F474553

General Info

Members Datasets Scaffolds Average Seq Length
676 241 1352 311

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0122747|Ga0501036_0122747_575_1597
Length 340
Sequence MITRIDRILTELPPPSDPDPDGAAAVQELMGGRFGELSTFMNYTFQSFNFRNRQGARPFYDLIANIAAEEFGHIELVATTINTMLSGASPTANGRAPKPSLRGVKGVGNPHHFLAGGQGALPQNSQGRPWNGDYVFSSGDLVEDLTHNFFLETGARNNKLKVYEMVEHPAARALTGYLLVRGGVHQVAYARALERLTGADLMKLFPSPRIPTAKIPECKPHIARGDHVRLYRYSPSDYLELAAVWNGPHPETGEELVVIDETPEGALAHDLPSQPAVFAPDYAPEEIADIATMLRTKAGLPKQPTGEVASEGASSRRSRSTARKPGAGGRRAKAGTGSRR

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
241 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.89
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 9.02
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0122747 3300049572 Bacteria 2194
2 JGI25406J46586_10005508 3300003203 Bacteria 5862
3 JGI25407J50210_10005900 3300003373 Bacteria 3029
4 JGI25407J50210_10006293 3300003373 Bacteria 2952
5 JGI25407J50210_10007416 3300003373 Unclassified 2746
6 JGI25407J50210_10020872 3300003373 Bacteria 1703
7 Ga0070676_10094962 3300005328 Bacteria 1833
8 Ga0070666_10001731 3300005335 Bacteria 13313
9 Ga0070680_100000377 3300005336 Bacteria 30109
10 Ga0070680_100270873 3300005336 Bacteria 1438
11 Ga0070682_100009338 3300005337 Bacteria 5552
12 Ga0070682_100028195 3300005337 Bacteria 3376
13 Ga0070682_100045514 3300005337 Bacteria 2720
14 Ga0070682_100243519 3300005337 Bacteria 1292
15 Ga0068868_100089099 3300005338 Bacteria 2484
16 Ga0068868_100262550 3300005338 Bacteria 1457
17 Ga0070689_100101211 3300005340 Bacteria 2280
18 Ga0070661_100062397 3300005344 Bacteria 2736
19 Ga0070661_100245909 3300005344 Bacteria 1379
20 Ga0070668_100048526 3300005347 Bacteria 3265
21 Ga0070668_100093329 3300005347 Bacteria 2375
22 Ga0070668_100160210 3300005347 Bacteria 1825
23 Ga0070674_100115428 3300005356 Bacteria 1979
24 Ga0070674_100300886 3300005356 Bacteria 1279
25 Ga0070673_100219937 3300005364 Bacteria 1643
26 Ga0070659_100049821 3300005366 Bacteria 3294
27 Ga0070659_100052652 3300005366 Bacteria 3202
28 Ga0070659_100375635 3300005366 Bacteria 1196
29 Ga0070667_100006217 3300005367 Bacteria 9936
30 Ga0070701_10073492 3300005438 Bacteria 1834
31 Ga0070711_100142960 3300005439 Bacteria 1796
32 Ga0070711_100208184 3300005439 Bacteria 1513
33 Ga0070705_100035123 3300005440 Bacteria 2808
34 Ga0070700_100038737 3300005441 Bacteria 2908
35 Ga0070700_100066220 3300005441 Bacteria 2292
36 Ga0070700_100386092 3300005441 Bacteria 1049
37 Ga0070694_100173209 3300005444 Bacteria 1591
38 Ga0070663_100115196 3300005455 Bacteria 2024
39 Ga0070663_100203071 3300005455 Bacteria 1548
40 Ga0070678_100005959 3300005456 Bacteria 7097
41 Ga0070678_100158411 3300005456 Bacteria 1831
42 Ga0070662_100003436 3300005457 Bacteria 9874
43 Ga0070681_10108608 3300005458 Bacteria 2715
44 Ga0070679_100001463 3300005530 Bacteria 20928
45 Ga0070679_100006632 3300005530 Bacteria 10794
46 Ga0070684_100052205 3300005535 Bacteria 3554
47 Ga0070684_100182268 3300005535 Bacteria 1909
48 Ga0070684_100227388 3300005535 Bacteria 1703
49 Ga0068853_100098586 3300005539 Bacteria 2581
50 Ga0070686_100114649 3300005544 Bacteria 1841
51 Ga0070665_100012257 3300005548 Bacteria 8642
52 Ga0070665_100036254 3300005548 Bacteria 4961
53 Ga0070665_100037474 3300005548 Bacteria 4877
54 Ga0070665_100113512 3300005548 Bacteria 2712
55 Ga0068855_100600422 3300005563 Bacteria 1187
56 Ga0070664_100079587 3300005564 Bacteria 2821
57 Ga0070664_100153089 3300005564 Bacteria 2037
58 Ga0068857_100164099 3300005577 Bacteria 2017
59 Ga0068854_100049607 3300005578 Bacteria 2999
60 Ga0068854_100207087 3300005578 Bacteria 1545
61 Ga0068856_100018280 3300005614 Bacteria 6796
62 Ga0068856_100023860 3300005614 Bacteria 5950
63 Ga0068856_100052107 3300005614 Bacteria 4035
64 Ga0068856_100170885 3300005614 Bacteria 2186
65 Ga0070702_100011574 3300005615 Bacteria 4391
66 Ga0070702_100017182 3300005615 Bacteria 3727
67 Ga0070702_100085052 3300005615 Bacteria 1904
68 Ga0068852_100002053 3300005616 Bacteria 13727
69 Ga0068852_100273727 3300005616 Bacteria 1626
70 Ga0068864_100126088 3300005618 Bacteria 2294
71 Ga0068866_10017369 3300005718 Bacteria 3235
72 Ga0068866_10187048 3300005718 Bacteria 1228
73 Ga0068861_100177847 3300005719 Bacteria 1768
74 Ga0068861_100215218 3300005719 Bacteria 1621
75 Ga0068858_100294091 3300005842 Bacteria 1548
76 Ga0068860_100091425 3300005843 Bacteria 2899
77 Ga0068862_100145332 3300005844 Bacteria 2107
78 Ga0081455_10005766 3300005937 Bacteria 13500
79 Ga0081455_10052151 3300005937 Bacteria 3504
80 Ga0081455_10126056 3300005937 Bacteria 2009
81 Ga0081538_10000118 3300005981 Bacteria 79260
82 Ga0081538_10000412 3300005981 Bacteria 48367
83 Ga0081538_10000761 3300005981 Bacteria 35201
84 Ga0081538_10001198 3300005981 Bacteria 27247
85 Ga0081538_10001226 3300005981 Bacteria 26905
86 Ga0081538_10001966 3300005981 Bacteria 20583
87 Ga0081538_10003093 3300005981 Bacteria 15824
88 Ga0081538_10003665 3300005981 Bacteria 14434
89 Ga0081538_10004687 3300005981 Bacteria 12526
90 Ga0081538_10004940 3300005981 Bacteria 12147
91 Ga0081538_10006114 3300005981 Bacteria 10692
92 Ga0081538_10006708 3300005981 Bacteria 10077
93 Ga0081538_10011012 3300005981 Bacteria 7358
94 Ga0081538_10012383 3300005981 Bacteria 6837
95 Ga0081538_10016899 3300005981 Bacteria 5566
96 Ga0081538_10022203 3300005981 Bacteria 4605
97 Ga0081538_10059746 3300005981 Bacteria 2199
98 Ga0081538_10074669 3300005981 Bacteria 1844
99 Ga0081540_1025569 3300005983 Bacteria 3393
100 Ga0081539_10000181 3300005985 Bacteria 148250
101 Ga0081539_10002286 3300005985 Bacteria 27753
102 Ga0081539_10005362 3300005985 Bacteria 13135
103 Ga0081539_10008446 3300005985 Bacteria 8974
104 Ga0075365_10017909 3300006038 Bacteria 4346
105 Ga0075365_10066553 3300006038 Bacteria 2418
106 Ga0075365_10092730 3300006038 Bacteria 2059
107 Ga0075365_10096809 3300006038 Bacteria 2017
108 Ga0075363_100144458 3300006048 Bacteria 1341
109 Ga0075363_100166102 3300006048 Bacteria 1251
110 Ga0075364_10009847 3300006051 Bacteria 5749
111 Ga0075364_10034197 3300006051 Bacteria 3278
112 Ga0070715_10027388 3300006163 Bacteria 2277
113 Ga0070715_10152025 3300006163 Bacteria 1135
114 Ga0070712_100050185 3300006175 Bacteria 2901
115 Ga0097621_100042024 3300006237 Bacteria 3682
