114221 | |||
| 708 | Ga0070713_101114631 | |||
| 709 | Ga0070710_10104944 | |||
| 710 | Ga0070710_10335222 | |||
| 711 | Ga0070710_10356281 | |||
| 712 | Ga0070711_100023435 | |||
| 713 | Ga0070711_100080987 | |||
| 714 | Ga0070711_100141898 | |||
| 715 | Ga0070711_100348838 | |||
| 716 | Ga0070711_100579371 | |||
| 717 | Ga0070711_100593705 | |||
| 718 | Ga0070711_101313255 | |||
| 719 | Ga0070694_101196361 | |||
| 720 | Ga0070708_100019803 | |||
| 721 | Ga0070708_100044919 | |||
| 722 | Ga0070708_100061638 | |||
| 723 | Ga0070708_100141526 | |||
| 724 | Ga0070708_101000672 | |||
| 725 | Ga0070708_101519981 | |||
| 726 | Ga0070663_100741937 | |||
| 727 | Ga0070706_100769765 | |||
| 728 | Ga0070706_100784833 | |||
| 729 | Ga0070706_100789137 | |||
| 730 | Ga0070707_100000431 | |||
| 731 | Ga0070707_100013899 | |||
| 732 | Ga0070707_100294932 | |||
| 733 | Ga0070707_100303243 | |||
| 734 | Ga0070707_100825329 | |||
| 735 | Ga0070707_101012747 | |||
| 736 | Ga0070707_101073318 | |||
| 737 | Ga0070698_100019225 | |||
| 738 | Ga0070698_100114902 | |||
| 739 | Ga0070698_100323648 | |||
| 740 | Ga0070699_100093961 | |||
| 741 | Ga0070699_100708696 | |||
| 742 | Ga0070699_101184055 | |||
| 743 | Ga0070684_100009424 | |||
| 744 | Ga0070684_100013697 | |||
| 745 | Ga0070684_100072152 | |||
| 746 | Ga0070684_100086693 | |||
| 747 | Ga0070697_100076172 | |||
| 748 | Ga0070697_100474859 | |||
| 749 | Ga0068853_100463841 | |||
| 750 | Ga0070693_101321048 | |||
| 751 | Ga0070665_100001094 | |||
| 752 | Ga0070665_100064862 | |||
| 753 | Ga0070665_101204793 | |||
| 754 | Ga0070704_100429438 | |||
| 755 | Ga0068855_100009736 | |||
| 756 | Ga0068855_100020319 | |||
| 757 | Ga0068855_100092795 | |||
| 758 | Ga0068855_100143942 | |||
| 759 | Ga0070664_100515712 | |||
| 760 | Ga0068857_100086014 | |||
| 761 | Ga0068857_100150454 | |||
| 762 | Ga0068854_100035457 | |||
| 763 | Ga0068854_100285554 | |||
| 764 | Ga0068854_100360080 | |||
| 765 | Ga0068856_100015444 | |||
| 766 | Ga0068856_100018943 | |||
| 767 | Ga0068856_100036617 | |||
| 768 | Ga0068856_100050127 | |||
| 769 | Ga0068856_100103712 | |||
| 770 | Ga0068856_100181463 | |||
| 771 | Ga0068856_100650182 | |||
| 772 | Ga0068856_101608623 | |||
| 773 | Ga0068852_100000027 | |||
| 774 | Ga0068852_100001031 | |||
| 775 | Ga0068852_100485643 | |||
| 776 | Ga0068859_100025020 | |||
| 777 | Ga0068859_100425046 | |||
| 778 | Ga0068859_101469553 | |||
| 779 | Ga0068864_100104895 | |||
| 780 | Ga0068851_10083468 | |||
| 781 | Ga0068851_10416521 | |||
| 782 | Ga0068863_100011627 | |||
| 783 | Ga0068863_100056888 | |||
| 784 | Ga0068858_100214743 | |||
| 785 | Ga0068860_100336290 | |||
| 786 | Ga0068860_100745095 | |||
| 787 | Ga0068862_100017528 | |||
| 788 | Ga0081455_10168891 | |||
| 789 | Ga0070717_10276245 | |||
| 790 | Ga0070717_10545355 | |||
| 791 | Ga0070717_10703607 | |||
| 792 | Ga0070715_10023904 | |||
