F474553
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 676 | 241 | 1352 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0122747|Ga0501036_0122747_575_1597 |
| Length | 340 |
| Sequence | MITRIDRILTELPPPSDPDPDGAAAVQELMGGRFGELSTFMNYTFQSFNFRNRQGARPFYDLIANIAAEEFGHIELVATTINTMLSGASPTANGRAPKPSLRGVKGVGNPHHFLAGGQGALPQNSQGRPWNGDYVFSSGDLVEDLTHNFFLETGARNNKLKVYEMVEHPAARALTGYLLVRGGVHQVAYARALERLTGADLMKLFPSPRIPTAKIPECKPHIARGDHVRLYRYSPSDYLELAAVWNGPHPETGEELVVIDETPEGALAHDLPSQPAVFAPDYAPEEIADIATMLRTKAGLPKQPTGEVASEGASSRRSRSTARKPGAGGRRAKAGTGSRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 83 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 150 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 151 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 152 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 154 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 155 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 156 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 160 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 161 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 162 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 166 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 175 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 178 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 190 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 191 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 192 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 233 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 234 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 236 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 239 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 240 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 241 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.82 |
| Metatranscriptomes | 0.89 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.51 |
| Nodule | 0 |
| Rhizoplane | 9.02 |
| Rhizosphere | 83.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501036_0122747 | 3300049572 | Bacteria | 2194 |
| 2 | JGI25406J46586_10005508 | 3300003203 | Bacteria | 5862 |
| 3 | JGI25407J50210_10005900 | 3300003373 | Bacteria | 3029 |
| 4 | JGI25407J50210_10006293 | 3300003373 | Bacteria | 2952 |
| 5 | JGI25407J50210_10007416 | 3300003373 | Unclassified | 2746 |
| 6 | JGI25407J50210_10020872 | 3300003373 | Bacteria | 1703 |
| 7 | Ga0070676_10094962 | 3300005328 | Bacteria | 1833 |
| 8 | Ga0070666_10001731 | 3300005335 | Bacteria | 13313 |
| 9 | Ga0070680_100000377 | 3300005336 | Bacteria | 30109 |
| 10 | Ga0070680_100270873 | 3300005336 | Bacteria | 1438 |
| 11 | Ga0070682_100009338 | 3300005337 | Bacteria | 5552 |
| 12 | Ga0070682_100028195 | 3300005337 | Bacteria | 3376 |
| 13 | Ga0070682_100045514 | 3300005337 | Bacteria | 2720 |
| 14 | Ga0070682_100243519 | 3300005337 | Bacteria | 1292 |
| 15 | Ga0068868_100089099 | 3300005338 | Bacteria | 2484 |
| 16 | Ga0068868_100262550 | 3300005338 | Bacteria | 1457 |
| 17 | Ga0070689_100101211 | 3300005340 | Bacteria | 2280 |
| 18 | Ga0070661_100062397 | 3300005344 | Bacteria | 2736 |
| 19 | Ga0070661_100245909 | 3300005344 | Bacteria | 1379 |
| 20 | Ga0070668_100048526 | 3300005347 | Bacteria | 3265 |
| 21 | Ga0070668_100093329 | 3300005347 | Bacteria | 2375 |
| 22 | Ga0070668_100160210 | 3300005347 | Bacteria | 1825 |
| 23 | Ga0070674_100115428 | 3300005356 | Bacteria | 1979 |
| 24 | Ga0070674_100300886 | 3300005356 | Bacteria | 1279 |
| 25 | Ga0070673_100219937 | 3300005364 | Bacteria | 1643 |
| 26 | Ga0070659_100049821 | 3300005366 | Bacteria | 3294 |
| 27 | Ga0070659_100052652 | 3300005366 | Bacteria | 3202 |
| 28 | Ga0070659_100375635 | 3300005366 | Bacteria | 1196 |
| 29 | Ga0070667_100006217 | 3300005367 | Bacteria | 9936 |
| 30 | Ga0070701_10073492 | 3300005438 | Bacteria | 1834 |
| 31 | Ga0070711_100142960 | 3300005439 | Bacteria | 1796 |
| 32 | Ga0070711_100208184 | 3300005439 | Bacteria | 1513 |
| 33 | Ga0070705_100035123 | 3300005440 | Bacteria | 2808 |
| 34 | Ga0070700_100038737 | 3300005441 | Bacteria | 2908 |
| 35 | Ga0070700_100066220 | 3300005441 | Bacteria | 2292 |
| 36 | Ga0070700_100386092 | 3300005441 | Bacteria | 1049 |
| 37 | Ga0070694_100173209 | 3300005444 | Bacteria | 1591 |
| 38 | Ga0070663_100115196 | 3300005455 | Bacteria | 2024 |
| 39 | Ga0070663_100203071 | 3300005455 | Bacteria | 1548 |
| 40 | Ga0070678_100005959 | 3300005456 | Bacteria | 7097 |
| 41 | Ga0070678_100158411 | 3300005456 | Bacteria | 1831 |
| 42 | Ga0070662_100003436 | 3300005457 | Bacteria | 9874 |
| 43 | Ga0070681_10108608 | 3300005458 | Bacteria | 2715 |
| 44 | Ga0070679_100001463 | 3300005530 | Bacteria | 20928 |
| 45 | Ga0070679_100006632 | 3300005530 | Bacteria | 10794 |
| 46 | Ga0070684_100052205 | 3300005535 | Bacteria | 3554 |
| 47 | Ga0070684_100182268 | 3300005535 | Bacteria | 1909 |
| 48 | Ga0070684_100227388 | 3300005535 | Bacteria | 1703 |
| 49 | Ga0068853_100098586 | 3300005539 | Bacteria | 2581 |
| 50 | Ga0070686_100114649 | 3300005544 | Bacteria | 1841 |
| 51 | Ga0070665_100012257 | 3300005548 | Bacteria | 8642 |
| 52 | Ga0070665_100036254 | 3300005548 | Bacteria | 4961 |
| 53 | Ga0070665_100037474 | 3300005548 | Bacteria | 4877 |
| 54 | Ga0070665_100113512 | 3300005548 | Bacteria | 2712 |
| 55 | Ga0068855_100600422 | 3300005563 | Bacteria | 1187 |
| 56 | Ga0070664_100079587 | 3300005564 | Bacteria | 2821 |
| 57 | Ga0070664_100153089 | 3300005564 | Bacteria | 2037 |
| 58 | Ga0068857_100164099 | 3300005577 | Bacteria | 2017 |
| 59 | Ga0068854_100049607 | 3300005578 | Bacteria | 2999 |
| 60 | Ga0068854_100207087 | 3300005578 | Bacteria | 1545 |
| 61 | Ga0068856_100018280 | 3300005614 | Bacteria | 6796 |
| 62 | Ga0068856_100023860 | 3300005614 | Bacteria | 5950 |
| 63 | Ga0068856_100052107 | 3300005614 | Bacteria | 4035 |
| 64 | Ga0068856_100170885 | 3300005614 | Bacteria | 2186 |
| 65 | Ga0070702_100011574 | 3300005615 | Bacteria | 4391 |
| 66 | Ga0070702_100017182 | 3300005615 | Bacteria | 3727 |
| 67 | Ga0070702_100085052 | 3300005615 | Bacteria | 1904 |
| 68 | Ga0068852_100002053 | 3300005616 | Bacteria | 13727 |
| 69 | Ga0068852_100273727 | 3300005616 | Bacteria | 1626 |
| 70 | Ga0068864_100126088 | 3300005618 | Bacteria | 2294 |
| 71 | Ga0068866_10017369 | 3300005718 | Bacteria | 3235 |
| 72 | Ga0068866_10187048 | 3300005718 | Bacteria | 1228 |
| 73 | Ga0068861_100177847 | 3300005719 | Bacteria | 1768 |
| 74 | Ga0068861_100215218 | 3300005719 | Bacteria | 1621 |
| 75 | Ga0068858_100294091 | 3300005842 | Bacteria | 1548 |
| 76 | Ga0068860_100091425 | 3300005843 | Bacteria | 2899 |
| 77 | Ga0068862_100145332 | 3300005844 | Bacteria | 2107 |
| 78 | Ga0081455_10005766 | 3300005937 | Bacteria | 13500 |
| 79 | Ga0081455_10052151 | 3300005937 | Bacteria | 3504 |
| 80 | Ga0081455_10126056 | 3300005937 | Bacteria | 2009 |
| 81 | Ga0081538_10000118 | 3300005981 | Bacteria | 79260 |
| 82 | Ga0081538_10000412 | 3300005981 | Bacteria | 48367 |
| 83 | Ga0081538_10000761 | 3300005981 | Bacteria | 35201 |
| 84 | Ga0081538_10001198 | 3300005981 | Bacteria | 27247 |
| 85 | Ga0081538_10001226 | 3300005981 | Bacteria | 26905 |
| 86 | Ga0081538_10001966 | 3300005981 | Bacteria | 20583 |
| 87 | Ga0081538_10003093 | 3300005981 | Bacteria | 15824 |
| 88 | Ga0081538_10003665 | 3300005981 | Bacteria | 14434 |
| 89 | Ga0081538_10004687 | 3300005981 | Bacteria | 12526 |
| 90 | Ga0081538_10004940 | 3300005981 | Bacteria | 12147 |
| 91 | Ga0081538_10006114 | 3300005981 | Bacteria | 10692 |
| 92 | Ga0081538_10006708 | 3300005981 | Bacteria | 10077 |
| 93 | Ga0081538_10011012 | 3300005981 | Bacteria | 7358 |
| 94 | Ga0081538_10012383 | 3300005981 | Bacteria | 6837 |
| 95 | Ga0081538_10016899 | 3300005981 | Bacteria | 5566 |
| 96 | Ga0081538_10022203 | 3300005981 | Bacteria | 4605 |
| 97 | Ga0081538_10059746 | 3300005981 | Bacteria | 2199 |
| 98 | Ga0081538_10074669 | 3300005981 | Bacteria | 1844 |
| 99 | Ga0081540_1025569 | 3300005983 | Bacteria | 3393 |
| 100 | Ga0081539_10000181 | 3300005985 | Bacteria | 148250 |
| 101 | Ga0081539_10002286 | 3300005985 | Bacteria | 27753 |
| 102 | Ga0081539_10005362 | 3300005985 | Bacteria | 13135 |
| 103 | Ga0081539_10008446 | 3300005985 | Bacteria | 8974 |
| 104 | Ga0075365_10017909 | 3300006038 | Bacteria | 4346 |