116 Ga0068871_100068423 3300006358 Bacteria 2916
117 Ga0075428_100016123 3300006844 Bacteria 8259
118 Ga0075428_100113374 3300006844 Bacteria 2954
119 Ga0075428_100690508 3300006844 Bacteria 1087
120 Ga0075430_100041116 3300006846 Bacteria 3912
121 Ga0075430_100061698 3300006846 Bacteria 3150
122 Ga0075430_100070457 3300006846 Bacteria 2933
123 Ga0075431_100054563 3300006847 Bacteria 4121
124 Ga0075429_100083935 3300006880 Bacteria 2776
125 Ga0068865_100031397 3300006881 Bacteria 3542
126 Ga0105240_10094004 3300009093 Bacteria 3658
127 Ga0111539_10024265 3300009094 Bacteria 7446
128 Ga0111539_10052620 3300009094 Bacteria 4847
129 Ga0111539_10159476 3300009094 Bacteria 2638
130 Ga0111539_10520709 3300009094 Bacteria 1385
131 Ga0111539_10717123 3300009094 Bacteria 1164
132 Ga0105245_10011669 3300009098 Bacteria 7647
133 Ga0105245_10011707 3300009098 Bacteria 7634
134 Ga0105245_10013599 3300009098 Bacteria 7090
135 Ga0105245_10134055 3300009098 Bacteria 2326
136 Ga0105245_10604309 3300009098 Bacteria 1124
137 Ga0105247_10096510 3300009101 Bacteria 1884
138 Ga0105247_10179318 3300009101 Bacteria 1413
139 Ga0114129_10009215 3300009147 Bacteria 14076
140 Ga0114129_10045594 3300009147 Bacteria 6162
141 Ga0114129_10154324 3300009147 Bacteria 3141
142 Ga0114129_10469821 3300009147 Bacteria 1647
143 Ga0114129_10517162 3300009147 Bacteria 1557
144 Ga0105243_10027628 3300009148 Bacteria 4349
145 Ga0105243_10031322 3300009148 Bacteria 4100
146 Ga0105243_10090349 3300009148 Bacteria 2520
147 Ga0105243_10188412 3300009148 Bacteria 1800
148 Ga0105243_10229337 3300009148 Bacteria 1647
149 Ga0105243_10270036 3300009148 Bacteria 1527
150 Ga0105242_10003435 3300009176 Bacteria 12313
151 Ga0105242_10384214 3300009176 Bacteria 1306
152 Ga0105242_10425091 3300009176 Bacteria 1246
153 Ga0105242_10525359 3300009176 Bacteria 1130
154 Ga0105242_10537500 3300009176 Bacteria 1118
155 Ga0105248_10039635 3300009177 Bacteria 5279
156 Ga0105248_10367092 3300009177 Bacteria 1620
157 Ga0105237_10176225 3300009545 Bacteria 2138
158 Ga0105238_10008186 3300009551 Bacteria 10457
159 Ga0105238_10126326 3300009551 Bacteria 2536
160 Ga0105238_10554428 3300009551 Bacteria 1154
161 Ga0105249_10088299 3300009553 Bacteria 2896
162 Ga0105249_10109058 3300009553 Bacteria 2614
163 Ga0105249_10587921 3300009553 Bacteria 1167
164 Ga0105239_10103464 3300010375 Bacteria 3151
165 Ga0105239_10137793 3300010375 Bacteria 2717
166 Ga0105239_10287316 3300010375 Bacteria 1852
167 Ga0105239_10294474 3300010375 Bacteria 1827
168 Ga0105239_10310404 3300010375 Bacteria 1778
169 Ga0105239_10556173 3300010375 Bacteria 1307
170 Ga0157370_10210897 3300013104 Bacteria 1800
171 Ga0157369_10003461 3300013105 Bacteria 18728
172 Ga0157369_10374906 3300013105 Bacteria 1477
173 Ga0157369_10662815 3300013105 Bacteria 1076
174 Ga0157374_10005535 3300013296 Bacteria 10623
175 Ga0163162_10147760 3300013306 Bacteria 2467
176 Ga0157372_10003908 3300013307 Bacteria 16015
177 Ga0157372_10017098 3300013307 Bacteria 7785
178 Ga0157372_10083623 3300013307 Bacteria 3616
179 Ga0157375_10002684 3300013308 Bacteria 15420
180 Ga0157375_10237967 3300013308 Bacteria 1980
181 Ga0182008_10177910 3300014497 Bacteria 1076
182 Ga0157377_10022644 3300014745 Bacteria 3321
183 Ga0157377_10144646 3300014745 Bacteria 1464
184 Ga0157379_10002851 3300014968 Bacteria 14570
185 Ga0157376_10329940 3300014969 Bacteria 1453
186 Ga0157376_10496926 3300014969 Bacteria 1198
187 Ga0206353_11303487 3300020082 Bacteria 1150
188 Ga0206353_11573877 3300020082 Bacteria 1713
189 Ga0206353_11726145 3300020082 Bacteria 4272
190 Ga0213873_10005797 3300021358 Bacteria 2393
191 Ga0213874_10000194 3300021377 Bacteria 11051
192 Ga0213874_10004563 3300021377 Bacteria 3177
193 Ga0213874_10070137 3300021377 Bacteria 1116
194 Ga0213876_10035417 3300021384 Bacteria 2633
195 Ga0213876_10037113 3300021384 Bacteria 2570
196 Ga0213875_10041825 3300021388 Bacteria 2155
197 Ga0213875_10108527 3300021388 Bacteria 1295
198 Ga0224712_10005082 3300022467 Bacteria 3623
199 Ga0224712_10079041 3300022467 Bacteria 1353
200 Ga0224712_10169566 3300022467 Bacteria 978
201 Ga0207656_10045167 3300025321 Bacteria 1884
202 Ga0207688_10092123 3300025901 Bacteria 1741
203 Ga0207688_10119438 3300025901 Bacteria 1537
204 Ga0207680_10002563 3300025903 Bacteria 8470
205 Ga0207647_10034082 3300025904 Bacteria 3254
206 Ga0207705_10052426 3300025909 Bacteria 2937
207 Ga0207705_10249680 3300025909 Bacteria 1353
208 Ga0207707_10001967 3300025912 Bacteria 18672
209 Ga0207695_10131582 3300025913 Bacteria 2459
210 Ga0207693_10180948 3300025915 Bacteria 1659
211 Ga0207660_10012386 3300025917 Bacteria 5580
212 Ga0207662_10017897 3300025918 Bacteria 4013
213 Ga0207657_10208957 3300025919 Bacteria 1567
214 Ga0207649_10021303 3300025920 Bacteria 3729
215 Ga0207649_10321122 3300025920 Bacteria 1138
216 Ga0207652_10002299 3300025921 Bacteria 16199
217 Ga0207652_10059594 3300025921 Bacteria 3291
218 Ga0207687_10040262 3300025927 Bacteria 3203
219 Ga0207687_10099715 3300025927 Bacteria 2135
220 Ga0207687_10106685 3300025927 Bacteria 2071
221 Ga0207687_10118863 3300025927 Bacteria 1973
222 Ga0207687_10128792 3300025927 Bacteria 1904
223 Ga0207687_10133616 3300025927 Bacteria 1874
224 Ga0207690_10053114 3300025932 Bacteria 2717
225 Ga0207690_10154274 3300025932 Bacteria 1705
226 Ga0207686_10050907 3300025934 Bacteria 2578
227 Ga0207709_10021582 3300025935 Bacteria 3647
228 Ga0207704_10025467 3300025938 Bacteria 3228
229 Ga0207704_10150092 3300025938 Bacteria 1643
230 Ga0207691_10085028 3300025940 Bacteria 2839
231 Ga0207711_10199015 3300025941 Bacteria 1828
232 Ga0207661_10001506 3300025944 Bacteria 15789
233 Ga0207661_10093794 3300025944 Bacteria 2506
234 Ga0207679_10027539 3300025945 Bacteria 3932
235 Ga0207679_10126146 3300025945 Bacteria 2045
236 Ga0207679_10205774 3300025945 Bacteria 1647
237 Ga0207651_10439930 3300025960 Bacteria 1117
238 Ga0207712_10079965 3300025961 Bacteria 2376
239 Ga0207712_10411721 3300025961 Bacteria 1139
240 Ga0207668_10012905 3300025972 Bacteria 5130
241 Ga0207668_10095258 3300025972 Bacteria 2197
242 Ga0207668_10165151 3300025972 Bacteria 1730
243 Ga0207668_10171640 3300025972 Bacteria 1701
244 Ga0207668_10185421 3300025972 Bacteria 1645
245 Ga0207668_10229496 3300025972 Bacteria 1496
246 Ga0207640_10040498 3300025981 Bacteria 2956