| 793 | Ga0070715_10362735 | |||
| 794 | Ga0070715_10638107 | |||
| 795 | Ga0070716_100013287 | |||
| 796 | Ga0070716_100019546 | |||
| 797 | Ga0070716_100037814 | |||
| 798 | Ga0070716_100065902 | |||
| 799 | Ga0070712_100043588 | |||
| 800 | Ga0070712_100050252 | |||
| 801 | Ga0070712_100054192 | |||
| 802 | Ga0070712_100056014 | |||
| 803 | Ga0070712_100080094 | |||
| 804 | Ga0070712_100153092 | |||
| 805 | Ga0070712_100158200 | |||
| 806 | Ga0070712_100161970 | |||
| 807 | Ga0070712_101649400 | |||
| 808 | Ga0097621_100011589 | |||
| 809 | Ga0097621_100411103 | |||
| 810 | Ga0068871_100003269 | |||
| 811 | Ga0068871_100066745 | |||
| 812 | Ga0068871_100263825 | |||
| 813 | Ga0068871_100301668 | |||
| 814 | Ga0075433_10607402 | |||
| 815 | Ga0075434_100032294 | |||
| 816 | Ga0075434_100045338 | |||
| 817 | Ga0075434_100255245 | |||
| 818 | Ga0075436_100066362 | |||
| 819 | Ga0075436_100444580 | |||
| 820 | Ga0075436_100630467 | |||
| 821 | Ga0075436_101275320 | |||
| 822 | Ga0097620_100025019 | |||
| 823 | Ga0097620_100425024 | |||
| 824 | Ga0097620_101469345 | |||
| 825 | Ga0075435_100011740 | |||
| 826 | Ga0075435_100030126 | |||
| 827 | Ga0075435_100608019 | |||
| 828 | Ga0099794_10006038 | |||
| 829 | Ga0099794_10010358 | |||
| 830 | Ga0099794_10011444 | |||
| 831 | Ga0099794_10015811 | |||
| 832 | Ga0099794_10018947 | |||
| 833 | Ga0099794_10021825 | |||
| 834 | Ga0099794_10024858 | |||
| 835 | Ga0099794_10159537 | |||
| 836 | Ga0099794_10191722 | |||
| 837 | Ga0099794_10371623 | |||
| 838 | Ga0099794_10433810 | |||
| 839 | Ga0099795_10006131 | |||
| 840 | Ga0105240_10000222 | |||
| 841 | Ga0105240_10009545 | |||
| 842 | Ga0105240_10017302 | |||
| 843 | Ga0105240_10022449 | |||
| 844 | Ga0105240_10036406 | |||
| 845 | Ga0105240_10037854 | |||
| 846 | Ga0105240_10057777 | |||
| 847 | Ga0105240_10094409 | |||
| 848 | Ga0105240_10135919 | |||
| 849 | Ga0105240_10163842 | |||
| 850 | Ga0105245_10013731 | |||
| 851 | Ga0105245_10386963 | |||
| 852 | Ga0105245_11165211 | |||
| 853 | Ga0105247_10049229 | |||
| 854 | Ga0105241_10013924 | |||
| 855 | Ga0105241_10026446 | |||
| 856 | Ga0105241_10028981 | |||
| 857 | Ga0105242_10190777 | |||
| 858 | Ga0105248_10004245 | |||
| 859 | Ga0105248_10083347 | |||
| 860 | Ga0105248_10230390 | |||
| 861 | Ga0105248_10243342 | |||
| 862 | Ga0105248_10598913 | |||
| 863 | Ga0105237_10049734 | |||
| 864 | Ga0105237_10164145 | |||
| 865 | Ga0105237_10853268 | |||
| 866 | Ga0105238_10003154 | |||
| 867 | Ga0105238_10003324 | |||
| 868 | Ga0105238_10003810 | |||
| 869 | Ga0105238_10018040 | |||
| 870 | Ga0099796_10002148 | |||
| 871 | Ga0099796_10195063 | |||
| 872 | Ga0099796_10343592 | |||
| 873 | Ga0105239_10002686 | |||
| 874 | Ga0105239_10818175 | |||
| 875 | Ga0157373_10050643 | |||
| 876 | Ga0157373_10697413 | |||
| 877 | Ga0157370_10000012 | |||
| 878 | Ga0157369_10000112 | |||
| 879 | Ga0157369_10003619 | |||