| 105 | Ga0075365_10066553 | 3300006038 | Bacteria | 2418 |
| 106 | Ga0075365_10092730 | 3300006038 | Bacteria | 2059 |
| 107 | Ga0075365_10096809 | 3300006038 | Bacteria | 2017 |
| 108 | Ga0075363_100144458 | 3300006048 | Bacteria | 1341 |
| 109 | Ga0075363_100166102 | 3300006048 | Bacteria | 1251 |
| 110 | Ga0075364_10009847 | 3300006051 | Bacteria | 5749 |
| 111 | Ga0075364_10034197 | 3300006051 | Bacteria | 3278 |
| 112 | Ga0070715_10027388 | 3300006163 | Bacteria | 2277 |
| 113 | Ga0070715_10152025 | 3300006163 | Bacteria | 1135 |
| 114 | Ga0070712_100050185 | 3300006175 | Bacteria | 2901 |
| 115 | Ga0097621_100042024 | 3300006237 | Bacteria | 3682 |
| 116 | Ga0068871_100068423 | 3300006358 | Bacteria | 2916 |
| 117 | Ga0075428_100016123 | 3300006844 | Bacteria | 8259 |
| 118 | Ga0075428_100113374 | 3300006844 | Bacteria | 2954 |
| 119 | Ga0075428_100690508 | 3300006844 | Bacteria | 1087 |
| 120 | Ga0075430_100041116 | 3300006846 | Bacteria | 3912 |
| 121 | Ga0075430_100061698 | 3300006846 | Bacteria | 3150 |
| 122 | Ga0075430_100070457 | 3300006846 | Bacteria | 2933 |
| 123 | Ga0075431_100054563 | 3300006847 | Bacteria | 4121 |
| 124 | Ga0075429_100083935 | 3300006880 | Bacteria | 2776 |
| 125 | Ga0068865_100031397 | 3300006881 | Bacteria | 3542 |
| 126 | Ga0105240_10094004 | 3300009093 | Bacteria | 3658 |
| 127 | Ga0111539_10024265 | 3300009094 | Bacteria | 7446 |
| 128 | Ga0111539_10052620 | 3300009094 | Bacteria | 4847 |
| 129 | Ga0111539_10159476 | 3300009094 | Bacteria | 2638 |
| 130 | Ga0111539_10520709 | 3300009094 | Bacteria | 1385 |
| 131 | Ga0111539_10717123 | 3300009094 | Bacteria | 1164 |
| 132 | Ga0105245_10011669 | 3300009098 | Bacteria | 7647 |
| 133 | Ga0105245_10011707 | 3300009098 | Bacteria | 7634 |
| 134 | Ga0105245_10013599 | 3300009098 | Bacteria | 7090 |
| 135 | Ga0105245_10134055 | 3300009098 | Bacteria | 2326 |
| 136 | Ga0105245_10604309 | 3300009098 | Bacteria | 1124 |
| 137 | Ga0105247_10096510 | 3300009101 | Bacteria | 1884 |
| 138 | Ga0105247_10179318 | 3300009101 | Bacteria | 1413 |
| 139 | Ga0114129_10009215 | 3300009147 | Bacteria | 14076 |
| 140 | Ga0114129_10045594 | 3300009147 | Bacteria | 6162 |
| 141 | Ga0114129_10154324 | 3300009147 | Bacteria | 3141 |
| 142 | Ga0114129_10469821 | 3300009147 | Bacteria | 1647 |
| 143 | Ga0114129_10517162 | 3300009147 | Bacteria | 1557 |
| 144 | Ga0105243_10027628 | 3300009148 | Bacteria | 4349 |
| 145 | Ga0105243_10031322 | 3300009148 | Bacteria | 4100 |
| 146 | Ga0105243_10090349 | 3300009148 | Bacteria | 2520 |
| 147 | Ga0105243_10188412 | 3300009148 | Bacteria | 1800 |
| 148 | Ga0105243_10229337 | 3300009148 | Bacteria | 1647 |
| 149 | Ga0105243_10270036 | 3300009148 | Bacteria | 1527 |
| 150 | Ga0105242_10003435 | 3300009176 | Bacteria | 12313 |
| 151 | Ga0105242_10384214 | 3300009176 | Bacteria | 1306 |
| 152 | Ga0105242_10425091 | 3300009176 | Bacteria | 1246 |
| 153 | Ga0105242_10525359 | 3300009176 | Bacteria | 1130 |
| 154 | Ga0105242_10537500 | 3300009176 | Bacteria | 1118 |
| 155 | Ga0105248_10039635 | 3300009177 | Bacteria | 5279 |
| 156 | Ga0105248_10367092 | 3300009177 | Bacteria | 1620 |
| 157 | Ga0105237_10176225 | 3300009545 | Bacteria | 2138 |
| 158 | Ga0105238_10008186 | 3300009551 | Bacteria | 10457 |
| 159 | Ga0105238_10126326 | 3300009551 | Bacteria | 2536 |
| 160 | Ga0105238_10554428 | 3300009551 | Bacteria | 1154 |
| 161 | Ga0105249_10088299 | 3300009553 | Bacteria | 2896 |
| 162 | Ga0105249_10109058 | 3300009553 | Bacteria | 2614 |
| 163 | Ga0105249_10587921 | 3300009553 | Bacteria | 1167 |
| 164 | Ga0105239_10103464 | 3300010375 | Bacteria | 3151 |
| 165 | Ga0105239_10137793 | 3300010375 | Bacteria | 2717 |
| 166 | Ga0105239_10287316 | 3300010375 | Bacteria | 1852 |
| 167 | Ga0105239_10294474 | 3300010375 | Bacteria | 1827 |
| 168 | Ga0105239_10310404 | 3300010375 | Bacteria | 1778 |
| 169 | Ga0105239_10556173 | 3300010375 | Bacteria | 1307 |
| 170 | Ga0157370_10210897 | 3300013104 | Bacteria | 1800 |
| 171 | Ga0157369_10003461 | 3300013105 | Bacteria | 18728 |
| 172 | Ga0157369_10374906 | 3300013105 | Bacteria | 1477 |
| 173 | Ga0157369_10662815 | 3300013105 | Bacteria | 1076 |
| 174 | Ga0157374_10005535 | 3300013296 | Bacteria | 10623 |
| 175 | Ga0163162_10147760 | 3300013306 | Bacteria | 2467 |
| 176 | Ga0157372_10003908 | 3300013307 | Bacteria | 16015 |
| 177 | Ga0157372_10017098 | 3300013307 | Bacteria | 7785 |
| 178 | Ga0157372_10083623 | 3300013307 | Bacteria | 3616 |
| 179 | Ga0157375_10002684 | 3300013308 | Bacteria | 15420 |
| 180 | Ga0157375_10237967 | 3300013308 | Bacteria | 1980 |
| 181 | Ga0182008_10177910 | 3300014497 | Bacteria | 1076 |
| 182 | Ga0157377_10022644 | 3300014745 | Bacteria | 3321 |
| 183 | Ga0157377_10144646 | 3300014745 | Bacteria | 1464 |
| 184 | Ga0157379_10002851 | 3300014968 | Bacteria | 14570 |
| 185 | Ga0157376_10329940 | 3300014969 | Bacteria | 1453 |
| 186 | Ga0157376_10496926 | 3300014969 | Bacteria | 1198 |
| 187 | Ga0206353_11303487 | 3300020082 | Bacteria | 1150 |
| 188 | Ga0206353_11573877 | 3300020082 | Bacteria | 1713 |
| 189 | Ga0206353_11726145 | 3300020082 | Bacteria | 4272 |
| 190 | Ga0213873_10005797 | 3300021358 | Bacteria | 2393 |
| 191 | Ga0213874_10000194 | 3300021377 | Bacteria | 11051 |
| 192 | Ga0213874_10004563 | 3300021377 | Bacteria | 3177 |
| 193 | Ga0213874_10070137 | 3300021377 | Bacteria | 1116 |
| 194 | Ga0213876_10035417 | 3300021384 | Bacteria | 2633 |
| 195 | Ga0213876_10037113 | 3300021384 | Bacteria | 2570 |
| 196 | Ga0213875_10041825 | 3300021388 | Bacteria | 2155 |
| 197 | Ga0213875_10108527 | 3300021388 | Bacteria | 1295 |
| 198 | Ga0224712_10005082 | 3300022467 | Bacteria | 3623 |
| 199 | Ga0224712_10079041 | 3300022467 | Bacteria | 1353 |
| 200 | Ga0224712_10169566 | 3300022467 | Bacteria | 978 |
| 201 | Ga0207656_10045167 | 3300025321 | Bacteria | 1884 |
| 202 | Ga0207688_10092123 | 3300025901 | Bacteria | 1741 |
| 203 | Ga0207688_10119438 | 3300025901 | Bacteria | 1537 |
| 204 | Ga0207680_10002563 | 3300025903 | Bacteria | 8470 |
| 205 | Ga0207647_10034082 | 3300025904 | Bacteria | 3254 |
| 206 | Ga0207705_10052426 | 3300025909 | Bacteria | 2937 |
| 207 | Ga0207705_10249680 | 3300025909 | Bacteria | 1353 |
| 208 | Ga0207707_10001967 | 3300025912 | Bacteria | 18672 |
| 209 | Ga0207695_10131582 | 3300025913 | Bacteria | 2459 |
| 210 | Ga0207693_10180948 | 3300025915 | Bacteria | 1659 |
| 211 | Ga0207660_10012386 | 3300025917 | Bacteria | 5580 |
| 212 | Ga0207662_10017897 | 3300025918 | Bacteria | 4013 |
| 213 | Ga0207657_10208957 | 3300025919 | Bacteria | 1567 |
| 214 | Ga0207649_10021303 | 3300025920 | Bacteria | 3729 |
| 215 | Ga0207649_10321122 | 3300025920 | Bacteria | 1138 |
| 216 | Ga0207652_10002299 | 3300025921 | Bacteria | 16199 |
| 217 | Ga0207652_10059594 | 3300025921 | Bacteria | 3291 |
| 218 | Ga0207687_10040262 | 3300025927 | Bacteria | 3203 |
| 219 | Ga0207687_10099715 | 3300025927 | Bacteria | 2135 |
| 220 | Ga0207687_10106685 | 3300025927 | Bacteria | 2071 |
| 221 | Ga0207687_10118863 | 3300025927 | Bacteria | 1973 |
| 222 | Ga0207687_10128792 | 3300025927 | Bacteria | 1904 |
| 223 | Ga0207687_10133616 | 3300025927 | Bacteria | 1874 |
| 224 | Ga0207690_10053114 | 3300025932 | Bacteria | 2717 |
| 225 | Ga0207690_10154274 | 3300025932 | Bacteria | 1705 |
| 226 | Ga0207686_10050907 | 3300025934 | Bacteria | 2578 |
| 227 | Ga0207709_10021582 | 3300025935 | Bacteria | 3647 |
| 228 | Ga0207704_10025467 | 3300025938 | Bacteria | 3228 |
| 229 | Ga0207704_10150092 | 3300025938 | Bacteria | 1643 |
| 230 | Ga0207691_10085028 | 3300025940 | Bacteria | 2839 |
| 231 | Ga0207711_10199015 | 3300025941 | Bacteria | 1828 |
| 232 | Ga0207661_10001506 | 3300025944 | Bacteria | 15789 |
| 233 | Ga0207661_10093794 | 3300025944 | Bacteria | 2506 |
| 234 | Ga0207679_10027539 | 3300025945 | Bacteria | 3932 |
| 235 | Ga0207679_10126146 | 3300025945 | Bacteria | 2045 |
| 236 | Ga0207679_10205774 | 3300025945 | Bacteria | 1647 |
| 237 | Ga0207651_10439930 | 3300025960 | Bacteria | 1117 |
| 238 | Ga0207712_10079965 | 3300025961 | Bacteria | 2376 |
| 239 | Ga0207712_10411721 | 3300025961 | Bacteria | 1139 |
| 240 | Ga0207668_10012905 | 3300025972 | Bacteria | 5130 |
| 241 | Ga0207668_10095258 | 3300025972 | Bacteria | 2197 |
| 242 | Ga0207668_10165151 | 3300025972 | Bacteria | 1730 |
| 243 | Ga0207668_10171640 | 3300025972 | Bacteria | 1701 |