247 Ga0207640_10190851 3300025981 Bacteria 1544
248 Ga0207658_10010603 3300025986 Bacteria 6263
249 Ga0207658_10114215 3300025986 Bacteria 2141
250 Ga0207703_10424681 3300026035 Bacteria 1237
251 Ga0207639_10048571 3300026041 Bacteria 3213
252 Ga0207639_10085495 3300026041 Bacteria 2508
253 Ga0207678_10038844 3300026067 Bacteria 4133
254 Ga0207678_10149064 3300026067 Bacteria 1997
255 Ga0207708_10034160 3300026075 Bacteria 3867
256 Ga0207708_10100514 3300026075 Bacteria 2238
257 Ga0207702_10004813 3300026078 Bacteria 11901
258 Ga0207702_10039380 3300026078 Bacteria 3960
259 Ga0207702_10140610 3300026078 Bacteria 2184
260 Ga0207702_10243415 3300026078 Bacteria 1686
261 Ga0207641_10513284 3300026088 Bacteria 1165
262 Ga0207648_10366143 3300026089 Bacteria 1301
263 Ga0207648_10465501 3300026089 Bacteria 1153
264 Ga0207676_10447750 3300026095 Bacteria 1217
265 Ga0207676_10511898 3300026095 Bacteria 1141
266 Ga0207674_10017500 3300026116 Bacteria 7819
267 Ga0207675_100030323 3300026118 Bacteria 5036
268 Ga0207675_100043207 3300026118 Bacteria 4209
269 Ga0207683_10000904 3300026121 Bacteria 27318
270 Ga0207683_10289236 3300026121 Bacteria 1498
271 Ga0207683_10498003 3300026121 Bacteria 1125
272 Ga0207698_10047788 3300026142 Bacteria 3245
273 Ga0207698_10124074 3300026142 Bacteria 2192
274 Ga0207698_10134589 3300026142 Bacteria 2118
275 Ga0207698_10313381 3300026142 Bacteria 1466
276 Ga0207428_10033790 3300027907 Bacteria 4195
277 Ga0207428_10249286 3300027907 Bacteria 1325
278 Ga0207428_10285006 3300027907 Bacteria 1225
279 Ga0268266_10001725 3300028379 Bacteria 25033
280 Ga0268266_10025080 3300028379 Bacteria 5075
281 Ga0268266_10036137 3300028379 Bacteria 4203
282 Ga0268266_10403040 3300028379 Bacteria 1293
283 Ga0268265_10364449 3300028380 Bacteria 1324
284 Ga0268264_10079767 3300028381 Bacteria 2793
285 Ga0307408_100082903 3300031548 Bacteria 2401
286 Ga0307405_10057739 3300031731 Bacteria 2439
287 Ga0307405_10114052 3300031731 Bacteria 1836
288 Ga0307413_10010236 3300031824 Bacteria 4536
289 Ga0307413_10056028 3300031824 Bacteria 2402
290 Ga0307413_10123563 3300031824 Bacteria 1758
291 Ga0307410_10012040 3300031852 Bacteria 4978
292 Ga0307410_10053395 3300031852 Bacteria 2735
293 Ga0307410_10264304 3300031852 Bacteria 1343
294 Ga0307406_10028555 3300031901 Bacteria 3371
295 Ga0307406_10094008 3300031901 Bacteria 2026
296 Ga0307406_10138584 3300031901 Bacteria 1719
297 Ga0307406_10370782 3300031901 Bacteria 1125
298 Ga0307406_10407587 3300031901 Bacteria 1079
299 Ga0307407_10018604 3300031903 Bacteria 3518
300 Ga0307407_10071469 3300031903 Bacteria 2066
301 Ga0307407_10090742 3300031903 Bacteria 1872
302 Ga0307412_10113760 3300031911 Bacteria 1937
303 Ga0307409_100000655 3300031995 Bacteria 15334
304 Ga0307409_100011147 3300031995 Bacteria 5646
305 Ga0307409_100121568 3300031995 Bacteria 2212
306 Ga0307409_100234667 3300031995 Bacteria 1665
307 Ga0307409_100521768 3300031995 Bacteria 1161
308 Ga0307416_100021508 3300032002 Bacteria 4633
309 Ga0307416_100035957 3300032002 Bacteria 3791
310 Ga0307416_100041122 3300032002 Bacteria 3598
311 Ga0307416_100083179 3300032002 Bacteria 2714
312 Ga0307416_100097413 3300032002 Bacteria 2547
313 Ga0307416_100104311 3300032002 Bacteria 2478
314 Ga0307416_100236167 3300032002 Bacteria 1767
315 Ga0307416_100321996 3300032002 Bacteria 1549
316 Ga0307416_100336211 3300032002 Bacteria 1520
317 Ga0307416_100356466 3300032002 Bacteria 1483
318 Ga0307416_100456345 3300032002 Bacteria 1332
319 Ga0307414_10007256 3300032004 Bacteria 6227
320 Ga0307414_10317682 3300032004 Bacteria 1324
321 Ga0307414_10499131 3300032004 Bacteria 1076
322 Ga0307411_10070932 3300032005 Bacteria 2359
323 Ga0307411_10232787 3300032005 Bacteria 1437
324 Ga0307415_100000531 3300032126 Bacteria 16623
325 Ga0307415_100018102 3300032126 Bacteria 4244
326 Ga0307415_100051609 3300032126 Bacteria 2792
327 Ga0307415_100100912 3300032126 Bacteria 2116
328 Ga0307415_100130455 3300032126 Bacteria 1902
329 Ga0307415_100231515 3300032126 Bacteria 1488
330 Ga0395899_0093690 3300037312 Bacteria 2174
331 Ga0395900_0111597 3300037418 Bacteria 2808
332 Ga0395900_0289067 3300037418 Bacteria 1628
333 Ga0395900_0324321 3300037418 Bacteria 1519
334 Ga0395898_0051651 3300037466 Bacteria 4019
335 Ga0395898_0178783 3300037466 Bacteria 2027
336 Ga0395898_0270790 3300037466 Bacteria 1620
337 Ga0395905_0044404 3300037471 Bacteria 4171
338 Ga0436364_0801814 3300037853 Bacteria 17054
339 Ga0436364_0888707 3300037853 Bacteria 2174
340 Ga0436364_0911658 3300037853 Bacteria 6802
341 Ga0436364_1492429 3300037853 Bacteria 2906
342 Ga0395901_0011145 3300038443 Bacteria 9110
343 Ga0395901_0078852 3300038443 Bacteria 3439
344 Ga0395901_0123458 3300038443 Bacteria 2721
345 Ga0395901_0208182 3300038443 Bacteria 2048
346 Ga0395901_0791978 3300038443 Bacteria 938
347 Ga0436365_0392863 3300039437 Bacteria 8115
348 Ga0436365_0440302 3300039437 Bacteria 2630
349 Ga0436365_0494652 3300039437 Bacteria 13610
350 Ga0436365_0855903 3300039437 Bacteria 2872
351 Ga0436365_0987560 3300039437 Bacteria 2176
352 Ga0436365_1294762 3300039437 Bacteria 9834
353 Ga0436365_1901512 3300039437 Bacteria 29147
354 Ga0436363_0101887 3300039450 Bacteria 3363
355 Ga0436363_0108530 3300039450 Bacteria 1350
356 Ga0436363_0151266 3300039450 Bacteria 15043
357 Ga0436363_0605788 3300039450 Bacteria 12820
358 Ga0436363_0820817 3300039450 Bacteria 1865
359 Ga0436362_0062100 3300039453 Bacteria 2617
360 Ga0436362_0264531 3300039453 Bacteria 1425
361 Ga0436362_0435205 3300039453 Bacteria 2105
362 Ga0436362_0668447 3300039453 Bacteria 1122
363 Ga0436362_0943907 3300039453 Bacteria 6000
364 Ga0439461_0001977 3300041410 Bacteria 3238
365 Ga0451798_0590354 3300041458 Bacteria 1289
366 Ga0451853_0007471 3300041512 Bacteria 2109
367 Ga0451853_2379236 3300041512 Archaea 2293
368 Ga0439448_0012121 3300042005 Bacteria 2575
369 Ga0439435_0018557 3300042436 Bacteria 1772
370 Ga0450918_003461 3300042531 Bacteria 2932
371 Ga0466965_0019495 3300044683 Bacteria 3256
372 Ga0466965_0035871 3300044683 Bacteria 2431
373 Ga0466963_0005462 3300044694 Bacteria 7442
374 Ga0466963_0006299 3300044694 Bacteria 7015
375 Ga0466963_0013615 3300044694 Bacteria 4999
376 Ga0466963_0040989 3300044694 Bacteria 3035
377 Ga0466963_0101156 3300044694 Bacteria 1973