| 880 | Ga0157369_10007463 | |||
| 881 | Ga0157369_10042848 | |||
| 882 | Ga0157369_11103806 | |||
| 883 | Ga0157374_10003427 | |||
| 884 | Ga0157374_10018378 | |||
| 885 | Ga0157374_10431015 | |||
| 886 | Ga0157374_11659537 | |||
| 887 | Ga0157378_10004815 | |||
| 888 | Ga0157378_10008730 | |||
| 889 | Ga0157378_10016708 | |||
| 890 | Ga0157378_10692887 | |||
| 891 | Ga0163162_10002090 | |||
| 892 | Ga0163162_10020335 | |||
| 893 | Ga0163162_10080351 | |||
| 894 | Ga0157372_10000111 | |||
| 895 | Ga0157372_10005629 | |||
| 896 | Ga0157372_10200131 | |||
| 897 | Ga0157372_10264778 | |||
| 898 | Ga0157372_10326125 | |||
| 899 | Ga0157372_10553446 | |||
| 900 | Ga0157372_10904655 | |||
| 901 | Ga0157375_10091391 | |||
| 902 | Ga0157375_10136245 | |||
| 903 | Ga0157375_10814970 | |||
| 904 | Ga0163163_10105291 | |||
| 905 | Ga0157379_10014423 | |||
| 906 | Ga0157379_10107169 | |||
| 907 | Ga0157379_10120873 | |||
| 908 | Ga0157379_10355627 | |||
| 909 | Ga0157376_10000050 | |||
| 910 | Ga0157376_10013325 | |||
| 911 | Ga0157376_10019536 | |||
| 912 | Ga0206356_10885676 | |||
| 913 | Ga0206356_11019469 | |||
| 914 | Ga0206349_1762153 | |||
| 915 | Ga0206350_11179382 | |||
| 916 | Ga0207692_10124375 | |||
| 917 | Ga0207692_10341710 | |||
| 918 | Ga0207642_10587265 | |||
| 919 | Ga0207710_10005185 | |||
| 920 | Ga0207685_10304423 | |||
| 921 | Ga0207685_10517407 | |||
| 922 | Ga0207699_10028329 | |||
| 923 | Ga0207699_10104299 | |||
| 924 | Ga0207699_10144802 | |||
| 925 | Ga0207699_10165376 | |||
| 926 | Ga0207699_10177236 | |||
| 927 | Ga0207705_10491120 | |||
| 928 | Ga0207684_10295727 | |||
| 929 | Ga0207654_10048037 | |||
| 930 | Ga0207654_10715390 | |||
| 931 | Ga0207695_10000028 | |||
| 932 | Ga0207695_10000814 | |||
| 933 | Ga0207695_10001044 | |||
| 934 | Ga0207695_10010410 | |||
| 935 | Ga0207695_10023756 | |||
| 936 | Ga0207695_10088037 | |||
| 937 | Ga0207695_10091340 | |||
| 938 | Ga0207695_10140393 | |||
| 939 | Ga0207695_10203628 | |||
| 940 | Ga0207695_10695778 | |||
| 941 | Ga0207671_10009652 | |||
| 942 | Ga0207671_10046798 | |||
| 943 | Ga0207671_10226218 | |||
| 944 | Ga0207671_10301744 | |||
| 945 | Ga0207693_10011413 | |||
| 946 | Ga0207693_10039952 | |||
| 947 | Ga0207693_10056083 | |||
| 948 | Ga0207693_10089142 | |||
| 949 | Ga0207693_10089610 | |||
| 950 | Ga0207693_10104954 | |||
| 951 | Ga0207693_10526336 | |||
| 952 | Ga0207693_10577355 | |||
| 953 | Ga0207663_10030334 | |||
| 954 | Ga0207663_10204799 | |||
| 955 | Ga0207649_10064142 | |||
| 956 | Ga0207649_10075809 | |||
| 957 | Ga0207649_10377851 | |||
| 958 | Ga0207646_10000801 | |||
| 959 | Ga0207646_10023069 | |||
| 960 | Ga0207646_10092749 | |||
| 961 | Ga0207646_10338727 | |||
| 962 | Ga0207694_10000209 | |||
| 963 | Ga0207694_10008257 | |||
| 964 | Ga0207694_10017631 | |||
| 965 | Ga0207694_10018694 | |||
| 966 | Ga0207694_10027390 | |||
| 967 | Ga0207650_10389745 | |||