| 244 | Ga0207668_10185421 | 3300025972 | Bacteria | 1645 |
| 245 | Ga0207668_10229496 | 3300025972 | Bacteria | 1496 |
| 246 | Ga0207640_10040498 | 3300025981 | Bacteria | 2956 |
| 247 | Ga0207640_10190851 | 3300025981 | Bacteria | 1544 |
| 248 | Ga0207658_10010603 | 3300025986 | Bacteria | 6263 |
| 249 | Ga0207658_10114215 | 3300025986 | Bacteria | 2141 |
| 250 | Ga0207703_10424681 | 3300026035 | Bacteria | 1237 |
| 251 | Ga0207639_10048571 | 3300026041 | Bacteria | 3213 |
| 252 | Ga0207639_10085495 | 3300026041 | Bacteria | 2508 |
| 253 | Ga0207678_10038844 | 3300026067 | Bacteria | 4133 |
| 254 | Ga0207678_10149064 | 3300026067 | Bacteria | 1997 |
| 255 | Ga0207708_10034160 | 3300026075 | Bacteria | 3867 |
| 256 | Ga0207708_10100514 | 3300026075 | Bacteria | 2238 |
| 257 | Ga0207702_10004813 | 3300026078 | Bacteria | 11901 |
| 258 | Ga0207702_10039380 | 3300026078 | Bacteria | 3960 |
| 259 | Ga0207702_10140610 | 3300026078 | Bacteria | 2184 |
| 260 | Ga0207702_10243415 | 3300026078 | Bacteria | 1686 |
| 261 | Ga0207641_10513284 | 3300026088 | Bacteria | 1165 |
| 262 | Ga0207648_10366143 | 3300026089 | Bacteria | 1301 |
| 263 | Ga0207648_10465501 | 3300026089 | Bacteria | 1153 |
| 264 | Ga0207676_10447750 | 3300026095 | Bacteria | 1217 |
| 265 | Ga0207676_10511898 | 3300026095 | Bacteria | 1141 |
| 266 | Ga0207674_10017500 | 3300026116 | Bacteria | 7819 |
| 267 | Ga0207675_100030323 | 3300026118 | Bacteria | 5036 |
| 268 | Ga0207675_100043207 | 3300026118 | Bacteria | 4209 |
| 269 | Ga0207683_10000904 | 3300026121 | Bacteria | 27318 |
| 270 | Ga0207683_10289236 | 3300026121 | Bacteria | 1498 |
| 271 | Ga0207683_10498003 | 3300026121 | Bacteria | 1125 |
| 272 | Ga0207698_10047788 | 3300026142 | Bacteria | 3245 |
| 273 | Ga0207698_10124074 | 3300026142 | Bacteria | 2192 |
| 274 | Ga0207698_10134589 | 3300026142 | Bacteria | 2118 |
| 275 | Ga0207698_10313381 | 3300026142 | Bacteria | 1466 |
| 276 | Ga0207428_10033790 | 3300027907 | Bacteria | 4195 |
| 277 | Ga0207428_10249286 | 3300027907 | Bacteria | 1325 |
| 278 | Ga0207428_10285006 | 3300027907 | Bacteria | 1225 |
| 279 | Ga0268266_10001725 | 3300028379 | Bacteria | 25033 |
| 280 | Ga0268266_10025080 | 3300028379 | Bacteria | 5075 |
| 281 | Ga0268266_10036137 | 3300028379 | Bacteria | 4203 |
| 282 | Ga0268266_10403040 | 3300028379 | Bacteria | 1293 |
| 283 | Ga0268265_10364449 | 3300028380 | Bacteria | 1324 |
| 284 | Ga0268264_10079767 | 3300028381 | Bacteria | 2793 |
| 285 | Ga0307408_100082903 | 3300031548 | Bacteria | 2401 |
| 286 | Ga0307405_10057739 | 3300031731 | Bacteria | 2439 |
| 287 | Ga0307405_10114052 | 3300031731 | Bacteria | 1836 |
| 288 | Ga0307413_10010236 | 3300031824 | Bacteria | 4536 |
| 289 | Ga0307413_10056028 | 3300031824 | Bacteria | 2402 |
| 290 | Ga0307413_10123563 | 3300031824 | Bacteria | 1758 |
| 291 | Ga0307410_10012040 | 3300031852 | Bacteria | 4978 |
| 292 | Ga0307410_10053395 | 3300031852 | Bacteria | 2735 |
| 293 | Ga0307410_10264304 | 3300031852 | Bacteria | 1343 |
| 294 | Ga0307406_10028555 | 3300031901 | Bacteria | 3371 |
| 295 | Ga0307406_10094008 | 3300031901 | Bacteria | 2026 |
| 296 | Ga0307406_10138584 | 3300031901 | Bacteria | 1719 |
| 297 | Ga0307406_10370782 | 3300031901 | Bacteria | 1125 |
| 298 | Ga0307406_10407587 | 3300031901 | Bacteria | 1079 |
| 299 | Ga0307407_10018604 | 3300031903 | Bacteria | 3518 |
| 300 | Ga0307407_10071469 | 3300031903 | Bacteria | 2066 |
| 301 | Ga0307407_10090742 | 3300031903 | Bacteria | 1872 |
| 302 | Ga0307412_10113760 | 3300031911 | Bacteria | 1937 |
| 303 | Ga0307409_100000655 | 3300031995 | Bacteria | 15334 |
| 304 | Ga0307409_100011147 | 3300031995 | Bacteria | 5646 |
| 305 | Ga0307409_100121568 | 3300031995 | Bacteria | 2212 |
| 306 | Ga0307409_100234667 | 3300031995 | Bacteria | 1665 |
| 307 | Ga0307409_100521768 | 3300031995 | Bacteria | 1161 |
| 308 | Ga0307416_100021508 | 3300032002 | Bacteria | 4633 |
| 309 | Ga0307416_100035957 | 3300032002 | Bacteria | 3791 |
| 310 | Ga0307416_100041122 | 3300032002 | Bacteria | 3598 |
| 311 | Ga0307416_100083179 | 3300032002 | Bacteria | 2714 |
| 312 | Ga0307416_100097413 | 3300032002 | Bacteria | 2547 |
| 313 | Ga0307416_100104311 | 3300032002 | Bacteria | 2478 |
| 314 | Ga0307416_100236167 | 3300032002 | Bacteria | 1767 |
| 315 | Ga0307416_100321996 | 3300032002 | Bacteria | 1549 |
| 316 | Ga0307416_100336211 | 3300032002 | Bacteria | 1520 |
| 317 | Ga0307416_100356466 | 3300032002 | Bacteria | 1483 |
| 318 | Ga0307416_100456345 | 3300032002 | Bacteria | 1332 |
| 319 | Ga0307414_10007256 | 3300032004 | Bacteria | 6227 |
| 320 | Ga0307414_10317682 | 3300032004 | Bacteria | 1324 |
| 321 | Ga0307414_10499131 | 3300032004 | Bacteria | 1076 |
| 322 | Ga0307411_10070932 | 3300032005 | Bacteria | 2359 |
| 323 | Ga0307411_10232787 | 3300032005 | Bacteria | 1437 |
| 324 | Ga0307415_100000531 | 3300032126 | Bacteria | 16623 |
| 325 | Ga0307415_100018102 | 3300032126 | Bacteria | 4244 |
| 326 | Ga0307415_100051609 | 3300032126 | Bacteria | 2792 |
| 327 | Ga0307415_100100912 | 3300032126 | Bacteria | 2116 |
| 328 | Ga0307415_100130455 | 3300032126 | Bacteria | 1902 |
| 329 | Ga0307415_100231515 | 3300032126 | Bacteria | 1488 |
| 330 | Ga0395899_0093690 | 3300037312 | Bacteria | 2174 |
| 331 | Ga0395900_0111597 | 3300037418 | Bacteria | 2808 |
| 332 | Ga0395900_0289067 | 3300037418 | Bacteria | 1628 |
| 333 | Ga0395900_0324321 | 3300037418 | Bacteria | 1519 |
| 334 | Ga0395898_0051651 | 3300037466 | Bacteria | 4019 |
| 335 | Ga0395898_0178783 | 3300037466 | Bacteria | 2027 |
| 336 | Ga0395898_0270790 | 3300037466 | Bacteria | 1620 |
| 337 | Ga0395905_0044404 | 3300037471 | Bacteria | 4171 |
| 338 | Ga0436364_0801814 | 3300037853 | Bacteria | 17054 |
| 339 | Ga0436364_0888707 | 3300037853 | Bacteria | 2174 |
| 340 | Ga0436364_0911658 | 3300037853 | Bacteria | 6802 |
| 341 | Ga0436364_1492429 | 3300037853 | Bacteria | 2906 |
| 342 | Ga0395901_0011145 | 3300038443 | Bacteria | 9110 |
| 343 | Ga0395901_0078852 | 3300038443 | Bacteria | 3439 |
| 344 | Ga0395901_0123458 | 3300038443 | Bacteria | 2721 |
| 345 | Ga0395901_0208182 | 3300038443 | Bacteria | 2048 |
| 346 | Ga0395901_0791978 | 3300038443 | Bacteria | 938 |
| 347 | Ga0436365_0392863 | 3300039437 | Bacteria | 8115 |
| 348 | Ga0436365_0440302 | 3300039437 | Bacteria | 2630 |
| 349 | Ga0436365_0494652 | 3300039437 | Bacteria | 13610 |
| 350 | Ga0436365_0855903 | 3300039437 | Bacteria | 2872 |
| 351 | Ga0436365_0987560 | 3300039437 | Bacteria | 2176 |
| 352 | Ga0436365_1294762 | 3300039437 | Bacteria | 9834 |
| 353 | Ga0436365_1901512 | 3300039437 | Bacteria | 29147 |
| 354 | Ga0436363_0101887 | 3300039450 | Bacteria | 3363 |
| 355 | Ga0436363_0108530 | 3300039450 | Bacteria | 1350 |
| 356 | Ga0436363_0151266 | 3300039450 | Bacteria | 15043 |
| 357 | Ga0436363_0605788 | 3300039450 | Bacteria | 12820 |
| 358 | Ga0436363_0820817 | 3300039450 | Bacteria | 1865 |
| 359 | Ga0436362_0062100 | 3300039453 | Bacteria | 2617 |
| 360 | Ga0436362_0264531 | 3300039453 | Bacteria | 1425 |
| 361 | Ga0436362_0435205 | 3300039453 | Bacteria | 2105 |
| 362 | Ga0436362_0668447 | 3300039453 | Bacteria | 1122 |
| 363 | Ga0436362_0943907 | 3300039453 | Bacteria | 6000 |
| 364 | Ga0439461_0001977 | 3300041410 | Bacteria | 3238 |
| 365 | Ga0451798_0590354 | 3300041458 | Bacteria | 1289 |
| 366 | Ga0451853_0007471 | 3300041512 | Bacteria | 2109 |
| 367 | Ga0451853_2379236 | 3300041512 | Archaea | 2293 |
| 368 | Ga0439448_0012121 | 3300042005 | Bacteria | 2575 |
| 369 | Ga0439435_0018557 | 3300042436 | Bacteria | 1772 |
| 370 | Ga0450918_003461 | 3300042531 | Bacteria | 2932 |
| 371 | Ga0466965_0019495 | 3300044683 | Bacteria | 3256 |
| 372 | Ga0466965_0035871 | 3300044683 | Bacteria | 2431 |
| 373 | Ga0466963_0005462 | 3300044694 | Bacteria | 7442 |
| 374 | Ga0466963_0006299 | 3300044694 | Bacteria | 7015 |
| 375 | Ga0466963_0013615 | 3300044694 | Bacteria | 4999 |
| 376 | Ga0466963_0040989 | 3300044694 | Bacteria | 3035 |
| 377 | Ga0466963_0101156 | 3300044694 | Bacteria | 1973 |
| 378 | Ga0466963_0170351 | 3300044694 | Bacteria | 1518 |
| 379 | Ga0466963_0217703 | 3300044694 | Bacteria | 1337 |
| 380 | Ga0466963_0280086 | 3300044694 | Bacteria | 1172 |
| 381 | Ga0466963_0517836 | 3300044694 | Bacteria | 842 |
| 382 | Ga0466964_0011611 | 3300044706 | Bacteria | 3330 |