378 Ga0466963_0170351 3300044694 Bacteria 1518
379 Ga0466963_0217703 3300044694 Bacteria 1337
380 Ga0466963_0280086 3300044694 Bacteria 1172
381 Ga0466963_0517836 3300044694 Bacteria 842
382 Ga0466964_0011611 3300044706 Bacteria 3330
383 Ga0466971_0070334 3300044719 Bacteria 1589
384 Ga0466968_0004627 3300044735 Bacteria 5146
385 Ga0466970_0132463 3300044765 Bacteria 1370
386 Ga0466957_0009461 3300044842 Bacteria 5564
387 Ga0466957_0041067 3300044842 Bacteria 2797
388 Ga0466957_0230048 3300044842 Bacteria 1227
389 Ga0466957_0256090 3300044842 Bacteria 1165
390 Ga0466960_0000005 3300044901 Bacteria 72219
391 Ga0466959_0050868 3300045049 Bacteria 3041
392 Ga0466959_0084022 3300045049 Bacteria 2292
393 Ga0466959_0086058 3300045049 Bacteria 2261
394 Ga0466959_0119662 3300045049 Bacteria 1873
395 Ga0466959_0131804 3300045049 Bacteria 1771
396 Ga0466958_0003457 3300045836 Bacteria 8193
397 Ga0466958_0010849 3300045836 Bacteria 5116
398 Ga0466958_0012328 3300045836 Bacteria 4841
399 Ga0466958_0259870 3300045836 Bacteria 1111
400 Ga0466967_0000503 3300045976 Bacteria 19151
401 Ga0466967_0006242 3300045976 Bacteria 8404
402 Ga0466967_0015486 3300045976 Bacteria 5977
403 Ga0466967_0043510 3300045976 Bacteria 3889
404 Ga0466967_0055287 3300045976 Bacteria 3496
405 Ga0466967_0059767 3300045976 Bacteria 3375
406 Ga0466967_0070822 3300045976 Bacteria 3120
407 Ga0466967_0094369 3300045976 Bacteria 2724
408 Ga0466967_0107032 3300045976 Bacteria 2564
409 Ga0466967_0221474 3300045976 Bacteria 1798
410 Ga0466967_0247806 3300045976 Bacteria 1701
411 Ga0466967_0251497 3300045976 Bacteria 1688
412 Ga0466967_0392825 3300045976 Bacteria 1348
413 Ga0495650_0000121 3300046471 Bacteria 183055
414 Ga0495625_0000032 3300046660 Bacteria 233135
415 Ga0495672_0020993 3300047320 Bacteria 4267
416 Ga0495672_0033312 3300047320 Bacteria 3192
417 Ga0496100_0002667 3300048903 Bacteria 9094
418 Ga0496100_0093713 3300048903 Bacteria 2055
419 Ga0496100_0225510 3300048903 Bacteria 1377
420 Ga0496101_0125818 3300048904 Bacteria 1942
421 Ga0496101_0146273 3300048904 Bacteria 1805
422 Ga0496101_0164381 3300048904 Bacteria 1703
423 Ga0496102_0051057 3300048905 Bacteria 3767
424 Ga0496102_0118769 3300048905 Bacteria 2468
425 Ga0496102_0250353 3300048905 Bacteria 1670
426 Ga0496103_0007811 3300048906 Bacteria 6357
427 Ga0496103_0029643 3300048906 Bacteria 3326
428 Ga0496103_0089230 3300048906 Bacteria 1945
429 Ga0496104_0008134 3300048907 Bacteria 9305
430 Ga0496104_0066553 3300048907 Bacteria 3421
431 Ga0496104_0073837 3300048907 Bacteria 3245
432 Ga0496104_0412103 3300048907 Bacteria 1263
433 Ga0496105_0002183 3300048908 Bacteria 14166
434 Ga0496105_0007438 3300048908 Bacteria 8477
435 Ga0496105_0213906 3300048908 Bacteria 1571
436 Ga0496106_0022070 3300048909 Bacteria 4728
437 Ga0496106_0048459 3300048909 Bacteria 3199
438 Ga0496106_0152753 3300048909 Bacteria 1822
439 Ga0496107_0011637 3300048910 Bacteria 6131
440 Ga0496107_0052903 3300048910 Bacteria 2929
441 Ga0496107_0116788 3300048910 Bacteria 1964
442 Ga0496108_0000894 3300048911 Bacteria 23226
443 Ga0496108_0007071 3300048911 Bacteria 9089
444 Ga0496108_0010239 3300048911 Bacteria 7614
445 Ga0496108_0024845 3300048911 Bacteria 4934
446 Ga0496108_0086717 3300048911 Bacteria 2658
447 Ga0496109_0000326 3300048912 Bacteria 44470
448 Ga0496109_0000753 3300048912 Bacteria 26958
449 Ga0496109_0006929 3300048912 Bacteria 9565
450 Ga0496109_0007731 3300048912 Bacteria 9103
451 Ga0496109_0011798 3300048912 Bacteria 7520
452 Ga0496109_0173795 3300048912 Bacteria 2022
453 Ga0496110_0002845 3300048913 Bacteria 13059
454 Ga0496110_0012777 3300048913 Bacteria 6915
455 Ga0496110_0047764 3300048913 Bacteria 3750
456 Ga0496110_0056058 3300048913 Bacteria 3468
457 Ga0496110_0189512 3300048913 Bacteria 1868
458 Ga0496110_0196101 3300048913 Bacteria 1834
459 Ga0496110_0203200 3300048913 Bacteria 1800
460 Ga0496110_0203770 3300048913 Bacteria 1798
461 Ga0496110_0350046 3300048913 Bacteria 1346
462 Ga0496111_0006374 3300048914 Bacteria 7658
463 Ga0496111_0007380 3300048914 Bacteria 7198
464 Ga0496111_0009574 3300048914 Bacteria 6472
465 Ga0496111_0079952 3300048914 Bacteria 2385
466 Ga0496111_0190100 3300048914 Bacteria 1526
467 Ga0496111_0234533 3300048914 Bacteria 1363
468 Ga0496111_0249828 3300048914 Bacteria 1317
469 Ga0496112_0011422 3300048915 Bacteria 8109
470 Ga0496112_0041071 3300048915 Bacteria 4525
471 Ga0496113_0013478 3300048916 Bacteria 5542
472 Ga0496113_0031402 3300048916 Bacteria 3855
473 Ga0496113_0097557 3300048916 Bacteria 2274
474 Ga0496114_0000990 3300048917 Bacteria 21267
475 Ga0496114_0036214 3300048917 Bacteria 4078
476 Ga0496115_0192488 3300048918 Unclassified 1685
477 Ga0496117_0000619 3300048920 Bacteria 57505
478 Ga0496118_0000766 3300048921 Bacteria 51540
479 Ga0496121_0002166 3300048924 Bacteria 30741
480 Ga0496121_0079255 3300048924 Bacteria 2608
481 Ga0496121_0255906 3300048924 Bacteria 1212
482 Ga0496124_0104612 3300048927 Bacteria 2289
483 Ga0496124_0121828 3300048927 Bacteria 2083
484 Ga0496126_0019683 3300048929 Bacteria 6642
485 Ga0496126_0061882 3300048929 Bacteria 3360
486 Ga0501031_0004357 3300049568 Bacteria 9158
487 Ga0501031_0017795 3300049568 Bacteria 4621
488 Ga0501031_0025420 3300049568 Bacteria 3861
489 Ga0501031_0032017 3300049568 Bacteria 3429
490 Ga0501031_0039685 3300049568 Bacteria 3073
491 Ga0501032_0004803 3300049569 Bacteria 10133
492 Ga0501032_0047954 3300049569 Bacteria 2884
493 Ga0501032_0166439 3300049569 Bacteria 1447
494 Ga0501033_0018958 3300049570 Bacteria 5200
495 Ga0501033_0041302 3300049570 Bacteria 3442
496 Ga0501034_0011301 3300049571 Bacteria 9261
497 Ga0501034_0115335 3300049571 Bacteria 2675
498 Ga0501036_0043669 3300049572 Bacteria 3796
499 Ga0501036_0050220 3300049572 Bacteria 3532
500 Ga0501036_0123256 3300049572 Bacteria 2189
501 Ga0501036_0138551 3300049572 Bacteria 2053
502 Ga0501036_0150947 3300049572 Bacteria 1960
503 Ga0501036_0172106 3300049572 Bacteria 1824
504 Ga0501036_0208718 3300049572 Bacteria 1641
505 Ga0501036_0462402 3300049572 Bacteria 1057
506 Ga0501037_0002769 3300049573 Bacteria 12682
507 Ga0501037_0055771 3300049573 Bacteria 2889
508 Ga0501038_0003753 3300049574 Bacteria 14133
509 Ga0501038_0030562 3300049574 Bacteria 4765
510 Ga0501038_0033506 3300049574 Bacteria 4525
511 Ga0501038_0171606 3300049574 Bacteria 1755