| 968 | Ga0207687_10053184 | |||
| 969 | Ga0207700_10049753 | |||
| 970 | Ga0207700_10078787 | |||
| 971 | Ga0207700_10130114 | |||
| 972 | Ga0207700_10502725 | |||
| 973 | Ga0207664_10651834 | |||
| 974 | Ga0207644_10188777 | |||
| 975 | Ga0207644_10406722 | |||
| 976 | Ga0207686_11281442 | |||
| 977 | Ga0207704_10273753 | |||
| 978 | Ga0207665_10000310 | |||
| 979 | Ga0207665_10004114 | |||
| 980 | Ga0207665_10065972 | |||
| 981 | Ga0207665_10092321 | |||
| 982 | Ga0207665_10390038 | |||
| 983 | Ga0207711_10000016 | |||
| 984 | Ga0207711_10010564 | |||
| 985 | Ga0207711_10152689 | |||
| 986 | Ga0207711_10169706 | |||
| 987 | Ga0207689_10010248 | |||
| 988 | Ga0207661_10007289 | |||
| 989 | Ga0207661_10053174 | |||
| 990 | Ga0207667_10030755 | |||
| 991 | Ga0207667_10855253 | |||
| 992 | Ga0207651_11734815 | |||
| 993 | Ga0207640_10013935 | |||
| 994 | Ga0207640_10041411 | |||
| 995 | Ga0207703_10203708 | |||
| 996 | Ga0207639_10000123 | |||
| 997 | Ga0207678_10010432 | |||
| 998 | Ga0207678_10568622 | |||
| 999 | Ga0207702_10002242 | |||
| 1000 | Ga0207702_10032038 | |||
| 1001 | Ga0207702_10172625 | |||
| 1002 | Ga0207702_10196271 | |||
| 1003 | Ga0207702_10200418 | |||
| 1004 | Ga0207702_10375579 | |||
| 1005 | Ga0207702_11330133 | |||
| 1006 | Ga0207641_10002903 | |||
| 1007 | Ga0207641_10215551 | |||
| 1008 | Ga0207676_10040093 | |||
| 1009 | Ga0207674_10005850 | |||
| 1010 | Ga0207674_10016521 | |||
| 1011 | Ga0207674_10099817 | |||
| 1012 | Ga0207698_10000021 | |||
| 1013 | Ga0209179_1017755 | |||
| 1014 | Ga0209588_1001083 | |||
| 1015 | Ga0209588_1003500 | |||
| 1016 | Ga0209588_1005643 | |||
| 1017 | Ga0209588_1017715 | |||
| 1018 | Ga0209588_1076607 | |||
| 1019 | Ga0268266_10001110 | |||
| 1020 | Ga0268266_10044705 | |||
| 1021 | Ga0268266_11102229 | |||
| 1022 | Ga0268265_10527185 | |||
| 1023 | Ga0268264_10069624 | |||
| 1024 | Ga0265319_1000229 | |||
| 1025 | Ga0265318_10000111 | |||
| 1026 | Ga0265338_10089086 | |||
| 1027 | Ga0265338_10158728 | |||
| 1028 | Ga0265338_10158906 | |||
| 1029 | Ga0265338_10198175 | |||
| 1030 | Ga0265338_10565930 | |||
| 1031 | Ga0265338_10838858 | |||
| 1032 | Ga0265324_10070705 | |||
| 1033 | Ga0265770_1001674 | |||
| 1034 | Ga0265760_10073886 | |||
| 1035 | Ga0265760_10094213 | |||
| 1036 | Ga0265330_10297321 | |||
| 1037 | Ga0265332_10032746 | |||
| 1038 | Ga0265328_10020083 | |||
| 1039 | Ga0265328_10043345 | |||
| 1040 | Ga0265320_10000087 | |||
| 1041 | Ga0265325_10008582 | |||
| 1042 | Ga0265325_10068265 | |||
| 1043 | Ga0265325_10095008 | |||
| 1044 | Ga0265325_10170887 | |||
| 1045 | Ga0265325_10384388 | |||
| 1046 | Ga0265329_10000111 | |||
| 1047 | Ga0265329_10007569 | |||
| 1048 | Ga0265340_10016482 | |||
| 1049 | Ga0265340_10040866 | |||
| 1050 | Ga0265339_10000011 | |||
| 1051 | Ga0265339_10002905 | |||
| 1052 | Ga0265339_10014051 | |||
| 1053 | Ga0265339_10088354 | |||
| 1054 | Ga0265339_10201934 | |||
