F474539
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 676 | 316 | 1352 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0048757|Ga0466967_0048757_1681_2346 |
| Length | 221 |
| Sequence | MATVMNLLTPRSQHPGWPVPVGPLRVPAGLVRLRPVRLRDAATWSRIRLADRAHLEPWEPSTDFDWEVRHAVSAWPSVCSGLRAEARKGRMLPYAIELDGQFAGQLTIGNVTHGALRSAWIGYWVASASTGGGVATAALALGLDHCFGPVMLHRVEATVRPENAASRAVLAKAGFREEGLLKRYLDVDGAWRDHLLVAITFEELNGSVTSALVRAGHASWV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 189 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 190 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 191 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 192 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 284 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 285 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 286 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 288 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 289 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 290 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 291 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 292 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 293 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 294 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 295 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 296 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 297 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 298 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 299 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 300 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 301 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 302 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 303 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 304 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 305 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 306 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 307 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 308 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 309 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 310 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 311 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 312 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 313 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 314 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 315 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 316 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.86 |
| Metatranscriptomes | 0 |
| Isolates | 4.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.69 |
| Nodule | 0 |
| Rhizoplane | 11.09 |
| Rhizosphere | 72.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0048757 | 3300045976 | Bacteria | 3701 |
| 2 | JGI24746J21847_1000249 | 3300001977 | Bacteria | 7535 |
| 3 | JGI24737J22298_10038251 | 3300001990 | Bacteria | 1477 |
| 4 | JGI24744J21845_10002207 | 3300002077 | Bacteria | 3956 |
| 5 | JGI24744J21845_10016152 | 3300002077 | Bacteria | 1488 |
| 6 | rootH2_10146445 | 3300003320 | Bacteria | 1509 |
| 7 | rootL2_10160125 | 3300003322 | Bacteria | 1569 |
| 8 | Ga0055540_1001795 | 3300003792 | Bacteria | 12207 |
| 9 | Ga0055540_1009417 | 3300003792 | Bacteria | 3378 |
| 10 | Ga0055540_1011152 | 3300003792 | Bacteria | 2926 |
| 11 | Ga0070658_10607210 | 3300005327 | Bacteria | 948 |
| 12 | Ga0070676_10010723 | 3300005328 | Bacteria | 4973 |
| 13 | Ga0070683_100167466 | 3300005329 | Bacteria | 2085 |
| 14 | Ga0070683_100219247 | 3300005329 | Bacteria | 1808 |
| 15 | Ga0070683_100241042 | 3300005329 | Bacteria | 1720 |
| 16 | Ga0070690_100151061 | 3300005330 | Bacteria | 1585 |