| 383 | Ga0466971_0070334 | 3300044719 | Bacteria | 1589 |
| 384 | Ga0466968_0004627 | 3300044735 | Bacteria | 5146 |
| 385 | Ga0466970_0132463 | 3300044765 | Bacteria | 1370 |
| 386 | Ga0466957_0009461 | 3300044842 | Bacteria | 5564 |
| 387 | Ga0466957_0041067 | 3300044842 | Bacteria | 2797 |
| 388 | Ga0466957_0230048 | 3300044842 | Bacteria | 1227 |
| 389 | Ga0466957_0256090 | 3300044842 | Bacteria | 1165 |
| 390 | Ga0466960_0000005 | 3300044901 | Bacteria | 72219 |
| 391 | Ga0466959_0050868 | 3300045049 | Bacteria | 3041 |
| 392 | Ga0466959_0084022 | 3300045049 | Bacteria | 2292 |
| 393 | Ga0466959_0086058 | 3300045049 | Bacteria | 2261 |
| 394 | Ga0466959_0119662 | 3300045049 | Bacteria | 1873 |
| 395 | Ga0466959_0131804 | 3300045049 | Bacteria | 1771 |
| 396 | Ga0466958_0003457 | 3300045836 | Bacteria | 8193 |
| 397 | Ga0466958_0010849 | 3300045836 | Bacteria | 5116 |
| 398 | Ga0466958_0012328 | 3300045836 | Bacteria | 4841 |
| 399 | Ga0466958_0259870 | 3300045836 | Bacteria | 1111 |
| 400 | Ga0466967_0000503 | 3300045976 | Bacteria | 19151 |
| 401 | Ga0466967_0006242 | 3300045976 | Bacteria | 8404 |
| 402 | Ga0466967_0015486 | 3300045976 | Bacteria | 5977 |
| 403 | Ga0466967_0043510 | 3300045976 | Bacteria | 3889 |
| 404 | Ga0466967_0055287 | 3300045976 | Bacteria | 3496 |
| 405 | Ga0466967_0059767 | 3300045976 | Bacteria | 3375 |
| 406 | Ga0466967_0070822 | 3300045976 | Bacteria | 3120 |
| 407 | Ga0466967_0094369 | 3300045976 | Bacteria | 2724 |
| 408 | Ga0466967_0107032 | 3300045976 | Bacteria | 2564 |
| 409 | Ga0466967_0221474 | 3300045976 | Bacteria | 1798 |
| 410 | Ga0466967_0247806 | 3300045976 | Bacteria | 1701 |
| 411 | Ga0466967_0251497 | 3300045976 | Bacteria | 1688 |
| 412 | Ga0466967_0392825 | 3300045976 | Bacteria | 1348 |
| 413 | Ga0495650_0000121 | 3300046471 | Bacteria | 183055 |
| 414 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 415 | Ga0495672_0020993 | 3300047320 | Bacteria | 4267 |
| 416 | Ga0495672_0033312 | 3300047320 | Bacteria | 3192 |
| 417 | Ga0496100_0002667 | 3300048903 | Bacteria | 9094 |
| 418 | Ga0496100_0093713 | 3300048903 | Bacteria | 2055 |
| 419 | Ga0496100_0225510 | 3300048903 | Bacteria | 1377 |
| 420 | Ga0496101_0125818 | 3300048904 | Bacteria | 1942 |
| 421 | Ga0496101_0146273 | 3300048904 | Bacteria | 1805 |
| 422 | Ga0496101_0164381 | 3300048904 | Bacteria | 1703 |
| 423 | Ga0496102_0051057 | 3300048905 | Bacteria | 3767 |
| 424 | Ga0496102_0118769 | 3300048905 | Bacteria | 2468 |
| 425 | Ga0496102_0250353 | 3300048905 | Bacteria | 1670 |
| 426 | Ga0496103_0007811 | 3300048906 | Bacteria | 6357 |
| 427 | Ga0496103_0029643 | 3300048906 | Bacteria | 3326 |
| 428 | Ga0496103_0089230 | 3300048906 | Bacteria | 1945 |
| 429 | Ga0496104_0008134 | 3300048907 | Bacteria | 9305 |
| 430 | Ga0496104_0066553 | 3300048907 | Bacteria | 3421 |
| 431 | Ga0496104_0073837 | 3300048907 | Bacteria | 3245 |
| 432 | Ga0496104_0412103 | 3300048907 | Bacteria | 1263 |
| 433 | Ga0496105_0002183 | 3300048908 | Bacteria | 14166 |
| 434 | Ga0496105_0007438 | 3300048908 | Bacteria | 8477 |
| 435 | Ga0496105_0213906 | 3300048908 | Bacteria | 1571 |
| 436 | Ga0496106_0022070 | 3300048909 | Bacteria | 4728 |
| 437 | Ga0496106_0048459 | 3300048909 | Bacteria | 3199 |
| 438 | Ga0496106_0152753 | 3300048909 | Bacteria | 1822 |
| 439 | Ga0496107_0011637 | 3300048910 | Bacteria | 6131 |
| 440 | Ga0496107_0052903 | 3300048910 | Bacteria | 2929 |
| 441 | Ga0496107_0116788 | 3300048910 | Bacteria | 1964 |
| 442 | Ga0496108_0000894 | 3300048911 | Bacteria | 23226 |
| 443 | Ga0496108_0007071 | 3300048911 | Bacteria | 9089 |
| 444 | Ga0496108_0010239 | 3300048911 | Bacteria | 7614 |
| 445 | Ga0496108_0024845 | 3300048911 | Bacteria | 4934 |
| 446 | Ga0496108_0086717 | 3300048911 | Bacteria | 2658 |
| 447 | Ga0496109_0000326 | 3300048912 | Bacteria | 44470 |
| 448 | Ga0496109_0000753 | 3300048912 | Bacteria | 26958 |
| 449 | Ga0496109_0006929 | 3300048912 | Bacteria | 9565 |
| 450 | Ga0496109_0007731 | 3300048912 | Bacteria | 9103 |
| 451 | Ga0496109_0011798 | 3300048912 | Bacteria | 7520 |
| 452 | Ga0496109_0173795 | 3300048912 | Bacteria | 2022 |
| 453 | Ga0496110_0002845 | 3300048913 | Bacteria | 13059 |
| 454 | Ga0496110_0012777 | 3300048913 | Bacteria | 6915 |
| 455 | Ga0496110_0047764 | 3300048913 | Bacteria | 3750 |
| 456 | Ga0496110_0056058 | 3300048913 | Bacteria | 3468 |
| 457 | Ga0496110_0189512 | 3300048913 | Bacteria | 1868 |
| 458 | Ga0496110_0196101 | 3300048913 | Bacteria | 1834 |
| 459 | Ga0496110_0203200 | 3300048913 | Bacteria | 1800 |
| 460 | Ga0496110_0203770 | 3300048913 | Bacteria | 1798 |
| 461 | Ga0496110_0350046 | 3300048913 | Bacteria | 1346 |
| 462 | Ga0496111_0006374 | 3300048914 | Bacteria | 7658 |
| 463 | Ga0496111_0007380 | 3300048914 | Bacteria | 7198 |
| 464 | Ga0496111_0009574 | 3300048914 | Bacteria | 6472 |
| 465 | Ga0496111_0079952 | 3300048914 | Bacteria | 2385 |
| 466 | Ga0496111_0190100 | 3300048914 | Bacteria | 1526 |
| 467 | Ga0496111_0234533 | 3300048914 | Bacteria | 1363 |
| 468 | Ga0496111_0249828 | 3300048914 | Bacteria | 1317 |
| 469 | Ga0496112_0011422 | 3300048915 | Bacteria | 8109 |
| 470 | Ga0496112_0041071 | 3300048915 | Bacteria | 4525 |
| 471 | Ga0496113_0013478 | 3300048916 | Bacteria | 5542 |
| 472 | Ga0496113_0031402 | 3300048916 | Bacteria | 3855 |
| 473 | Ga0496113_0097557 | 3300048916 | Bacteria | 2274 |
| 474 | Ga0496114_0000990 | 3300048917 | Bacteria | 21267 |
| 475 | Ga0496114_0036214 | 3300048917 | Bacteria | 4078 |
| 476 | Ga0496115_0192488 | 3300048918 | Unclassified | 1685 |
| 477 | Ga0496117_0000619 | 3300048920 | Bacteria | 57505 |
| 478 | Ga0496118_0000766 | 3300048921 | Bacteria | 51540 |
| 479 | Ga0496121_0002166 | 3300048924 | Bacteria | 30741 |
| 480 | Ga0496121_0079255 | 3300048924 | Bacteria | 2608 |
| 481 | Ga0496121_0255906 | 3300048924 | Bacteria | 1212 |
| 482 | Ga0496124_0104612 | 3300048927 | Bacteria | 2289 |
| 483 | Ga0496124_0121828 | 3300048927 | Bacteria | 2083 |
| 484 | Ga0496126_0019683 | 3300048929 | Bacteria | 6642 |
| 485 | Ga0496126_0061882 | 3300048929 | Bacteria | 3360 |
| 486 | Ga0501031_0004357 | 3300049568 | Bacteria | 9158 |
| 487 | Ga0501031_0017795 | 3300049568 | Bacteria | 4621 |
| 488 | Ga0501031_0025420 | 3300049568 | Bacteria | 3861 |
| 489 | Ga0501031_0032017 | 3300049568 | Bacteria | 3429 |
| 490 | Ga0501031_0039685 | 3300049568 | Bacteria | 3073 |
| 491 | Ga0501032_0004803 | 3300049569 | Bacteria | 10133 |
| 492 | Ga0501032_0047954 | 3300049569 | Bacteria | 2884 |
| 493 | Ga0501032_0166439 | 3300049569 | Bacteria | 1447 |
| 494 | Ga0501033_0018958 | 3300049570 | Bacteria | 5200 |
| 495 | Ga0501033_0041302 | 3300049570 | Bacteria | 3442 |
| 496 | Ga0501034_0011301 | 3300049571 | Bacteria | 9261 |
| 497 | Ga0501034_0115335 | 3300049571 | Bacteria | 2675 |
| 498 | Ga0501036_0043669 | 3300049572 | Bacteria | 3796 |
| 499 | Ga0501036_0050220 | 3300049572 | Bacteria | 3532 |
| 500 | Ga0501036_0123256 | 3300049572 | Bacteria | 2189 |
| 501 | Ga0501036_0138551 | 3300049572 | Bacteria | 2053 |
| 502 | Ga0501036_0150947 | 3300049572 | Bacteria | 1960 |
| 503 | Ga0501036_0172106 | 3300049572 | Bacteria | 1824 |
| 504 | Ga0501036_0208718 | 3300049572 | Bacteria | 1641 |
| 505 | Ga0501036_0462402 | 3300049572 | Bacteria | 1057 |
| 506 | Ga0501037_0002769 | 3300049573 | Bacteria | 12682 |
| 507 | Ga0501037_0055771 | 3300049573 | Bacteria | 2889 |
| 508 | Ga0501038_0003753 | 3300049574 | Bacteria | 14133 |
| 509 | Ga0501038_0030562 | 3300049574 | Bacteria | 4765 |
| 510 | Ga0501038_0033506 | 3300049574 | Bacteria | 4525 |
| 511 | Ga0501038_0171606 | 3300049574 | Bacteria | 1755 |
| 512 | Ga0501039_0004459 | 3300049575 | Bacteria | 10566 |
| 513 | Ga0501039_0022741 | 3300049575 | Bacteria | 4810 |
| 514 | Ga0501039_0043644 | 3300049575 | Bacteria | 3463 |
| 515 | Ga0501039_0069189 | 3300049575 | Bacteria | 2741 |
| 516 | Ga0501039_0095731 | 3300049575 | Bacteria | 2315 |
| 517 | Ga0501039_0109862 | 3300049575 | Bacteria | 2155 |
| 518 | Ga0501040_0017272 | 3300049576 | Bacteria | 4787 |
| 519 | Ga0501040_0025804 | 3300049576 | Bacteria | 3953 |
| 520 | Ga0501040_0027930 | 3300049576 | Bacteria | 3801 |
| 521 | Ga0501040_0028992 | 3300049576 | Bacteria | 3734 |
| 522 | Ga0501040_0036832 | 3300049576 | Bacteria | 3322 |
| 523 | Ga0501040_0040049 | 3300049576 | Bacteria | 3188 |