| 1055 | Ga0265331_10000169 | |||
| 1056 | Ga0265331_10007640 | |||
| 1057 | Ga0265331_10010096 | |||
| 1058 | Ga0265316_10000220 | |||
| 1059 | Ga0265316_10006161 | |||
| 1060 | Ga0265316_10013059 | |||
| 1061 | Ga0265316_10105563 | |||
| 1062 | Ga0265316_10150592 | |||
| 1063 | Ga0265316_10278820 | |||
| 1064 | Ga0265316_10304206 | |||
| 1065 | Ga0265316_10606667 | |||
| 1066 | Ga0307408_100018791 | |||
| 1067 | Ga0265313_10000867 | |||
| 1068 | Ga0265313_10230301 | |||
| 1069 | Ga0265314_10000067 | |||
| 1070 | Ga0265314_10032239 | |||
| 1071 | Ga0265314_10348274 | |||
| 1072 | Ga0265342_10000435 | |||
| 1073 | Ga0265342_10002210 | |||
| 1074 | Ga0265342_10044490 | |||
| 1075 | Ga0265342_10260940 | |||
| 1076 | Ga0307405_10544192 | |||
| 1077 | Ga0307413_10025902 | |||
| 1078 | Ga0307410_10004263 | |||
| 1079 | Ga0307406_10087875 | |||
| 1080 | Ga0307407_10137989 | |||
| 1081 | Ga0307409_100064241 | |||
| 1082 | Ga0307416_100027929 | |||
| 1083 | Ga0307414_10054871 | |||
| 1084 | Ga0307411_10014131 | |||
| 1085 | Ga0307415_100059623 | |||
| 1086 | Ga0373928_0051974 | |||
| 1087 | Ga0373934_0006003 | |||
| 1088 | Ga0373934_0153821 | |||
| 1089 | Ga0373923_0007982 | |||
| 1090 | Ga0373923_0297370 | |||
| 1091 | Ga0373953_0012970 | |||
| 1092 | Ga0373954_0020195 | |||
| 1093 | Ga0373954_0049523 | |||
| 1094 | Ga0373954_0137668 | |||
| 1095 | Ga0373954_0224918 | |||
| 1096 | Ga0373956_0005154 | |||
| 1097 | Ga0373956_0010163 | |||
| 1098 | Ga0373957_0002993 | |||
| 1099 | Ga0373943_0329915 | |||
| 1100 | Ga0373946_0121661 | |||
| 1101 | Ga0373955_0001650 | |||
| 1102 | Ga0373955_0032672 | |||
| 1103 | Ga0373955_0066929 | |||
| 1104 | Ga0373962_0032310 | |||
| 1105 | Ga0373924_0072411 | |||
| 1106 | Ga0373924_0081420 | |||
| 1107 | Ga0373931_0096756 | |||
| 1108 | Ga0373935_0018181 | |||
| 1109 | Ga0373935_0374271 | |||
| 1110 | Ga0373927_0011505 | |||
| 1111 | Ga0373927_0039773 | |||
| 1112 | Ga0373933_0000255 | |||
| 1113 | Ga0373933_0004034 | |||
| 1114 | Ga0373933_0086464 | |||
| 1115 | Ga0373933_0743180 | |||
| 1116 | Ga0373947_0096831 | |||
| 1117 | Ga0373937_0000024 | |||
| 1118 | Ga0373937_0015332 | |||
| 1119 | Ga0373937_0047142 | |||
| 1120 | Ga0373937_0115271 | |||
| 1121 | Ga0373925_0073852 | |||
| 1122 | Ga0395898_0685395 | |||
| 1123 | Ga0439461_0082996 | |||
| 1124 | Ga0439462_0152725 | |||
| 1125 | Ga0439446_0033792 | |||
| 1126 | Ga0451577_0206459 | |||
| 1127 | Ga0451577_0982769 | |||
| 1128 | Ga0453683_0011965 | |||
| 1129 | Ga0453683_0027338 | |||
| 1130 | Ga0453683_0821980 | |||
| 1131 | Ga0466961_0077997 | |||
| 1132 | Ga0466963_0005734 | |||
| 1133 | Ga0453684_0331051 | |||
| 1134 | Ga0451576_0334077 | |||
| 1135 | Ga0451576_0688039 | |||
| 1136 | Ga0495592_0059748 | |||
| 1137 | Ga0495592_0104540 | |||
| 1138 | Ga0495592_0225459 | |||
| 1139 | Ga0495592_0233257 | |||
| 1140 | Ga0495603_0071842 | |||
| 1141 | Ga0495603_0108752 | |||