512 Ga0501039_0004459 3300049575 Bacteria 10566
513 Ga0501039_0022741 3300049575 Bacteria 4810
514 Ga0501039_0043644 3300049575 Bacteria 3463
515 Ga0501039_0069189 3300049575 Bacteria 2741
516 Ga0501039_0095731 3300049575 Bacteria 2315
517 Ga0501039_0109862 3300049575 Bacteria 2155
518 Ga0501040_0017272 3300049576 Bacteria 4787
519 Ga0501040_0025804 3300049576 Bacteria 3953
520 Ga0501040_0027930 3300049576 Bacteria 3801
521 Ga0501040_0028992 3300049576 Bacteria 3734
522 Ga0501040_0036832 3300049576 Bacteria 3322
523 Ga0501040_0040049 3300049576 Bacteria 3188
524 Ga0501040_0070304 3300049576 Bacteria 2415
525 Ga0501041_0010224 3300049577 Bacteria 5531
526 Ga0501041_0013196 3300049577 Bacteria 4895
527 Ga0501041_0062463 3300049577 Bacteria 2280
528 Ga0501041_0110258 3300049577 Bacteria 1707
529 Ga0501041_0259629 3300049577 Bacteria 1092
530 Ga0501041_0265968 3300049577 Bacteria 1078
531 Ga0501042_0012344 3300049578 Bacteria 5784
532 Ga0501042_0020235 3300049578 Bacteria 4630
533 Ga0501042_0092212 3300049578 Bacteria 2175
534 Ga0501042_0149274 3300049578 Bacteria 1685
535 Ga0501042_0245249 3300049578 Bacteria 1292
536 Ga0501042_0431819 3300049578 Bacteria 955
537 Ga0501043_0034752 3300049579 Bacteria 3964
538 Ga0501043_0113005 3300049579 Bacteria 2133
539 Ga0501043_0330842 3300049579 Bacteria 1160
540 Ga0501043_0345666 3300049579 Bacteria 1131
541 Ga0501046_0005549 3300049580 Bacteria 11270
542 Ga0501046_0018249 3300049580 Bacteria 5841
543 Ga0501046_0087086 3300049580 Bacteria 2407
544 Ga0501046_0186332 3300049580 Bacteria 1549
545 Ga0501046_0294242 3300049580 Bacteria 1187
546 Ga0501046_0358771 3300049580 Bacteria 1057
547 Ga0501047_0027727 3300049581 Bacteria 5458
548 Ga0501047_0067281 3300049581 Bacteria 3452
549 Ga0501047_0110901 3300049581 Bacteria 2626
550 Ga0501048_0002489 3300049582 Bacteria 14066
551 Ga0501048_0012939 3300049582 Bacteria 6198
552 Ga0501048_0052121 3300049582 Bacteria 2911
553 Ga0501048_0118122 3300049582 Bacteria 1873
554 Ga0501048_0312734 3300049582 Bacteria 1118
555 Ga0501067_0017219 3300049583 Bacteria 3994
556 Ga0501068_0002271 3300049584 Bacteria 10235
557 Ga0501068_0064949 3300049584 Bacteria 2221
558 Ga0501068_0092864 3300049584 Bacteria 1864
559 Ga0501068_0187425 3300049584 Bacteria 1309
560 Ga0501068_0188055 3300049584 Bacteria 1307
561 Ga0501068_0222865 3300049584 Bacteria 1199
562 Ga0501069_0017386 3300049585 Bacteria 3869
563 Ga0501069_0018063 3300049585 Bacteria 3804
564 Ga0501069_0079933 3300049585 Bacteria 1841
565 Ga0501070_0044118 3300049586 Bacteria 3710
566 Ga0501070_0172135 3300049586 Bacteria 1783
567 Ga0501071_0003111 3300049587 Bacteria 10296
568 Ga0501071_0049221 3300049587 Bacteria 3033
569 Ga0501071_0057386 3300049587 Bacteria 2813
570 Ga0501071_0060381 3300049587 Bacteria 2744
571 Ga0501071_0065264 3300049587 Bacteria 2643
572 Ga0501071_0079713 3300049587 Bacteria 2394
573 Ga0501071_0080399 3300049587 Bacteria 2383
574 Ga0501071_0100238 3300049587 Bacteria 2134
575 Ga0501071_0166891 3300049587 Bacteria 1647
576 Ga0501071_0300519 3300049587 Bacteria 1217
577 Ga0501071_0327357 3300049587 Bacteria 1164
578 Ga0501072_0009002 3300049588 Bacteria 7590
579 Ga0501072_0031226 3300049588 Bacteria 4168
580 Ga0501072_0042390 3300049588 Bacteria 3575
581 Ga0501072_0056458 3300049588 Bacteria 3094
582 Ga0501072_0089294 3300049588 Bacteria 2446
583 Ga0501072_0112005 3300049588 Bacteria 2172
584 Ga0501072_0247670 3300049588 Bacteria 1419
585 Ga0501072_0328516 3300049588 Bacteria 1215
586 Ga0501073_0043928 3300049589 Bacteria 3150
587 Ga0501073_0067379 3300049589 Bacteria 2496
588 Ga0501074_0006500 3300049590 Bacteria 8443
589 Ga0501074_0006612 3300049590 Bacteria 8382
590 Ga0501074_0028802 3300049590 Bacteria 4024
591 Ga0501074_0054478 3300049590 Bacteria 2884
592 Ga0501074_0305078 3300049590 Bacteria 1131
593 Ga0501074_0341821 3300049590 Bacteria 1062
594 Ga0501075_0004445 3300049591 Bacteria 9489
595 Ga0501075_0021150 3300049591 Bacteria 4740
596 Ga0501075_0023425 3300049591 Bacteria 4521
597 Ga0501075_0096095 3300049591 Bacteria 2249
598 Ga0501075_0097206 3300049591 Bacteria 2234
599 Ga0501076_0007814 3300049592 Bacteria 7796
600 Ga0501076_0008142 3300049592 Bacteria 7669
601 Ga0501076_0011403 3300049592 Bacteria 6618
602 Ga0501076_0028506 3300049592 Bacteria 4336
603 Ga0501076_0032144 3300049592 Bacteria 4095
604 Ga0501076_0052237 3300049592 Bacteria 3237
605 Ga0501076_0061404 3300049592 Bacteria 2991
606 Ga0501076_0073663 3300049592 Bacteria 2734
607 Ga0501076_0079072 3300049592 Bacteria 2639
608 Ga0501076_0205773 3300049592 Bacteria 1607
609 Ga0501076_0392817 3300049592 Bacteria 1140
610 Ga0501077_0032152 3300049593 Bacteria 3340
611 Ga0501077_0074690 3300049593 Bacteria 2147
612 Ga0501077_0106864 3300049593 Bacteria 1773
613 Ga0501077_0237261 3300049593 Bacteria 1159
614 Ga0501079_0017033 3300049741 Bacteria 5550
615 Ga0501079_0024985 3300049741 Bacteria 4583
616 Ga0501079_0025897 3300049741 Bacteria 4499
617 Ga0501079_0082257 3300049741 Bacteria 2490
618 Ga0501079_0140931 3300049741 Bacteria 1878
619 Ga0501079_0269728 3300049741 Bacteria 1330
620 Ga0501080_0061837 3300049742 Bacteria 3485
621 Ga0501080_0125490 3300049742 Bacteria 2377
622 Ga0501081_0005599 3300049743 Bacteria 8111
623 Ga0501081_0030794 3300049743 Bacteria 3634
624 Ga0501081_0072664 3300049743 Bacteria 2398
625 Ga0501081_0096432 3300049743 Bacteria 2086
626 Ga0501083_0040996 3300049744 Bacteria 3141
627 Ga0501083_0273342 3300049744 Bacteria 1099
628 Ga0501035_0018223 3300049822 Bacteria 6466
629 Ga0501035_0076211 3300049822 Bacteria 2966
630 Ga0501035_0266160 3300049822 Bacteria 1452
631 Ga0501035_0349545 3300049822 Bacteria 1237
632 Ga0501044_0014862 3300049823 Bacteria 8392
633 Ga0501044_0034027 3300049823 Bacteria 5348
634 Ga0501044_0376182 3300049823 Bacteria 1336
635 Ga0501045_0019194 3300049824 Bacteria 4870
636 Ga0501045_0082239 3300049824 Bacteria 2375
637 Ga0501045_0188051 3300049824 Bacteria 1539
638 Ga0501045_0328167 3300049824 Bacteria 1139
639 nmdc:mga03n38_19754_c1 3300050490 Bacteria 2682
640 nmdc:mga00v17_191274_c1 3300050491 Bacteria 1322
641 nmdc:mga00v17_41311_c1 3300050491 Bacteria 2769
642 nmdc:mga0yw44_205589_c1 3300050492 Bacteria 1301
643 nmdc:mga05p37_378395_c1 3300050507 Bacteria 1660
644 nmdc:mga05p37_4971_c1 3300050507 Bacteria 15580