| 524 | Ga0501040_0070304 | 3300049576 | Bacteria | 2415 |
| 525 | Ga0501041_0010224 | 3300049577 | Bacteria | 5531 |
| 526 | Ga0501041_0013196 | 3300049577 | Bacteria | 4895 |
| 527 | Ga0501041_0062463 | 3300049577 | Bacteria | 2280 |
| 528 | Ga0501041_0110258 | 3300049577 | Bacteria | 1707 |
| 529 | Ga0501041_0259629 | 3300049577 | Bacteria | 1092 |
| 530 | Ga0501041_0265968 | 3300049577 | Bacteria | 1078 |
| 531 | Ga0501042_0012344 | 3300049578 | Bacteria | 5784 |
| 532 | Ga0501042_0020235 | 3300049578 | Bacteria | 4630 |
| 533 | Ga0501042_0092212 | 3300049578 | Bacteria | 2175 |
| 534 | Ga0501042_0149274 | 3300049578 | Bacteria | 1685 |
| 535 | Ga0501042_0245249 | 3300049578 | Bacteria | 1292 |
| 536 | Ga0501042_0431819 | 3300049578 | Bacteria | 955 |
| 537 | Ga0501043_0034752 | 3300049579 | Bacteria | 3964 |
| 538 | Ga0501043_0113005 | 3300049579 | Bacteria | 2133 |
| 539 | Ga0501043_0330842 | 3300049579 | Bacteria | 1160 |
| 540 | Ga0501043_0345666 | 3300049579 | Bacteria | 1131 |
| 541 | Ga0501046_0005549 | 3300049580 | Bacteria | 11270 |
| 542 | Ga0501046_0018249 | 3300049580 | Bacteria | 5841 |
| 543 | Ga0501046_0087086 | 3300049580 | Bacteria | 2407 |
| 544 | Ga0501046_0186332 | 3300049580 | Bacteria | 1549 |
| 545 | Ga0501046_0294242 | 3300049580 | Bacteria | 1187 |
| 546 | Ga0501046_0358771 | 3300049580 | Bacteria | 1057 |
| 547 | Ga0501047_0027727 | 3300049581 | Bacteria | 5458 |
| 548 | Ga0501047_0067281 | 3300049581 | Bacteria | 3452 |
| 549 | Ga0501047_0110901 | 3300049581 | Bacteria | 2626 |
| 550 | Ga0501048_0002489 | 3300049582 | Bacteria | 14066 |
| 551 | Ga0501048_0012939 | 3300049582 | Bacteria | 6198 |
| 552 | Ga0501048_0052121 | 3300049582 | Bacteria | 2911 |
| 553 | Ga0501048_0118122 | 3300049582 | Bacteria | 1873 |
| 554 | Ga0501048_0312734 | 3300049582 | Bacteria | 1118 |
| 555 | Ga0501067_0017219 | 3300049583 | Bacteria | 3994 |
| 556 | Ga0501068_0002271 | 3300049584 | Bacteria | 10235 |
| 557 | Ga0501068_0064949 | 3300049584 | Bacteria | 2221 |
| 558 | Ga0501068_0092864 | 3300049584 | Bacteria | 1864 |
| 559 | Ga0501068_0187425 | 3300049584 | Bacteria | 1309 |
| 560 | Ga0501068_0188055 | 3300049584 | Bacteria | 1307 |
| 561 | Ga0501068_0222865 | 3300049584 | Bacteria | 1199 |
| 562 | Ga0501069_0017386 | 3300049585 | Bacteria | 3869 |
| 563 | Ga0501069_0018063 | 3300049585 | Bacteria | 3804 |
| 564 | Ga0501069_0079933 | 3300049585 | Bacteria | 1841 |
| 565 | Ga0501070_0044118 | 3300049586 | Bacteria | 3710 |
| 566 | Ga0501070_0172135 | 3300049586 | Bacteria | 1783 |
| 567 | Ga0501071_0003111 | 3300049587 | Bacteria | 10296 |
| 568 | Ga0501071_0049221 | 3300049587 | Bacteria | 3033 |
| 569 | Ga0501071_0057386 | 3300049587 | Bacteria | 2813 |
| 570 | Ga0501071_0060381 | 3300049587 | Bacteria | 2744 |
| 571 | Ga0501071_0065264 | 3300049587 | Bacteria | 2643 |
| 572 | Ga0501071_0079713 | 3300049587 | Bacteria | 2394 |
| 573 | Ga0501071_0080399 | 3300049587 | Bacteria | 2383 |
| 574 | Ga0501071_0100238 | 3300049587 | Bacteria | 2134 |
| 575 | Ga0501071_0166891 | 3300049587 | Bacteria | 1647 |
| 576 | Ga0501071_0300519 | 3300049587 | Bacteria | 1217 |
| 577 | Ga0501071_0327357 | 3300049587 | Bacteria | 1164 |
| 578 | Ga0501072_0009002 | 3300049588 | Bacteria | 7590 |
| 579 | Ga0501072_0031226 | 3300049588 | Bacteria | 4168 |
| 580 | Ga0501072_0042390 | 3300049588 | Bacteria | 3575 |
| 581 | Ga0501072_0056458 | 3300049588 | Bacteria | 3094 |
| 582 | Ga0501072_0089294 | 3300049588 | Bacteria | 2446 |
| 583 | Ga0501072_0112005 | 3300049588 | Bacteria | 2172 |
| 584 | Ga0501072_0247670 | 3300049588 | Bacteria | 1419 |
| 585 | Ga0501072_0328516 | 3300049588 | Bacteria | 1215 |
| 586 | Ga0501073_0043928 | 3300049589 | Bacteria | 3150 |
| 587 | Ga0501073_0067379 | 3300049589 | Bacteria | 2496 |
| 588 | Ga0501074_0006500 | 3300049590 | Bacteria | 8443 |
| 589 | Ga0501074_0006612 | 3300049590 | Bacteria | 8382 |
| 590 | Ga0501074_0028802 | 3300049590 | Bacteria | 4024 |
| 591 | Ga0501074_0054478 | 3300049590 | Bacteria | 2884 |
| 592 | Ga0501074_0305078 | 3300049590 | Bacteria | 1131 |
| 593 | Ga0501074_0341821 | 3300049590 | Bacteria | 1062 |
| 594 | Ga0501075_0004445 | 3300049591 | Bacteria | 9489 |
| 595 | Ga0501075_0021150 | 3300049591 | Bacteria | 4740 |
| 596 | Ga0501075_0023425 | 3300049591 | Bacteria | 4521 |
| 597 | Ga0501075_0096095 | 3300049591 | Bacteria | 2249 |
| 598 | Ga0501075_0097206 | 3300049591 | Bacteria | 2234 |
| 599 | Ga0501076_0007814 | 3300049592 | Bacteria | 7796 |
| 600 | Ga0501076_0008142 | 3300049592 | Bacteria | 7669 |
| 601 | Ga0501076_0011403 | 3300049592 | Bacteria | 6618 |
| 602 | Ga0501076_0028506 | 3300049592 | Bacteria | 4336 |
| 603 | Ga0501076_0032144 | 3300049592 | Bacteria | 4095 |
| 604 | Ga0501076_0052237 | 3300049592 | Bacteria | 3237 |
| 605 | Ga0501076_0061404 | 3300049592 | Bacteria | 2991 |
| 606 | Ga0501076_0073663 | 3300049592 | Bacteria | 2734 |
| 607 | Ga0501076_0079072 | 3300049592 | Bacteria | 2639 |
| 608 | Ga0501076_0205773 | 3300049592 | Bacteria | 1607 |
| 609 | Ga0501076_0392817 | 3300049592 | Bacteria | 1140 |
| 610 | Ga0501077_0032152 | 3300049593 | Bacteria | 3340 |
| 611 | Ga0501077_0074690 | 3300049593 | Bacteria | 2147 |
| 612 | Ga0501077_0106864 | 3300049593 | Bacteria | 1773 |
| 613 | Ga0501077_0237261 | 3300049593 | Bacteria | 1159 |
| 614 | Ga0501079_0017033 | 3300049741 | Bacteria | 5550 |
| 615 | Ga0501079_0024985 | 3300049741 | Bacteria | 4583 |
| 616 | Ga0501079_0025897 | 3300049741 | Bacteria | 4499 |
| 617 | Ga0501079_0082257 | 3300049741 | Bacteria | 2490 |
| 618 | Ga0501079_0140931 | 3300049741 | Bacteria | 1878 |
| 619 | Ga0501079_0269728 | 3300049741 | Bacteria | 1330 |
| 620 | Ga0501080_0061837 | 3300049742 | Bacteria | 3485 |
| 621 | Ga0501080_0125490 | 3300049742 | Bacteria | 2377 |
| 622 | Ga0501081_0005599 | 3300049743 | Bacteria | 8111 |
| 623 | Ga0501081_0030794 | 3300049743 | Bacteria | 3634 |
| 624 | Ga0501081_0072664 | 3300049743 | Bacteria | 2398 |
| 625 | Ga0501081_0096432 | 3300049743 | Bacteria | 2086 |
| 626 | Ga0501083_0040996 | 3300049744 | Bacteria | 3141 |
| 627 | Ga0501083_0273342 | 3300049744 | Bacteria | 1099 |
| 628 | Ga0501035_0018223 | 3300049822 | Bacteria | 6466 |
| 629 | Ga0501035_0076211 | 3300049822 | Bacteria | 2966 |
| 630 | Ga0501035_0266160 | 3300049822 | Bacteria | 1452 |
| 631 | Ga0501035_0349545 | 3300049822 | Bacteria | 1237 |
| 632 | Ga0501044_0014862 | 3300049823 | Bacteria | 8392 |
| 633 | Ga0501044_0034027 | 3300049823 | Bacteria | 5348 |
| 634 | Ga0501044_0376182 | 3300049823 | Bacteria | 1336 |
| 635 | Ga0501045_0019194 | 3300049824 | Bacteria | 4870 |
| 636 | Ga0501045_0082239 | 3300049824 | Bacteria | 2375 |
| 637 | Ga0501045_0188051 | 3300049824 | Bacteria | 1539 |
| 638 | Ga0501045_0328167 | 3300049824 | Bacteria | 1139 |
| 639 | nmdc:mga03n38_19754_c1 | 3300050490 | Bacteria | 2682 |
| 640 | nmdc:mga00v17_191274_c1 | 3300050491 | Bacteria | 1322 |
| 641 | nmdc:mga00v17_41311_c1 | 3300050491 | Bacteria | 2769 |
| 642 | nmdc:mga0yw44_205589_c1 | 3300050492 | Bacteria | 1301 |
| 643 | nmdc:mga05p37_378395_c1 | 3300050507 | Bacteria | 1660 |
| 644 | nmdc:mga05p37_4971_c1 | 3300050507 | Bacteria | 15580 |
| 645 | nmdc:mga09592_227321_c1 | 3300050508 | Bacteria | 1616 |
| 646 | nmdc:mga0qj67_413644_c1 | 3300050509 | Bacteria | 1088 |
| 647 | nmdc:mga0qj67_56217_c1 | 3300050509 | Bacteria | 3119 |
| 648 | nmdc:mga06r32_202821_c1 | 3300050510 | Bacteria | 1971 |
| 649 | nmdc:mga06r32_76346_c1 | 3300050510 | Bacteria | 3254 |
| 650 | nmdc:mga08y16_22873_c1 | 3300050511 | Bacteria | 6597 |
| 651 | Ga0500641_0013882 | 3300053096 | Bacteria | 2964 |
| 652 | Ga0500556_0001060 | 3300053104 | Bacteria | 14115 |
| 653 | Ga0500616_0058152 | 3300053153 | Bacteria | 2012 |
| 654 | Ga0500616_0058716 | 3300053153 | Bacteria | 2000 |
| 655 | Ga0500599_002571 | 3300053736 | Bacteria | 2181 |
| 656 | Ga0501084_0004200 | 3300054114 | Bacteria | 11749 |
| 657 | Ga0501084_0032428 | 3300054114 | Bacteria | 4370 |
| 658 | Ga0501084_0062326 | 3300054114 | Bacteria | 3121 |
| 659 | Ga0501084_0094809 | 3300054114 | Bacteria | 2506 |
| 660 | Ga0501084_0203662 | 3300054114 | Bacteria | 1670 |
| 661 | Ga0501084_0310507 | 3300054114 | Bacteria | 1332 |
| 662 | Ga0501084_0346176 | 3300054114 | Bacteria | 1255 |
| 663 | Ga0501082_0013763 | 3300060353 | Bacteria | 6955 |