| 1142 | Ga0495629_0048557 | |||
| 1143 | Ga0495629_0138716 | |||
| 1144 | Ga0495641_0299236 | |||
| 1145 | Ga0495651_0000623 | |||
| 1146 | Ga0495651_0001179 | |||
| 1147 | Ga0495651_0002622 | |||
| 1148 | Ga0495651_0015777 | |||
| 1149 | Ga0495651_0067015 | |||
| 1150 | Ga0495653_0005696 | |||
| 1151 | Ga0495653_0021341 | |||
| 1152 | Ga0495653_0091773 | |||
| 1153 | Ga0495653_0096768 | |||
| 1154 | Ga0495653_0619620 | |||
| 1155 | Ga0495580_0001722 | |||
| 1156 | Ga0495580_0005362 | |||
| 1157 | Ga0495580_0012721 | |||
| 1158 | Ga0495580_0191241 | |||
| 1159 | Ga0495580_0199996 | |||
| 1160 | Ga0495582_0002504 | |||
| 1161 | Ga0495582_0014596 | |||
| 1162 | Ga0495582_0085591 | |||
| 1163 | Ga0495639_0002454 | |||
| 1164 | Ga0495639_0032953 | |||
| 1165 | Ga0495662_0008869 | |||
| 1166 | Ga0495662_0160156 | |||
| 1167 | Ga0495664_0000812 | |||
| 1168 | Ga0495664_0029033 | |||
| 1169 | Ga0495664_0033167 | |||
| 1170 | Ga0495664_0064146 | |||
| 1171 | Ga0495594_0003417 | |||
| 1172 | Ga0495594_0084851 | |||
| 1173 | Ga0495606_0020034 | |||
| 1174 | Ga0495608_0016322 | |||
| 1175 | Ga0495608_0029946 | |||
| 1176 | Ga0495608_0075491 | |||
| 1177 | Ga0495608_0089977 | |||
| 1178 | Ga0495608_0344127 | |||
| 1179 | Ga0495618_0330700 | |||
| 1180 | Ga0495618_0580429 | |||
| 1181 | Ga0495628_0001969 | |||
| 1182 | Ga0495628_0004301 | |||
| 1183 | Ga0495628_0026320 | |||
| 1184 | Ga0495628_0055808 | |||
| 1185 | Ga0495628_0161800 | |||
| 1186 | Ga0495630_0009732 | |||
| 1187 | Ga0495630_0049799 | |||
| 1188 | Ga0495630_0053224 | |||
| 1189 | Ga0495630_0138825 | |||
| 1190 | Ga0495630_0207808 | |||
| 1191 | Ga0495666_0005082 | |||
| 1192 | Ga0495666_0011777 | |||
| 1193 | Ga0495652_0000918 | |||
| 1194 | Ga0495652_0176320 | |||
| 1195 | Ga0495665_0014946 | |||
| 1196 | Ga0495665_0041902 | |||
| 1197 | Ga0495665_0073987 | |||
| 1198 | Ga0495640_0002656 | |||
| 1199 | Ga0495640_0007941 | |||
| 1200 | Ga0495640_0087190 | |||
| 1201 | Ga0495640_0368222 | |||
| 1202 | Ga0495586_0002041 | |||
| 1203 | Ga0495586_0014590 | |||
| 1204 | Ga0495586_0017786 | |||
| 1205 | Ga0495586_0077642 | |||
| 1206 | Ga0495587_0000573 | |||
| 1207 | Ga0495587_0003343 | |||
| 1208 | Ga0495587_0018078 | |||
| 1209 | Ga0495587_0045468 | |||
| 1210 | Ga0495587_0126868 | |||
| 1211 | Ga0495587_0388892 | |||
| 1212 | Ga0495609_0057022 | |||
| 1213 | Ga0495645_0035887 | |||
| 1214 | Ga0495645_0067833 | |||
| 1215 | Ga0495645_0442991 | |||
| 1216 | Ga0495667_0009115 | |||
| 1217 | Ga0495667_0069082 | |||
| 1218 | Ga0495667_0243759 | |||
| 1219 | Ga0495667_0327584 | |||
| 1220 | Ga0495634_0006936 | |||
| 1221 | Ga0495634_0111873 | |||
| 1222 | Ga0495634_0398682 | |||
| 1223 | Ga0495635_0009814 | |||
| 1224 | Ga0495635_0017279 | |||
| 1225 | Ga0495635_0029105 | |||
| 1226 | Ga0495659_0030765 | |||
| 1227 | Ga0495657_0027842 | |||
| 1228 | Ga0495657_0045942 | |||
| 1229 | Ga0495657_0075228 | |||