645 nmdc:mga09592_227321_c1 3300050508 Bacteria 1616
646 nmdc:mga0qj67_413644_c1 3300050509 Bacteria 1088
647 nmdc:mga0qj67_56217_c1 3300050509 Bacteria 3119
648 nmdc:mga06r32_202821_c1 3300050510 Bacteria 1971
649 nmdc:mga06r32_76346_c1 3300050510 Bacteria 3254
650 nmdc:mga08y16_22873_c1 3300050511 Bacteria 6597
651 Ga0500641_0013882 3300053096 Bacteria 2964
652 Ga0500556_0001060 3300053104 Bacteria 14115
653 Ga0500616_0058152 3300053153 Bacteria 2012
654 Ga0500616_0058716 3300053153 Bacteria 2000
655 Ga0500599_002571 3300053736 Bacteria 2181
656 Ga0501084_0004200 3300054114 Bacteria 11749
657 Ga0501084_0032428 3300054114 Bacteria 4370
658 Ga0501084_0062326 3300054114 Bacteria 3121
659 Ga0501084_0094809 3300054114 Bacteria 2506
660 Ga0501084_0203662 3300054114 Bacteria 1670
661 Ga0501084_0310507 3300054114 Bacteria 1332
662 Ga0501084_0346176 3300054114 Bacteria 1255
663 Ga0501082_0013763 3300060353 Bacteria 6955
664 Ga0501082_0014079 3300060353 Bacteria 6880
665 Ga0501082_0038736 3300060353 Bacteria 4111
666 Ga0501082_0094475 3300060353 Bacteria 2584
667 Ga0501082_0134996 3300060353 Bacteria 2141
668 Ga0501082_0203718 3300060353 Bacteria 1721
669 Ga0501082_0220272 3300060353 Bacteria 1651
670 Ga0501082_0358614 3300060353 Bacteria 1272
671 Ga0466962_0164062 3300061719 Bacteria 1081
672 Ga0530510_0004106 3300061734 Bacteria 10050
673 Ga0530510_0016773 3300061734 Bacteria 5186
674 Ga0530510_0035845 3300061734 Bacteria 3576
675 2526063489 2524614857 Bacteria 4146328
676 2740064778 2739367875 Bacteria 4157290
677 Ga0501036_0122747
678 JGI25406J46586_10005508
679 JGI25407J50210_10005900
680 JGI25407J50210_10006293
681 JGI25407J50210_10007416
682 JGI25407J50210_10020872
683 Ga0070676_10094962
684 Ga0070666_10001731
685 Ga0070680_100000377
686 Ga0070680_100270873
687 Ga0070682_100009338
688 Ga0070682_100028195
689 Ga0070682_100045514
690 Ga0070682_100243519
691 Ga0068868_100089099
692 Ga0068868_100262550
693 Ga0070689_100101211
694 Ga0070661_100062397
695 Ga0070661_100245909
696 Ga0070668_100048526
697 Ga0070668_100093329
698 Ga0070668_100160210
699 Ga0070674_100115428
700 Ga0070674_100300886
701 Ga0070673_100219937
702 Ga0070659_100049821
703 Ga0070659_100052652
704 Ga0070659_100375635
705 Ga0070667_100006217
706 Ga0070701_10073492
707 Ga0070711_100142960
708 Ga0070711_100208184
709 Ga0070705_100035123
710 Ga0070700_100038737
711 Ga0070700_100066220
712 Ga0070700_100386092
713 Ga0070694_100173209
714 Ga0070663_100115196
715 Ga0070663_100203071
716 Ga0070678_100005959
717 Ga0070678_100158411
718 Ga0070662_100003436
719 Ga0070681_10108608
720 Ga0070679_100001463
721 Ga0070679_100006632
722 Ga0070684_100052205
723 Ga0070684_100182268
724 Ga0070684_100227388
725 Ga0068853_100098586
726 Ga0070686_100114649
727 Ga0070665_100012257
728 Ga0070665_100036254
729 Ga0070665_100037474
730 Ga0070665_100113512
731 Ga0068855_100600422
732 Ga0070664_100079587
733 Ga0070664_100153089
734 Ga0068857_100164099
735 Ga0068854_100049607
736 Ga0068854_100207087
737 Ga0068856_100018280
738 Ga0068856_100023860
739 Ga0068856_100052107
740 Ga0068856_100170885
741 Ga0070702_100011574
742 Ga0070702_100017182
743 Ga0070702_100085052
744 Ga0068852_100002053
745 Ga0068852_100273727
746 Ga0068864_100126088
747 Ga0068866_10017369
748 Ga0068866_10187048
749 Ga0068861_100177847
750 Ga0068861_100215218
751 Ga0068858_100294091
752 Ga0068860_100091425
753 Ga0068862_100145332
754 Ga0081455_10005766
755 Ga0081455_10052151
756 Ga0081455_10126056
757 Ga0081538_10000118
758 Ga0081538_10000412
759 Ga0081538_10000761
760 Ga0081538_10001198
761 Ga0081538_10001226
762 Ga0081538_10001966
763 Ga0081538_10003093
764 Ga0081538_10003665
765 Ga0081538_10004687
766 Ga0081538_10004940
767 Ga0081538_10006114
768 Ga0081538_10006708
769 Ga0081538_10011012
770 Ga0081538_10012383
771 Ga0081538_10016899
772 Ga0081538_10022203
773 Ga0081538_10059746
774 Ga0081538_10074669
775 Ga0081540_1025569
776 Ga0081539_10000181
777 Ga0081539_10002286
778 Ga0081539_10005362
779 Ga0081539_10008446
780 Ga0075365_10017909
781 Ga0075365_10066553
782 Ga0075365_10092730
783 Ga0075365_10096809
784 Ga0075363_100144458
785 Ga0075363_100166102
786 Ga0075364_10009847
787 Ga0075364_10034197
788 Ga0070715_10027388
789 Ga0070715_10152025
790 Ga0070712_100050185
791 Ga0097621_100042024
792 Ga0068871_100068423
793 Ga0075428_100016123
794 Ga0075428_100113374
795 Ga0075428_100690508
796 Ga0075430_100041116
797 Ga0075430_100061698
798 Ga0075430_100070457
799 Ga0075431_100054563
800 Ga0075429_100083935
801 Ga0068865_100031397
802 Ga0105240_10094004
803 Ga0111539_10024265
804 Ga0111539_10052620
805 Ga0111539_10159476
806 Ga0111539_10520709
807 Ga0111539_10717123
808 Ga0105245_10011669
809 Ga0105245_10011707
810 Ga0105245_10013599
811 Ga0105245_10134055
812 Ga0105245_10604309
813 Ga0105247_10096510
814 Ga0105247_10179318
815 Ga0114129_10009215
816 Ga0114129_10045594
817 Ga0114129_10154324
818 Ga0114129_10469821
819 Ga0114129_10517162
820 Ga0105243_10027628
821 Ga0105243_10031322
822 Ga0105243_10090349
823 Ga0105243_10188412
824 Ga0105243_10229337
825 Ga0105243_10270036
826 Ga0105242_10003435
827 Ga0105242_10384214
828 Ga0105242_10425091
829 Ga0105242_10525359
830 Ga0105242_10537500
831 Ga0105248_10039635
832 Ga0105248_10367092
833 Ga0105237_10176225
834 Ga0105238_10008186
835 Ga0105238_10126326
836 Ga0105238_10554428
837 Ga0105249_10088299
838 Ga0105249_10109058
839 Ga0105249_10587921
840 Ga0105239_10103464
841 Ga0105239_10137793
842 Ga0105239_10287316
843 Ga0105239_10294474
844 Ga0105239_10310404
845 Ga0105239_10556173
846 Ga0157370_10210897
847 Ga0157369_10003461
848 Ga0157369_10374906
849 Ga0157369_10662815
850 Ga0157374_10005535
851 Ga0163162_10147760
852 Ga0157372_10003908
853 Ga0157372_10017098
854 Ga0157372_10083623
855 Ga0157375_10002684
856 Ga0157375_10237967
857 Ga0182008_10177910
858 Ga0157377_10022644
859 Ga0157377_10144646
860 Ga0157379_10002851
861 Ga0157376_10329940
862 Ga0157376_10496926
863 Ga0206353_11303487
864 Ga0206353_11573877
865 Ga0206353_11726145
866 Ga0213873_10005797
867 Ga0213874_10000194
868 Ga0213874_10004563
869 Ga0213874_10070137
870 Ga0213876_10035417
871 Ga0213876_10037113
872 Ga0213875_10041825
873 Ga0213875_10108527
874 Ga0224712_10005082
875 Ga0224712_10079041
876 Ga0224712_10169566
877 Ga0207656_10045167
878 Ga0207688_10092123