| 664 | Ga0501082_0014079 | 3300060353 | Bacteria | 6880 |
| 665 | Ga0501082_0038736 | 3300060353 | Bacteria | 4111 |
| 666 | Ga0501082_0094475 | 3300060353 | Bacteria | 2584 |
| 667 | Ga0501082_0134996 | 3300060353 | Bacteria | 2141 |
| 668 | Ga0501082_0203718 | 3300060353 | Bacteria | 1721 |
| 669 | Ga0501082_0220272 | 3300060353 | Bacteria | 1651 |
| 670 | Ga0501082_0358614 | 3300060353 | Bacteria | 1272 |
| 671 | Ga0466962_0164062 | 3300061719 | Bacteria | 1081 |
| 672 | Ga0530510_0004106 | 3300061734 | Bacteria | 10050 |
| 673 | Ga0530510_0016773 | 3300061734 | Bacteria | 5186 |
| 674 | Ga0530510_0035845 | 3300061734 | Bacteria | 3576 |
| 675 | 2526063489 | 2524614857 | Bacteria | 4146328 |
| 676 | 2740064778 | 2739367875 | Bacteria | 4157290 |
| 677 | Ga0501036_0122747 | |||
| 678 | JGI25406J46586_10005508 | |||
| 679 | JGI25407J50210_10005900 | |||
| 680 | JGI25407J50210_10006293 | |||
| 681 | JGI25407J50210_10007416 | |||
| 682 | JGI25407J50210_10020872 | |||
| 683 | Ga0070676_10094962 | |||
| 684 | Ga0070666_10001731 | |||
| 685 | Ga0070680_100000377 | |||
| 686 | Ga0070680_100270873 | |||
| 687 | Ga0070682_100009338 | |||
| 688 | Ga0070682_100028195 | |||
| 689 | Ga0070682_100045514 | |||
| 690 | Ga0070682_100243519 | |||
| 691 | Ga0068868_100089099 | |||
| 692 | Ga0068868_100262550 | |||
| 693 | Ga0070689_100101211 | |||
| 694 | Ga0070661_100062397 | |||
| 695 | Ga0070661_100245909 | |||
| 696 | Ga0070668_100048526 | |||
| 697 | Ga0070668_100093329 | |||
| 698 | Ga0070668_100160210 | |||
| 699 | Ga0070674_100115428 | |||
| 700 | Ga0070674_100300886 | |||
| 701 | Ga0070673_100219937 | |||
| 702 | Ga0070659_100049821 | |||
| 703 | Ga0070659_100052652 | |||
| 704 | Ga0070659_100375635 | |||
| 705 | Ga0070667_100006217 | |||
| 706 | Ga0070701_10073492 | |||
| 707 | Ga0070711_100142960 | |||
| 708 | Ga0070711_100208184 | |||
| 709 | Ga0070705_100035123 | |||
| 710 | Ga0070700_100038737 | |||
| 711 | Ga0070700_100066220 | |||
| 712 | Ga0070700_100386092 | |||
| 713 | Ga0070694_100173209 | |||
| 714 | Ga0070663_100115196 | |||
| 715 | Ga0070663_100203071 | |||
| 716 | Ga0070678_100005959 | |||
| 717 | Ga0070678_100158411 | |||
| 718 | Ga0070662_100003436 | |||
| 719 | Ga0070681_10108608 | |||
| 720 | Ga0070679_100001463 | |||
| 721 | Ga0070679_100006632 | |||
| 722 | Ga0070684_100052205 | |||
| 723 | Ga0070684_100182268 | |||
| 724 | Ga0070684_100227388 | |||
| 725 | Ga0068853_100098586 | |||
| 726 | Ga0070686_100114649 | |||
| 727 | Ga0070665_100012257 | |||
| 728 | Ga0070665_100036254 | |||
| 729 | Ga0070665_100037474 | |||
| 730 | Ga0070665_100113512 | |||
| 731 | Ga0068855_100600422 | |||
| 732 | Ga0070664_100079587 | |||
| 733 | Ga0070664_100153089 | |||
| 734 | Ga0068857_100164099 | |||
| 735 | Ga0068854_100049607 | |||
| 736 | Ga0068854_100207087 | |||
| 737 | Ga0068856_100018280 | |||
| 738 | Ga0068856_100023860 | |||
| 739 | Ga0068856_100052107 | |||
| 740 | Ga0068856_100170885 | |||
| 741 | Ga0070702_100011574 | |||
| 742 | Ga0070702_100017182 | |||
| 743 | Ga0070702_100085052 | |||
| 744 | Ga0068852_100002053 | |||
| 745 | Ga0068852_100273727 | |||
| 746 | Ga0068864_100126088 | |||
| 747 | Ga0068866_10017369 | |||
| 748 | Ga0068866_10187048 | |||
| 749 | Ga0068861_100177847 | |||
| 750 | Ga0068861_100215218 | |||
| 751 | Ga0068858_100294091 | |||
| 752 | Ga0068860_100091425 | |||
| 753 | Ga0068862_100145332 | |||
| 754 | Ga0081455_10005766 | |||
| 755 | Ga0081455_10052151 | |||
| 756 | Ga0081455_10126056 | |||
| 757 | Ga0081538_10000118 | |||
| 758 | Ga0081538_10000412 | |||
| 759 | Ga0081538_10000761 | |||
| 760 | Ga0081538_10001198 | |||
| 761 | Ga0081538_10001226 | |||
| 762 | Ga0081538_10001966 | |||
| 763 | Ga0081538_10003093 | |||
| 764 | Ga0081538_10003665 | |||
| 765 | Ga0081538_10004687 | |||
| 766 | Ga0081538_10004940 | |||
| 767 | Ga0081538_10006114 | |||
| 768 | Ga0081538_10006708 | |||
| 769 | Ga0081538_10011012 | |||
| 770 | Ga0081538_10012383 | |||
| 771 | Ga0081538_10016899 | |||
| 772 | Ga0081538_10022203 | |||
| 773 | Ga0081538_10059746 | |||
| 774 | Ga0081538_10074669 | |||
| 775 | Ga0081540_1025569 | |||
| 776 | Ga0081539_10000181 | |||
| 777 | Ga0081539_10002286 | |||
| 778 | Ga0081539_10005362 | |||
| 779 | Ga0081539_10008446 | |||
| 780 | Ga0075365_10017909 | |||
| 781 | Ga0075365_10066553 | |||
| 782 | Ga0075365_10092730 | |||
| 783 | Ga0075365_10096809 | |||
| 784 | Ga0075363_100144458 | |||
| 785 | Ga0075363_100166102 | |||
| 786 | Ga0075364_10009847 | |||
| 787 | Ga0075364_10034197 | |||
| 788 | Ga0070715_10027388 | |||
| 789 | Ga0070715_10152025 | |||
| 790 | Ga0070712_100050185 | |||
| 791 | Ga0097621_100042024 | |||
| 792 | Ga0068871_100068423 | |||
| 793 | Ga0075428_100016123 | |||
| 794 | Ga0075428_100113374 | |||
| 795 | Ga0075428_100690508 | |||
| 796 | Ga0075430_100041116 | |||
| 797 | Ga0075430_100061698 | |||
| 798 | Ga0075430_100070457 | |||
| 799 | Ga0075431_100054563 | |||
| 800 | Ga0075429_100083935 | |||
| 801 | Ga0068865_100031397 | |||
| 802 | Ga0105240_10094004 | |||
| 803 | Ga0111539_10024265 | |||
| 804 | Ga0111539_10052620 | |||
| 805 | Ga0111539_10159476 | |||
| 806 | Ga0111539_10520709 | |||
| 807 | Ga0111539_10717123 | |||
| 808 | Ga0105245_10011669 | |||
| 809 | Ga0105245_10011707 | |||
| 810 | Ga0105245_10013599 | |||
| 811 | Ga0105245_10134055 | |||
| 812 | Ga0105245_10604309 | |||
| 813 | Ga0105247_10096510 | |||
| 814 | Ga0105247_10179318 | |||
| 815 | Ga0114129_10009215 | |||
| 816 | Ga0114129_10045594 | |||
| 817 | Ga0114129_10154324 | |||
| 818 | Ga0114129_10469821 | |||
| 819 | Ga0114129_10517162 | |||
| 820 | Ga0105243_10027628 | |||
| 821 | Ga0105243_10031322 | |||
| 822 | Ga0105243_10090349 | |||
| 823 | Ga0105243_10188412 | |||
| 824 | Ga0105243_10229337 | |||
| 825 | Ga0105243_10270036 | |||
| 826 | Ga0105242_10003435 | |||
| 827 | Ga0105242_10384214 | |||
| 828 | Ga0105242_10425091 | |||
| 829 | Ga0105242_10525359 | |||
| 830 | Ga0105242_10537500 | |||
| 831 | Ga0105248_10039635 | |||
| 832 | Ga0105248_10367092 | |||
| 833 | Ga0105237_10176225 | |||
| 834 | Ga0105238_10008186 | |||
| 835 | Ga0105238_10126326 | |||
| 836 | Ga0105238_10554428 | |||
| 837 | Ga0105249_10088299 | |||
| 838 | Ga0105249_10109058 | |||
| 839 | Ga0105249_10587921 | |||
| 840 | Ga0105239_10103464 | |||
| 841 | Ga0105239_10137793 | |||
| 842 | Ga0105239_10287316 | |||
| 843 | Ga0105239_10294474 | |||
| 844 | Ga0105239_10310404 | |||
| 845 | Ga0105239_10556173 | |||
| 846 | Ga0157370_10210897 | |||
| 847 | Ga0157369_10003461 | |||
| 848 | Ga0157369_10374906 | |||
| 849 | Ga0157369_10662815 | |||
| 850 | Ga0157374_10005535 | |||
| 851 | Ga0163162_10147760 | |||
| 852 | Ga0157372_10003908 | |||
| 853 | Ga0157372_10017098 | |||
| 854 | Ga0157372_10083623 | |||
| 855 | Ga0157375_10002684 | |||
| 856 | Ga0157375_10237967 | |||
| 857 | Ga0182008_10177910 | |||
| 858 | Ga0157377_10022644 | |||
| 859 | Ga0157377_10144646 | |||
| 860 | Ga0157379_10002851 | |||
| 861 | Ga0157376_10329940 | |||
| 862 | Ga0157376_10496926 | |||
| 863 | Ga0206353_11303487 | |||
| 864 | Ga0206353_11573877 | |||
| 865 | Ga0206353_11726145 | |||
| 866 | Ga0213873_10005797 | |||
| 867 | Ga0213874_10000194 | |||
| 868 | Ga0213874_10004563 | |||
| 869 | Ga0213874_10070137 | |||
| 870 | Ga0213876_10035417 | |||
| 871 | Ga0213876_10037113 | |||
| 872 | Ga0213875_10041825 | |||
| 873 | Ga0213875_10108527 | |||
| 874 | Ga0224712_10005082 | |||
| 875 | Ga0224712_10079041 | |||
| 876 | Ga0224712_10169566 | |||
| 877 | Ga0207656_10045167 | |||
| 878 | Ga0207688_10092123 | |||
| 879 | Ga0207688_10119438 | |||
| 880 | Ga0207680_10002563 | |||
| 881 | Ga0207647_10034082 | |||
| 882 | Ga0207705_10052426 | |||
| 883 | Ga0207705_10249680 | |||
| 884 | Ga0207707_10001967 | |||
| 885 | Ga0207695_10131582 | |||
| 886 | Ga0207693_10180948 | |||
| 887 | Ga0207660_10012386 | |||
| 888 | Ga0207662_10017897 | |||
| 889 | Ga0207657_10208957 | |||
| 890 | Ga0207649_10021303 | |||
| 891 | Ga0207649_10321122 | |||
| 892 | Ga0207652_10002299 | |||
| 893 | Ga0207652_10059594 | |||
| 894 | Ga0207687_10040262 | |||
| 895 | Ga0207687_10099715 | |||
| 896 | Ga0207687_10106685 | |||
| 897 | Ga0207687_10118863 | |||
| 898 | Ga0207687_10128792 | |||
| 899 | Ga0207687_10133616 | |||
| 900 | Ga0207690_10053114 | |||
| 901 | Ga0207690_10154274 | |||