| 1230 | Ga0495657_0391973 | |||
| 1231 | Ga0495599_0005602 | |||
| 1232 | Ga0495599_0084721 | |||
| 1233 | Ga0495599_0139618 | |||
| 1234 | Ga0495599_0236968 | |||
| 1235 | Ga0495623_0015868 | |||
| 1236 | Ga0495623_0046380 | |||
| 1237 | Ga0495623_0070670 | |||
| 1238 | Ga0495623_0176355 | |||
| 1239 | Ga0495623_0184652 | |||
| 1240 | Ga0495646_0002387 | |||
| 1241 | Ga0495646_0007192 | |||
| 1242 | Ga0495646_0105179 | |||
| 1243 | Ga0495647_0005307 | |||
| 1244 | Ga0495658_0040294 | |||
| 1245 | Ga0495658_0092685 | |||
| 1246 | Ga0495658_0458330 | |||
| 1247 | Ga0495658_0993084 | |||
| 1248 | Ga0495613_0036320 | |||
| 1249 | Ga0495613_0072320 | |||
| 1250 | Ga0495613_0153578 | |||
| 1251 | Ga0495613_0284377 | |||
| 1252 | Ga0495624_0001182 | |||
| 1253 | Ga0495624_0462745 | |||
| 1254 | Ga0495624_0648640 | |||
| 1255 | Ga0495600_0001600 | |||
| 1256 | Ga0495581_0030499 | |||
| 1257 | Ga0495581_0075734 | |||
| 1258 | Ga0495581_0132027 | |||
| 1259 | Ga0495604_0001035 | |||
| 1260 | Ga0495604_0014816 | |||
| 1261 | Ga0495604_0021772 | |||
| 1262 | Ga0495604_0022367 | |||
| 1263 | Ga0495604_0060643 | |||
| 1264 | Ga0495604_0148307 | |||
| 1265 | Ga0495604_0159631 | |||
| 1266 | Ga0495636_0126624 | |||
| 1267 | Ga0495674_0010925 | |||
| 1268 | Ga0495674_0023040 | |||
| 1269 | Ga0495674_0024764 | |||
| 1270 | Ga0495674_0083505 | |||
| 1271 | Ga0495674_1160984 | |||
| 1272 | Ga0495676_0001718 | |||
| 1273 | Ga0495676_0144047 | |||
| 1274 | Ga0495680_0000563 | |||
| 1275 | Ga0495680_0010317 | |||
| 1276 | Ga0495680_0063033 | |||
| 1277 | Ga0495680_0274693 | |||
| 1278 | Ga0495675_0000574 | |||
| 1279 | Ga0495675_0001186 | |||
| 1280 | Ga0495675_0006663 | |||
| 1281 | Ga0495675_0123451 | |||
| 1282 | Ga0495675_0244518 | |||
| 1283 | Ga0495675_0249878 | |||
| 1284 | Ga0495684_0008499 | |||
| 1285 | Ga0495684_0012723 | |||
| 1286 | Ga0495684_0030409 | |||
| 1287 | Ga0495593_0002996 | |||
| 1288 | Ga0495602_0000047 | |||
| 1289 | Ga0495602_0003057 | |||
| 1290 | Ga0495602_0071686 | |||
| 1291 | Ga0495602_0398438 | |||
| 1292 | Ga0495614_0000733 | |||
| 1293 | Ga0495614_0002554 | |||
| 1294 | Ga0495614_0176351 | |||
| 1295 | Ga0496101_0947963 | |||
| 1296 | Ga0496104_0107781 | |||
| 1297 | Ga0496104_0285101 | |||
| 1298 | Ga0496104_1025096 | |||
| 1299 | Ga0496106_0049126 | |||
| 1300 | Ga0496107_0076157 | |||
| 1301 | Ga0496107_0628882 | |||
| 1302 | Ga0496110_0875501 | |||
| 1303 | Ga0496111_0444081 | |||
| 1304 | Ga0496114_0036229 | |||
| 1305 | Ga0496114_0036346 | |||
| 1306 | Ga0496114_0105574 | |||
| 1307 | Ga0496115_0005161 | |||
| 1308 | Ga0496115_0023845 | |||
| 1309 | Ga0496115_0065421 | |||
| 1310 | Ga0496115_0549124 | |||
| 1311 | Ga0496115_0584050 | |||
| 1312 | Ga0501031_0214406 | |||
| 1313 | Ga0501036_0145616 | |||
| 1314 | Ga0501038_0135544 | |||
| 1315 | Ga0501039_0509463 | |||
| 1316 | Ga0501039_0723051 | |||
| 1317 | Ga0501040_0203983 | |||