879 Ga0207688_10119438
880 Ga0207680_10002563
881 Ga0207647_10034082
882 Ga0207705_10052426
883 Ga0207705_10249680
884 Ga0207707_10001967
885 Ga0207695_10131582
886 Ga0207693_10180948
887 Ga0207660_10012386
888 Ga0207662_10017897
889 Ga0207657_10208957
890 Ga0207649_10021303
891 Ga0207649_10321122
892 Ga0207652_10002299
893 Ga0207652_10059594
894 Ga0207687_10040262
895 Ga0207687_10099715
896 Ga0207687_10106685
897 Ga0207687_10118863
898 Ga0207687_10128792
899 Ga0207687_10133616
900 Ga0207690_10053114
901 Ga0207690_10154274
902 Ga0207686_10050907
903 Ga0207709_10021582
904 Ga0207704_10025467
905 Ga0207704_10150092
906 Ga0207691_10085028
907 Ga0207711_10199015
908 Ga0207661_10001506
909 Ga0207661_10093794
910 Ga0207679_10027539
911 Ga0207679_10126146
912 Ga0207679_10205774
913 Ga0207651_10439930
914 Ga0207712_10079965
915 Ga0207712_10411721
916 Ga0207668_10012905
917 Ga0207668_10095258
918 Ga0207668_10165151
919 Ga0207668_10171640
920 Ga0207668_10185421
921 Ga0207668_10229496
922 Ga0207640_10040498
923 Ga0207640_10190851
924 Ga0207658_10010603
925 Ga0207658_10114215
926 Ga0207703_10424681
927 Ga0207639_10048571
928 Ga0207639_10085495
929 Ga0207678_10038844
930 Ga0207678_10149064
931 Ga0207708_10034160
932 Ga0207708_10100514
933 Ga0207702_10004813
934 Ga0207702_10039380
935 Ga0207702_10140610
936 Ga0207702_10243415
937 Ga0207641_10513284
938 Ga0207648_10366143
939 Ga0207648_10465501
940 Ga0207676_10447750
941 Ga0207676_10511898
942 Ga0207674_10017500
943 Ga0207675_100030323
944 Ga0207675_100043207
945 Ga0207683_10000904
946 Ga0207683_10289236
947 Ga0207683_10498003
948 Ga0207698_10047788
949 Ga0207698_10124074
950 Ga0207698_10134589
951 Ga0207698_10313381
952 Ga0207428_10033790
953 Ga0207428_10249286
954 Ga0207428_10285006
955 Ga0268266_10001725
956 Ga0268266_10025080
957 Ga0268266_10036137
958 Ga0268266_10403040
959 Ga0268265_10364449
960 Ga0268264_10079767
961 Ga0307408_100082903
962 Ga0307405_10057739
963 Ga0307405_10114052
964 Ga0307413_10010236
965 Ga0307413_10056028
966 Ga0307413_10123563
967 Ga0307410_10012040
968 Ga0307410_10053395
969 Ga0307410_10264304
970 Ga0307406_10028555
971 Ga0307406_10094008
972 Ga0307406_10138584
973 Ga0307406_10370782
974 Ga0307406_10407587
975 Ga0307407_10018604
976 Ga0307407_10071469
977 Ga0307407_10090742
978 Ga0307412_10113760
979 Ga0307409_100000655
980 Ga0307409_100011147
981 Ga0307409_100121568
982 Ga0307409_100234667
983 Ga0307409_100521768
984 Ga0307416_100021508
985 Ga0307416_100035957
986 Ga0307416_100041122
987 Ga0307416_100083179
988 Ga0307416_100097413
989 Ga0307416_100104311
990 Ga0307416_100236167
991 Ga0307416_100321996
992 Ga0307416_100336211
993 Ga0307416_100356466
994 Ga0307416_100456345
995 Ga0307414_10007256
996 Ga0307414_10317682
997 Ga0307414_10499131
998 Ga0307411_10070932
999 Ga0307411_10232787
1000 Ga0307415_100000531
1001 Ga0307415_100018102
1002 Ga0307415_100051609
1003 Ga0307415_100100912
1004 Ga0307415_100130455
1005 Ga0307415_100231515
1006 Ga0395899_0093690
1007 Ga0395900_0111597
1008 Ga0395900_0289067
1009 Ga0395900_0324321
1010 Ga0395898_0051651
1011 Ga0395898_0178783
1012 Ga0395898_0270790
1013 Ga0395905_0044404
1014 Ga0436364_0801814
1015 Ga0436364_0888707
1016 Ga0436364_0911658
1017 Ga0436364_1492429
1018 Ga0395901_0011145
1019 Ga0395901_0078852
1020 Ga0395901_0123458
1021 Ga0395901_0208182
1022 Ga0395901_0791978
1023 Ga0436365_0392863
1024 Ga0436365_0440302
1025 Ga0436365_0494652
1026 Ga0436365_0855903
1027 Ga0436365_0987560
1028 Ga0436365_1294762
1029 Ga0436365_1901512
1030 Ga0436363_0101887
1031 Ga0436363_0108530
1032 Ga0436363_0151266
1033 Ga0436363_0605788
1034 Ga0436363_0820817
1035 Ga0436362_0062100
1036 Ga0436362_0264531
1037 Ga0436362_0435205
1038 Ga0436362_0668447
1039 Ga0436362_0943907
1040 Ga0439461_0001977
1041 Ga0451798_0590354
1042 Ga0451853_0007471
1043 Ga0451853_2379236
1044 Ga0439448_0012121
1045 Ga0439435_0018557
1046 Ga0450918_003461
1047 Ga0466965_0019495
1048 Ga0466965_0035871
1049 Ga0466963_0005462
1050 Ga0466963_0006299
1051 Ga0466963_0013615
1052 Ga0466963_0040989
1053 Ga0466963_0101156
1054 Ga0466963_0170351
1055 Ga0466963_0217703
1056 Ga0466963_0280086
1057 Ga0466963_0517836
1058 Ga0466964_0011611
1059 Ga0466971_0070334
1060 Ga0466968_0004627
1061 Ga0466970_0132463
1062 Ga0466957_0009461
1063 Ga0466957_0041067
1064 Ga0466957_0230048
1065 Ga0466957_0256090
1066 Ga0466960_0000005
1067 Ga0466959_0050868
1068 Ga0466959_0084022
1069 Ga0466959_0086058
1070 Ga0466959_0119662
1071 Ga0466959_0131804
1072 Ga0466958_0003457
1073 Ga0466958_0010849
1074 Ga0466958_0012328
1075 Ga0466958_0259870
1076 Ga0466967_0000503
1077 Ga0466967_0006242
1078 Ga0466967_0015486
1079 Ga0466967_0043510
1080 Ga0466967_0055287
1081 Ga0466967_0059767
1082 Ga0466967_0070822
1083 Ga0466967_0094369
1084 Ga0466967_0107032
1085 Ga0466967_0221474
1086 Ga0466967_0247806
1087 Ga0466967_0251497
1088 Ga0466967_0392825
1089 Ga0495650_0000121
1090 Ga0495625_0000032
1091 Ga0495672_0020993
1092 Ga0495672_0033312
1093 Ga0496100_0002667
1094 Ga0496100_0093713
1095 Ga0496100_0225510
1096 Ga0496101_0125818
1097 Ga0496101_0146273
1098 Ga0496101_0164381
1099 Ga0496102_0051057
1100 Ga0496102_0118769
1101 Ga0496102_0250353
1102 Ga0496103_0007811
1103 Ga0496103_0029643
1104 Ga0496103_0089230
1105 Ga0496104_0008134
1106 Ga0496104_0066553
1107 Ga0496104_0073837
1108 Ga0496104_0412103
1109 Ga0496105_0002183
1110 Ga0496105_0007438
1111 Ga0496105_0213906
1112 Ga0496106_0022070
1113 Ga0496106_0048459
1114 Ga0496106_0152753
1115 Ga0496107_0011637
1116 Ga0496107_0052903
1117 Ga0496107_0116788
1118 Ga0496108_0000894
1119 Ga0496108_0007071
1120 Ga0496108_0010239
1121 Ga0496108_0024845
1122 Ga0496108_0086717
1123 Ga0496109_0000326
1124 Ga0496109_0000753
1125 Ga0496109_0006929
1126 Ga0496109_0007731
1127 Ga0496109_0011798
1128 Ga0496109_0173795
1129 Ga0496110_0002845
1130 Ga0496110_0012777
1131 Ga0496110_0047764
1132 Ga0496110_0056058
1133 Ga0496110_0189512
1134 Ga0496110_0196101
1135 Ga0496110_0203200
1136 Ga0496110_0203770
1137 Ga0496110_0350046
1138 Ga0496111_0006374
1139 Ga0496111_0007380
1140 Ga0496111_0009574
1141 Ga0496111_0079952
1142 Ga0496111_0190100
1143 Ga0496111_0234533
1144 Ga0496111_0249828
1145 Ga0496112_0011422
1146 Ga0496112_0041071
1147 Ga0496113_0013478
1148 Ga0496113_0031402
1149 Ga0496113_0097557
1150 Ga0496114_0000990
1151 Ga0496114_0036214