| 902 | Ga0207686_10050907 | |||
| 903 | Ga0207709_10021582 | |||
| 904 | Ga0207704_10025467 | |||
| 905 | Ga0207704_10150092 | |||
| 906 | Ga0207691_10085028 | |||
| 907 | Ga0207711_10199015 | |||
| 908 | Ga0207661_10001506 | |||
| 909 | Ga0207661_10093794 | |||
| 910 | Ga0207679_10027539 | |||
| 911 | Ga0207679_10126146 | |||
| 912 | Ga0207679_10205774 | |||
| 913 | Ga0207651_10439930 | |||
| 914 | Ga0207712_10079965 | |||
| 915 | Ga0207712_10411721 | |||
| 916 | Ga0207668_10012905 | |||
| 917 | Ga0207668_10095258 | |||
| 918 | Ga0207668_10165151 | |||
| 919 | Ga0207668_10171640 | |||
| 920 | Ga0207668_10185421 | |||
| 921 | Ga0207668_10229496 | |||
| 922 | Ga0207640_10040498 | |||
| 923 | Ga0207640_10190851 | |||
| 924 | Ga0207658_10010603 | |||
| 925 | Ga0207658_10114215 | |||
| 926 | Ga0207703_10424681 | |||
| 927 | Ga0207639_10048571 | |||
| 928 | Ga0207639_10085495 | |||
| 929 | Ga0207678_10038844 | |||
| 930 | Ga0207678_10149064 | |||
| 931 | Ga0207708_10034160 | |||
| 932 | Ga0207708_10100514 | |||
| 933 | Ga0207702_10004813 | |||
| 934 | Ga0207702_10039380 | |||
| 935 | Ga0207702_10140610 | |||
| 936 | Ga0207702_10243415 | |||
| 937 | Ga0207641_10513284 | |||
| 938 | Ga0207648_10366143 | |||
| 939 | Ga0207648_10465501 | |||
| 940 | Ga0207676_10447750 | |||
| 941 | Ga0207676_10511898 | |||
| 942 | Ga0207674_10017500 | |||
| 943 | Ga0207675_100030323 | |||
| 944 | Ga0207675_100043207 | |||
| 945 | Ga0207683_10000904 | |||
| 946 | Ga0207683_10289236 | |||
| 947 | Ga0207683_10498003 | |||
| 948 | Ga0207698_10047788 | |||
| 949 | Ga0207698_10124074 | |||
| 950 | Ga0207698_10134589 | |||
| 951 | Ga0207698_10313381 | |||
| 952 | Ga0207428_10033790 | |||
| 953 | Ga0207428_10249286 | |||
| 954 | Ga0207428_10285006 | |||
| 955 | Ga0268266_10001725 | |||
| 956 | Ga0268266_10025080 | |||
| 957 | Ga0268266_10036137 | |||
| 958 | Ga0268266_10403040 | |||
| 959 | Ga0268265_10364449 | |||
| 960 | Ga0268264_10079767 | |||
| 961 | Ga0307408_100082903 | |||
| 962 | Ga0307405_10057739 | |||
| 963 | Ga0307405_10114052 | |||
| 964 | Ga0307413_10010236 | |||
| 965 | Ga0307413_10056028 | |||
| 966 | Ga0307413_10123563 | |||
| 967 | Ga0307410_10012040 | |||
| 968 | Ga0307410_10053395 | |||
| 969 | Ga0307410_10264304 | |||
| 970 | Ga0307406_10028555 | |||
| 971 | Ga0307406_10094008 | |||
| 972 | Ga0307406_10138584 | |||
| 973 | Ga0307406_10370782 | |||
| 974 | Ga0307406_10407587 | |||
| 975 | Ga0307407_10018604 | |||
| 976 | Ga0307407_10071469 | |||
| 977 | Ga0307407_10090742 | |||
| 978 | Ga0307412_10113760 | |||
| 979 | Ga0307409_100000655 | |||
| 980 | Ga0307409_100011147 | |||
| 981 | Ga0307409_100121568 | |||
| 982 | Ga0307409_100234667 | |||
| 983 | Ga0307409_100521768 | |||
| 984 | Ga0307416_100021508 | |||
| 985 | Ga0307416_100035957 | |||
| 986 | Ga0307416_100041122 | |||
| 987 | Ga0307416_100083179 | |||
| 988 | Ga0307416_100097413 | |||
| 989 | Ga0307416_100104311 | |||
| 990 | Ga0307416_100236167 | |||
| 991 | Ga0307416_100321996 | |||
| 992 | Ga0307416_100336211 | |||
| 993 | Ga0307416_100356466 | |||
| 994 | Ga0307416_100456345 | |||
| 995 | Ga0307414_10007256 | |||
| 996 | Ga0307414_10317682 | |||
| 997 | Ga0307414_10499131 | |||
| 998 | Ga0307411_10070932 | |||
| 999 | Ga0307411_10232787 | |||
| 1000 | Ga0307415_100000531 | |||
| 1001 | Ga0307415_100018102 | |||
| 1002 | Ga0307415_100051609 | |||
| 1003 | Ga0307415_100100912 | |||
| 1004 | Ga0307415_100130455 | |||
| 1005 | Ga0307415_100231515 | |||
| 1006 | Ga0395899_0093690 | |||
| 1007 | Ga0395900_0111597 | |||
| 1008 | Ga0395900_0289067 | |||
| 1009 | Ga0395900_0324321 | |||
| 1010 | Ga0395898_0051651 | |||
| 1011 | Ga0395898_0178783 | |||
| 1012 | Ga0395898_0270790 | |||
| 1013 | Ga0395905_0044404 | |||
| 1014 | Ga0436364_0801814 | |||
| 1015 | Ga0436364_0888707 | |||
| 1016 | Ga0436364_0911658 | |||
| 1017 | Ga0436364_1492429 | |||
| 1018 | Ga0395901_0011145 | |||
| 1019 | Ga0395901_0078852 | |||
| 1020 | Ga0395901_0123458 | |||
| 1021 | Ga0395901_0208182 | |||
| 1022 | Ga0395901_0791978 | |||
| 1023 | Ga0436365_0392863 | |||
| 1024 | Ga0436365_0440302 | |||
| 1025 | Ga0436365_0494652 | |||
| 1026 | Ga0436365_0855903 | |||
| 1027 | Ga0436365_0987560 | |||
| 1028 | Ga0436365_1294762 | |||
| 1029 | Ga0436365_1901512 | |||
| 1030 | Ga0436363_0101887 | |||
| 1031 | Ga0436363_0108530 | |||
| 1032 | Ga0436363_0151266 | |||
| 1033 | Ga0436363_0605788 | |||
| 1034 | Ga0436363_0820817 | |||
| 1035 | Ga0436362_0062100 | |||
| 1036 | Ga0436362_0264531 | |||
| 1037 | Ga0436362_0435205 | |||
| 1038 | Ga0436362_0668447 | |||
| 1039 | Ga0436362_0943907 | |||
| 1040 | Ga0439461_0001977 | |||
| 1041 | Ga0451798_0590354 | |||
| 1042 | Ga0451853_0007471 | |||
| 1043 | Ga0451853_2379236 | |||
| 1044 | Ga0439448_0012121 | |||
| 1045 | Ga0439435_0018557 | |||
| 1046 | Ga0450918_003461 | |||
| 1047 | Ga0466965_0019495 | |||
| 1048 | Ga0466965_0035871 | |||
| 1049 | Ga0466963_0005462 | |||
| 1050 | Ga0466963_0006299 | |||
| 1051 | Ga0466963_0013615 | |||
| 1052 | Ga0466963_0040989 | |||
| 1053 | Ga0466963_0101156 | |||
| 1054 | Ga0466963_0170351 | |||
| 1055 | Ga0466963_0217703 | |||
| 1056 | Ga0466963_0280086 | |||
| 1057 | Ga0466963_0517836 | |||
| 1058 | Ga0466964_0011611 | |||
| 1059 | Ga0466971_0070334 | |||
| 1060 | Ga0466968_0004627 | |||
| 1061 | Ga0466970_0132463 | |||
| 1062 | Ga0466957_0009461 | |||
| 1063 | Ga0466957_0041067 | |||
| 1064 | Ga0466957_0230048 | |||
| 1065 | Ga0466957_0256090 | |||
| 1066 | Ga0466960_0000005 | |||
| 1067 | Ga0466959_0050868 | |||
| 1068 | Ga0466959_0084022 | |||
| 1069 | Ga0466959_0086058 | |||
| 1070 | Ga0466959_0119662 | |||
| 1071 | Ga0466959_0131804 | |||
| 1072 | Ga0466958_0003457 | |||
| 1073 | Ga0466958_0010849 | |||
| 1074 | Ga0466958_0012328 | |||
| 1075 | Ga0466958_0259870 | |||
| 1076 | Ga0466967_0000503 | |||
| 1077 | Ga0466967_0006242 | |||
| 1078 | Ga0466967_0015486 | |||
| 1079 | Ga0466967_0043510 | |||
| 1080 | Ga0466967_0055287 | |||
| 1081 | Ga0466967_0059767 | |||
| 1082 | Ga0466967_0070822 | |||
| 1083 | Ga0466967_0094369 | |||
| 1084 | Ga0466967_0107032 | |||
| 1085 | Ga0466967_0221474 | |||
| 1086 | Ga0466967_0247806 | |||
| 1087 | Ga0466967_0251497 | |||
| 1088 | Ga0466967_0392825 | |||
| 1089 | Ga0495650_0000121 | |||
| 1090 | Ga0495625_0000032 | |||
| 1091 | Ga0495672_0020993 | |||
| 1092 | Ga0495672_0033312 | |||
| 1093 | Ga0496100_0002667 | |||
| 1094 | Ga0496100_0093713 | |||
| 1095 | Ga0496100_0225510 | |||
| 1096 | Ga0496101_0125818 | |||
| 1097 | Ga0496101_0146273 | |||
| 1098 | Ga0496101_0164381 | |||
| 1099 | Ga0496102_0051057 | |||
| 1100 | Ga0496102_0118769 | |||
| 1101 | Ga0496102_0250353 | |||
| 1102 | Ga0496103_0007811 | |||
| 1103 | Ga0496103_0029643 | |||
| 1104 | Ga0496103_0089230 | |||
| 1105 | Ga0496104_0008134 | |||
| 1106 | Ga0496104_0066553 | |||
| 1107 | Ga0496104_0073837 | |||
| 1108 | Ga0496104_0412103 | |||
| 1109 | Ga0496105_0002183 | |||
| 1110 | Ga0496105_0007438 | |||
| 1111 | Ga0496105_0213906 | |||
| 1112 | Ga0496106_0022070 | |||
| 1113 | Ga0496106_0048459 | |||
| 1114 | Ga0496106_0152753 | |||
| 1115 | Ga0496107_0011637 | |||
| 1116 | Ga0496107_0052903 | |||
| 1117 | Ga0496107_0116788 | |||
| 1118 | Ga0496108_0000894 | |||
| 1119 | Ga0496108_0007071 | |||
| 1120 | Ga0496108_0010239 | |||
| 1121 | Ga0496108_0024845 | |||
| 1122 | Ga0496108_0086717 | |||
| 1123 | Ga0496109_0000326 | |||
| 1124 | Ga0496109_0000753 | |||
| 1125 | Ga0496109_0006929 | |||
| 1126 | Ga0496109_0007731 | |||
| 1127 | Ga0496109_0011798 | |||
| 1128 | Ga0496109_0173795 | |||
| 1129 | Ga0496110_0002845 | |||
| 1130 | Ga0496110_0012777 | |||
| 1131 | Ga0496110_0047764 | |||
| 1132 | Ga0496110_0056058 | |||
| 1133 | Ga0496110_0189512 | |||
| 1134 | Ga0496110_0196101 | |||
| 1135 | Ga0496110_0203200 | |||
| 1136 | Ga0496110_0203770 | |||
| 1137 | Ga0496110_0350046 | |||
| 1138 | Ga0496111_0006374 | |||
| 1139 | Ga0496111_0007380 | |||
| 1140 | Ga0496111_0009574 | |||
| 1141 | Ga0496111_0079952 | |||
| 1142 | Ga0496111_0190100 | |||
| 1143 | Ga0496111_0234533 | |||
| 1144 | Ga0496111_0249828 | |||
| 1145 | Ga0496112_0011422 | |||
| 1146 | Ga0496112_0041071 | |||
| 1147 | Ga0496113_0013478 | |||
| 1148 | Ga0496113_0031402 | |||
| 1149 | Ga0496113_0097557 | |||
| 1150 | Ga0496114_0000990 | |||
| 1151 | Ga0496114_0036214 | |||
| 1152 | Ga0496115_0192488 | |||
| 1153 | Ga0496117_0000619 | |||