| 1318 | Ga0501046_0036234 | |||
| 1319 | Ga0501046_0219723 | |||
| 1320 | Ga0501071_0019679 | |||
| 1321 | Ga0501072_0107026 | |||
| 1322 | Ga0501075_0126752 | |||
| 1323 | Ga0501075_0182803 | |||
| 1324 | Ga0501076_0051885 | |||
| 1325 | Ga0501076_0178514 | |||
| 1326 | Ga0501216_183812 | |||
| 1327 | Ga0501224_060748 | |||
| 1328 | Ga0501079_0862364 | |||
| 1329 | Ga0501080_0335051 | |||
| 1330 | Ga0501081_0199973 | |||
| 1331 | Ga0501083_0524799 | |||
| 1332 | Ga0501273_018928 | |||
| 1333 | Ga0501045_0423525 | |||
| 1334 | Ga0501045_0953036 | |||
| 1335 | Ga0501204_026486 | |||
| 1336 | nmdc:mga0n895_148529_c1 | |||
| 1337 | nmdc:mga0n895_38954_c1 | |||
| 1338 | nmdc:mga0rr50_11971_c1 | |||
| 1339 | nmdc:mga0rr50_76805_c1 | |||
| 1340 | nmdc:mga08x19_11823_c1 | |||
| 1341 | nmdc:mga08x19_1318917_c1 | |||
| 1342 | nmdc:mga08x19_201380_c1 | |||
| 1343 | nmdc:mga08x19_427254_c1 | |||
| 1344 | nmdc:mga0a205_1335152_c1 | |||
| 1345 | nmdc:mga0a205_838018_c1 | |||
| 1346 | Ga0495601_0304446 | |||
| 1347 | Ga0495601_0860052 | |||
| 1348 | Ga0495612_0011530 | |||
| 1349 | Ga0495619_0024584 | |||
| 1350 | Ga0495619_1130526 | |||
| 1351 | Ga0501084_0087325 | |||
| 1352 | Ga0501084_1501958 | |||
| 1353 | Ga0501082_0039709 | |||
| 1354 | Ga0501082_0677027 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ld9-assembly1.cif.gz_A | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8757 | 2 | 143 |
| 5ld9-assembly1.cif.gz_A | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8568 | 2 | 143 |
| 5ld9-assembly1.cif.gz_B | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8531 | 1 | 143 |
| 5ld9-assembly1.cif.gz_B | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8407 | 1 | 143 |
| 2kks-assembly1.cif.gz_A | solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 | 0.8219 | 1 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8871 | 1 | 143 | 3.40.140.10 |
| af_Q55FM0_2_113_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8707 | 2 | 85 | 3.40.140.10 |
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8631 | 1 | 143 | 3.40.140.10 |
| 2kksA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8219 | 1 | 146 | 3.40.140.10 |
| af_A0A0R4IER2_1_165_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.7981 | 2 | 143 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D7XH12-F1-model_v4 | MPN domain-containing protein | 0.9902 | 2 | 144 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A2V9YEC8-F1-model_v4 | JAB domain-containing protein | 0.9898 | 82 | 143 |
GO:0006508
GO:0008237 GO:0046872 |
| AF-A0A5M8SHL5-F1-model_v4 | M67 family metallopeptidase | 0.9865 | 1 | 145 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A1Q7CBK1-F1-model_v4 | MPN domain-containing protein | 0.984 | 1 | 143 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A5M8SDD4-F1-model_v4 | M67 family metallopeptidase | 0.9782 | 5 | 143 |
GO:0006508
GO:0008235 GO:0008270 |