1152 Ga0496115_0192488
1153 Ga0496117_0000619
1154 Ga0496118_0000766
1155 Ga0496121_0002166
1156 Ga0496121_0079255
1157 Ga0496121_0255906
1158 Ga0496124_0104612
1159 Ga0496124_0121828
1160 Ga0496126_0019683
1161 Ga0496126_0061882
1162 Ga0501031_0004357
1163 Ga0501031_0017795
1164 Ga0501031_0025420
1165 Ga0501031_0032017
1166 Ga0501031_0039685
1167 Ga0501032_0004803
1168 Ga0501032_0047954
1169 Ga0501032_0166439
1170 Ga0501033_0018958
1171 Ga0501033_0041302
1172 Ga0501034_0011301
1173 Ga0501034_0115335
1174 Ga0501036_0043669
1175 Ga0501036_0050220
1176 Ga0501036_0123256
1177 Ga0501036_0138551
1178 Ga0501036_0150947
1179 Ga0501036_0172106
1180 Ga0501036_0208718
1181 Ga0501036_0462402
1182 Ga0501037_0002769
1183 Ga0501037_0055771
1184 Ga0501038_0003753
1185 Ga0501038_0030562
1186 Ga0501038_0033506
1187 Ga0501038_0171606
1188 Ga0501039_0004459
1189 Ga0501039_0022741
1190 Ga0501039_0043644
1191 Ga0501039_0069189
1192 Ga0501039_0095731
1193 Ga0501039_0109862
1194 Ga0501040_0017272
1195 Ga0501040_0025804
1196 Ga0501040_0027930
1197 Ga0501040_0028992
1198 Ga0501040_0036832
1199 Ga0501040_0040049
1200 Ga0501040_0070304
1201 Ga0501041_0010224
1202 Ga0501041_0013196
1203 Ga0501041_0062463
1204 Ga0501041_0110258
1205 Ga0501041_0259629
1206 Ga0501041_0265968
1207 Ga0501042_0012344
1208 Ga0501042_0020235
1209 Ga0501042_0092212
1210 Ga0501042_0149274
1211 Ga0501042_0245249
1212 Ga0501042_0431819
1213 Ga0501043_0034752
1214 Ga0501043_0113005
1215 Ga0501043_0330842
1216 Ga0501043_0345666
1217 Ga0501046_0005549
1218 Ga0501046_0018249
1219 Ga0501046_0087086
1220 Ga0501046_0186332
1221 Ga0501046_0294242
1222 Ga0501046_0358771
1223 Ga0501047_0027727
1224 Ga0501047_0067281
1225 Ga0501047_0110901
1226 Ga0501048_0002489
1227 Ga0501048_0012939
1228 Ga0501048_0052121
1229 Ga0501048_0118122
1230 Ga0501048_0312734
1231 Ga0501067_0017219
1232 Ga0501068_0002271
1233 Ga0501068_0064949
1234 Ga0501068_0092864
1235 Ga0501068_0187425
1236 Ga0501068_0188055
1237 Ga0501068_0222865
1238 Ga0501069_0017386
1239 Ga0501069_0018063
1240 Ga0501069_0079933
1241 Ga0501070_0044118
1242 Ga0501070_0172135
1243 Ga0501071_0003111
1244 Ga0501071_0049221
1245 Ga0501071_0057386
1246 Ga0501071_0060381
1247 Ga0501071_0065264
1248 Ga0501071_0079713
1249 Ga0501071_0080399
1250 Ga0501071_0100238
1251 Ga0501071_0166891
1252 Ga0501071_0300519
1253 Ga0501071_0327357
1254 Ga0501072_0009002
1255 Ga0501072_0031226
1256 Ga0501072_0042390
1257 Ga0501072_0056458
1258 Ga0501072_0089294
1259 Ga0501072_0112005
1260 Ga0501072_0247670
1261 Ga0501072_0328516
1262 Ga0501073_0043928
1263 Ga0501073_0067379
1264 Ga0501074_0006500
1265 Ga0501074_0006612
1266 Ga0501074_0028802
1267 Ga0501074_0054478
1268 Ga0501074_0305078
1269 Ga0501074_0341821
1270 Ga0501075_0004445
1271 Ga0501075_0021150
1272 Ga0501075_0023425
1273 Ga0501075_0096095
1274 Ga0501075_0097206
1275 Ga0501076_0007814
1276 Ga0501076_0008142
1277 Ga0501076_0011403
1278 Ga0501076_0028506
1279 Ga0501076_0032144
1280 Ga0501076_0052237
1281 Ga0501076_0061404
1282 Ga0501076_0073663
1283 Ga0501076_0079072
1284 Ga0501076_0205773
1285 Ga0501076_0392817
1286 Ga0501077_0032152
1287 Ga0501077_0074690
1288 Ga0501077_0106864
1289 Ga0501077_0237261
1290 Ga0501079_0017033
1291 Ga0501079_0024985
1292 Ga0501079_0025897
1293 Ga0501079_0082257
1294 Ga0501079_0140931
1295 Ga0501079_0269728
1296 Ga0501080_0061837
1297 Ga0501080_0125490
1298 Ga0501081_0005599
1299 Ga0501081_0030794
1300 Ga0501081_0072664
1301 Ga0501081_0096432
1302 Ga0501083_0040996
1303 Ga0501083_0273342
1304 Ga0501035_0018223
1305 Ga0501035_0076211
1306 Ga0501035_0266160
1307 Ga0501035_0349545
1308 Ga0501044_0014862
1309 Ga0501044_0034027
1310 Ga0501044_0376182
1311 Ga0501045_0019194
1312 Ga0501045_0082239
1313 Ga0501045_0188051
1314 Ga0501045_0328167
1315 nmdc:mga03n38_19754_c1
1316 nmdc:mga00v17_191274_c1
1317 nmdc:mga00v17_41311_c1
1318 nmdc:mga0yw44_205589_c1
1319 nmdc:mga05p37_378395_c1
1320 nmdc:mga05p37_4971_c1
1321 nmdc:mga09592_227321_c1
1322 nmdc:mga0qj67_413644_c1
1323 nmdc:mga0qj67_56217_c1
1324 nmdc:mga06r32_202821_c1
1325 nmdc:mga06r32_76346_c1
1326 nmdc:mga08y16_22873_c1
1327 Ga0500641_0013882
1328 Ga0500556_0001060
1329 Ga0500616_0058152
1330 Ga0500616_0058716
1331 Ga0500599_002571
1332 Ga0501084_0004200
1333 Ga0501084_0032428
1334 Ga0501084_0062326
1335 Ga0501084_0094809
1336 Ga0501084_0203662
1337 Ga0501084_0310507
1338 Ga0501084_0346176
1339 Ga0501082_0013763
1340 Ga0501082_0014079
1341 Ga0501082_0038736
1342 Ga0501082_0094475
1343 Ga0501082_0134996
1344 Ga0501082_0203718
1345 Ga0501082_0220272
1346 Ga0501082_0358614
1347 Ga0466962_0164062
1348 Ga0530510_0004106
1349 Ga0530510_0016773
1350 Ga0530510_0035845
1351 2526063489
1352 2740064778

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05067

Mn_catalase

Manganese containing catalase

1

300

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v8t-assembly1.cif.gz_A crystal structure of mn catalase from thermus thermophilus complexed with chloride 0.9384 1 285
2cwl-assembly1.cif.gz_A crystal structure of manganese-free form of pseudocatalase from thermus thermophilus hb8 0.938 1 282
2v8t-assembly1.cif.gz_A crystal structure of mn catalase from thermus thermophilus complexed with chloride 0.8985 1 285
2cwl-assembly1.cif.gz_A crystal structure of manganese-free form of pseudocatalase from thermus thermophilus hb8 0.889 1 282
6j42-assembly1.cif.gz_B-2 crystal structure of wild type katb, a manganese catalase from anabaena 0.8232 1 224
ID Description Score Start End Superfamily
2cwlA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.938 3 282 1.20.1260.10
af_Q4CYB4_1172_1308_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.9221 130 182 1.20.58.1120
af_Q9C0G6_1303_1448_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.9215 128 185 1.20.58.1120
4r42B01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.895 1 193 1.20.1260.10
1jkuA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8948 1 189 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7V9H882-F1-model_v4 Manganese catalase family protein 0.9829 1 88
AF-A0A7K0PBL1-F1-model_v4 Manganese catalase family protein 0.9754 1 87
AF-A0A6J4SF62-F1-model_v4 Manganese catalase (EC 1.11.1.6) 0.9564 1 289 GO:0004096
AF-A0A4Q3AWB6-F1-model_v4 deleted 0.9564 1 88
AF-A0A4R1T4U3-F1-model_v4 deleted 0.9537 1 188

Map