| 1154 | Ga0496118_0000766 | |||
| 1155 | Ga0496121_0002166 | |||
| 1156 | Ga0496121_0079255 | |||
| 1157 | Ga0496121_0255906 | |||
| 1158 | Ga0496124_0104612 | |||
| 1159 | Ga0496124_0121828 | |||
| 1160 | Ga0496126_0019683 | |||
| 1161 | Ga0496126_0061882 | |||
| 1162 | Ga0501031_0004357 | |||
| 1163 | Ga0501031_0017795 | |||
| 1164 | Ga0501031_0025420 | |||
| 1165 | Ga0501031_0032017 | |||
| 1166 | Ga0501031_0039685 | |||
| 1167 | Ga0501032_0004803 | |||
| 1168 | Ga0501032_0047954 | |||
| 1169 | Ga0501032_0166439 | |||
| 1170 | Ga0501033_0018958 | |||
| 1171 | Ga0501033_0041302 | |||
| 1172 | Ga0501034_0011301 | |||
| 1173 | Ga0501034_0115335 | |||
| 1174 | Ga0501036_0043669 | |||
| 1175 | Ga0501036_0050220 | |||
| 1176 | Ga0501036_0123256 | |||
| 1177 | Ga0501036_0138551 | |||
| 1178 | Ga0501036_0150947 | |||
| 1179 | Ga0501036_0172106 | |||
| 1180 | Ga0501036_0208718 | |||
| 1181 | Ga0501036_0462402 | |||
| 1182 | Ga0501037_0002769 | |||
| 1183 | Ga0501037_0055771 | |||
| 1184 | Ga0501038_0003753 | |||
| 1185 | Ga0501038_0030562 | |||
| 1186 | Ga0501038_0033506 | |||
| 1187 | Ga0501038_0171606 | |||
| 1188 | Ga0501039_0004459 | |||
| 1189 | Ga0501039_0022741 | |||
| 1190 | Ga0501039_0043644 | |||
| 1191 | Ga0501039_0069189 | |||
| 1192 | Ga0501039_0095731 | |||
| 1193 | Ga0501039_0109862 | |||
| 1194 | Ga0501040_0017272 | |||
| 1195 | Ga0501040_0025804 | |||
| 1196 | Ga0501040_0027930 | |||
| 1197 | Ga0501040_0028992 | |||
| 1198 | Ga0501040_0036832 | |||
| 1199 | Ga0501040_0040049 | |||
| 1200 | Ga0501040_0070304 | |||
| 1201 | Ga0501041_0010224 | |||
| 1202 | Ga0501041_0013196 | |||
| 1203 | Ga0501041_0062463 | |||
| 1204 | Ga0501041_0110258 | |||
| 1205 | Ga0501041_0259629 | |||
| 1206 | Ga0501041_0265968 | |||
| 1207 | Ga0501042_0012344 | |||
| 1208 | Ga0501042_0020235 | |||
| 1209 | Ga0501042_0092212 | |||
| 1210 | Ga0501042_0149274 | |||
| 1211 | Ga0501042_0245249 | |||
| 1212 | Ga0501042_0431819 | |||
| 1213 | Ga0501043_0034752 | |||
| 1214 | Ga0501043_0113005 | |||
| 1215 | Ga0501043_0330842 | |||
| 1216 | Ga0501043_0345666 | |||
| 1217 | Ga0501046_0005549 | |||
| 1218 | Ga0501046_0018249 | |||
| 1219 | Ga0501046_0087086 | |||
| 1220 | Ga0501046_0186332 | |||
| 1221 | Ga0501046_0294242 | |||
| 1222 | Ga0501046_0358771 | |||
| 1223 | Ga0501047_0027727 | |||
| 1224 | Ga0501047_0067281 | |||
| 1225 | Ga0501047_0110901 | |||
| 1226 | Ga0501048_0002489 | |||
| 1227 | Ga0501048_0012939 | |||
| 1228 | Ga0501048_0052121 | |||
| 1229 | Ga0501048_0118122 | |||
| 1230 | Ga0501048_0312734 | |||
| 1231 | Ga0501067_0017219 | |||
| 1232 | Ga0501068_0002271 | |||
| 1233 | Ga0501068_0064949 | |||
| 1234 | Ga0501068_0092864 | |||
| 1235 | Ga0501068_0187425 | |||
| 1236 | Ga0501068_0188055 | |||
| 1237 | Ga0501068_0222865 | |||
| 1238 | Ga0501069_0017386 | |||
| 1239 | Ga0501069_0018063 | |||
| 1240 | Ga0501069_0079933 | |||
| 1241 | Ga0501070_0044118 | |||
| 1242 | Ga0501070_0172135 | |||
| 1243 | Ga0501071_0003111 | |||
| 1244 | Ga0501071_0049221 | |||
| 1245 | Ga0501071_0057386 | |||
| 1246 | Ga0501071_0060381 | |||
| 1247 | Ga0501071_0065264 | |||
| 1248 | Ga0501071_0079713 | |||
| 1249 | Ga0501071_0080399 | |||
| 1250 | Ga0501071_0100238 | |||
| 1251 | Ga0501071_0166891 | |||
| 1252 | Ga0501071_0300519 | |||
| 1253 | Ga0501071_0327357 | |||
| 1254 | Ga0501072_0009002 | |||
| 1255 | Ga0501072_0031226 | |||
| 1256 | Ga0501072_0042390 | |||
| 1257 | Ga0501072_0056458 | |||
| 1258 | Ga0501072_0089294 | |||
| 1259 | Ga0501072_0112005 | |||
| 1260 | Ga0501072_0247670 | |||
| 1261 | Ga0501072_0328516 | |||
| 1262 | Ga0501073_0043928 | |||
| 1263 | Ga0501073_0067379 | |||
| 1264 | Ga0501074_0006500 | |||
| 1265 | Ga0501074_0006612 | |||
| 1266 | Ga0501074_0028802 | |||
| 1267 | Ga0501074_0054478 | |||
| 1268 | Ga0501074_0305078 | |||
| 1269 | Ga0501074_0341821 | |||
| 1270 | Ga0501075_0004445 | |||
| 1271 | Ga0501075_0021150 | |||
| 1272 | Ga0501075_0023425 | |||
| 1273 | Ga0501075_0096095 | |||
| 1274 | Ga0501075_0097206 | |||
| 1275 | Ga0501076_0007814 | |||
| 1276 | Ga0501076_0008142 | |||
| 1277 | Ga0501076_0011403 | |||
| 1278 | Ga0501076_0028506 | |||
| 1279 | Ga0501076_0032144 | |||
| 1280 | Ga0501076_0052237 | |||
| 1281 | Ga0501076_0061404 | |||
| 1282 | Ga0501076_0073663 | |||
| 1283 | Ga0501076_0079072 | |||
| 1284 | Ga0501076_0205773 | |||
| 1285 | Ga0501076_0392817 | |||
| 1286 | Ga0501077_0032152 | |||
| 1287 | Ga0501077_0074690 | |||
| 1288 | Ga0501077_0106864 | |||
| 1289 | Ga0501077_0237261 | |||
| 1290 | Ga0501079_0017033 | |||
| 1291 | Ga0501079_0024985 | |||
| 1292 | Ga0501079_0025897 | |||
| 1293 | Ga0501079_0082257 | |||
| 1294 | Ga0501079_0140931 | |||
| 1295 | Ga0501079_0269728 | |||
| 1296 | Ga0501080_0061837 | |||
| 1297 | Ga0501080_0125490 | |||
| 1298 | Ga0501081_0005599 | |||
| 1299 | Ga0501081_0030794 | |||
| 1300 | Ga0501081_0072664 | |||
| 1301 | Ga0501081_0096432 | |||
| 1302 | Ga0501083_0040996 | |||
| 1303 | Ga0501083_0273342 | |||
| 1304 | Ga0501035_0018223 | |||
| 1305 | Ga0501035_0076211 | |||
| 1306 | Ga0501035_0266160 | |||
| 1307 | Ga0501035_0349545 | |||
| 1308 | Ga0501044_0014862 | |||
| 1309 | Ga0501044_0034027 | |||
| 1310 | Ga0501044_0376182 | |||
| 1311 | Ga0501045_0019194 | |||
| 1312 | Ga0501045_0082239 | |||
| 1313 | Ga0501045_0188051 | |||
| 1314 | Ga0501045_0328167 | |||
| 1315 | nmdc:mga03n38_19754_c1 | |||
| 1316 | nmdc:mga00v17_191274_c1 | |||
| 1317 | nmdc:mga00v17_41311_c1 | |||
| 1318 | nmdc:mga0yw44_205589_c1 | |||
| 1319 | nmdc:mga05p37_378395_c1 | |||
| 1320 | nmdc:mga05p37_4971_c1 | |||
| 1321 | nmdc:mga09592_227321_c1 | |||
| 1322 | nmdc:mga0qj67_413644_c1 | |||
| 1323 | nmdc:mga0qj67_56217_c1 | |||
| 1324 | nmdc:mga06r32_202821_c1 | |||
| 1325 | nmdc:mga06r32_76346_c1 | |||
| 1326 | nmdc:mga08y16_22873_c1 | |||
| 1327 | Ga0500641_0013882 | |||
| 1328 | Ga0500556_0001060 | |||
| 1329 | Ga0500616_0058152 | |||
| 1330 | Ga0500616_0058716 | |||
| 1331 | Ga0500599_002571 | |||
| 1332 | Ga0501084_0004200 | |||
| 1333 | Ga0501084_0032428 | |||
| 1334 | Ga0501084_0062326 | |||
| 1335 | Ga0501084_0094809 | |||
| 1336 | Ga0501084_0203662 | |||
| 1337 | Ga0501084_0310507 | |||
| 1338 | Ga0501084_0346176 | |||
| 1339 | Ga0501082_0013763 | |||
| 1340 | Ga0501082_0014079 | |||
| 1341 | Ga0501082_0038736 | |||
| 1342 | Ga0501082_0094475 | |||
| 1343 | Ga0501082_0134996 | |||
| 1344 | Ga0501082_0203718 | |||
| 1345 | Ga0501082_0220272 | |||
| 1346 | Ga0501082_0358614 | |||
| 1347 | Ga0466962_0164062 | |||
| 1348 | Ga0530510_0004106 | |||
| 1349 | Ga0530510_0016773 | |||
| 1350 | Ga0530510_0035845 | |||
| 1351 | 2526063489 | |||
| 1352 | 2740064778 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v8t-assembly1.cif.gz_A | crystal structure of mn catalase from thermus thermophilus complexed with chloride | 0.9384 | 1 | 285 |
| 2cwl-assembly1.cif.gz_A | crystal structure of manganese-free form of pseudocatalase from thermus thermophilus hb8 | 0.938 | 1 | 282 |
| 2v8t-assembly1.cif.gz_A | crystal structure of mn catalase from thermus thermophilus complexed with chloride | 0.8985 | 1 | 285 |
| 2cwl-assembly1.cif.gz_A | crystal structure of manganese-free form of pseudocatalase from thermus thermophilus hb8 | 0.889 | 1 | 282 |
| 6j42-assembly1.cif.gz_B-2 | crystal structure of wild type katb, a manganese catalase from anabaena | 0.8232 | 1 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cwlA01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.938 | 3 | 282 | 1.20.1260.10 |
| af_Q4CYB4_1172_1308_1.20.58.1120 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 | 0.9221 | 130 | 182 | 1.20.58.1120 |
| af_Q9C0G6_1303_1448_1.20.58.1120 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 | 0.9215 | 128 | 185 | 1.20.58.1120 |
| 4r42B01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.895 | 1 | 193 | 1.20.1260.10 |
| 1jkuA01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8948 | 1 | 189 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9H882-F1-model_v4 | Manganese catalase family protein | 0.9829 | 1 | 88 |
|
| AF-A0A7K0PBL1-F1-model_v4 | Manganese catalase family protein | 0.9754 | 1 | 87 |
|
| AF-A0A6J4SF62-F1-model_v4 | Manganese catalase (EC 1.11.1.6) | 0.9564 | 1 | 289 |
GO:0004096
|
| AF-A0A4Q3AWB6-F1-model_v4 | deleted | 0.9564 | 1 | 88 |
|
| AF-A0A4R1T4U3-F1-model_v4 | deleted | 0.9537 | 1 | 188 |
|