| 17 | Ga0070670_100708862 | 3300005331 | Bacteria | 905 |
| 18 | Ga0068869_100096412 | 3300005334 | Bacteria | 2232 |
| 19 | Ga0070666_10179911 | 3300005335 | Bacteria | 1483 |
| 20 | Ga0070666_10189511 | 3300005335 | Bacteria | 1445 |
| 21 | Ga0070680_100239401 | 3300005336 | Bacteria | 1534 |
| 22 | Ga0070682_100088168 | 3300005337 | Bacteria | 2025 |
| 23 | Ga0068868_100040396 | 3300005338 | Bacteria | 3631 |
| 24 | Ga0068868_100480219 | 3300005338 | Bacteria | 1085 |
| 25 | Ga0070660_100188710 | 3300005339 | Bacteria | 1669 |
| 26 | Ga0070689_100004126 | 3300005340 | Bacteria | 9782 |
| 27 | Ga0070691_10038194 | 3300005341 | Bacteria | 2267 |
| 28 | Ga0070691_10062532 | 3300005341 | Bacteria | 1793 |
| 29 | Ga0070691_10274739 | 3300005341 | Bacteria | 912 |
| 30 | Ga0070692_10078001 | 3300005345 | Bacteria | 1778 |
| 31 | Ga0070668_100008191 | 3300005347 | Bacteria | 7762 |
| 32 | Ga0070668_100061451 | 3300005347 | Bacteria | 2910 |
| 33 | Ga0070668_100610737 | 3300005347 | Bacteria | 955 |
| 34 | Ga0070669_100043553 | 3300005353 | Bacteria | 3269 |
| 35 | Ga0070669_100076749 | 3300005353 | Bacteria | 2481 |
| 36 | Ga0070675_100468309 | 3300005354 | Bacteria | 1132 |
| 37 | Ga0070675_100679253 | 3300005354 | Bacteria | 937 |
| 38 | Ga0070671_100012064 | 3300005355 | Bacteria | 6952 |
| 39 | Ga0070671_100661155 | 3300005355 | Bacteria | 905 |
| 40 | Ga0070674_100003905 | 3300005356 | Bacteria | 8442 |
| 41 | Ga0070673_100063938 | 3300005364 | Bacteria | 2930 |
| 42 | Ga0070659_100167850 | 3300005366 | Bacteria | 1796 |
| 43 | Ga0070667_100000207 | 3300005367 | Bacteria | 69147 |
| 44 | Ga0070667_100008191 | 3300005367 | Bacteria | 8664 |
| 45 | Ga0070667_100045426 | 3300005367 | Bacteria | 3693 |
| 46 | Ga0070667_100047120 | 3300005367 | Bacteria | 3627 |
| 47 | Ga0070703_10021993 | 3300005406 | Bacteria | 1868 |
| 48 | Ga0070709_10015484 | 3300005434 | Bacteria | 4340 |
| 49 | Ga0070714_100251570 | 3300005435 | Bacteria | 1634 |
| 50 | Ga0070714_100274286 | 3300005435 | Bacteria | 1565 |
| 51 | Ga0070714_100471712 | 3300005435 | Bacteria | 1194 |
| 52 | Ga0070714_101046158 | 3300005435 | Bacteria | 795 |
| 53 | Ga0070713_100407450 | 3300005436 | Bacteria | 1271 |
| 54 | Ga0070710_10002949 | 3300005437 | Bacteria | 8079 |
| 55 | Ga0070710_10067081 | 3300005437 | Bacteria | 2058 |
| 56 | Ga0070701_10009581 | 3300005438 | Bacteria | 4248 |
| 57 | Ga0070701_10112075 | 3300005438 | Bacteria | 1525 |
| 58 | Ga0070711_100008390 | 3300005439 | Bacteria | 6326 |
| 59 | Ga0070711_100028157 | 3300005439 | Bacteria | 3694 |
| 60 | Ga0070705_100130391 | 3300005440 | Bacteria | 1639 |
| 61 | Ga0070663_100010779 | 3300005455 | Bacteria | 5706 |
| 62 | Ga0070663_100142894 | 3300005455 | Bacteria | 1829 |
| 63 | Ga0070678_100004244 | 3300005456 | Bacteria | 8098 |
| 64 | Ga0070678_100307025 | 3300005456 | Bacteria | 1350 |
| 65 | Ga0070662_100015171 | 3300005457 | Bacteria | 5155 |
| 66 | Ga0070662_100107732 | 3300005457 | Bacteria | 2119 |
| 67 | Ga0068867_100013125 | 3300005459 | Bacteria | 5865 |
| 68 | Ga0070685_10007226 | 3300005466 | Bacteria | 5677 |
| 69 | Ga0070679_100178923 | 3300005530 | Bacteria | 2093 |
| 70 | Ga0070684_100314547 | 3300005535 | Bacteria | 1438 |
| 71 | Ga0070684_100341054 | 3300005535 | Bacteria | 1378 |
| 72 | Ga0068853_100009963 | 3300005539 | Bacteria | 7675 |
| 73 | Ga0068853_100037295 | 3300005539 | Bacteria | 4136 |
| 74 | Ga0068853_100476191 | 3300005539 | Bacteria | 1177 |
| 75 | Ga0070672_100098550 | 3300005543 | Bacteria | 2367 |
| 76 | Ga0070672_100354081 | 3300005543 | Bacteria | 1252 |
| 77 | Ga0070686_100089807 | 3300005544 | Bacteria | 2053 |
| 78 | Ga0070686_100269187 | 3300005544 | Bacteria | 1252 |
| 79 | Ga0070695_100222085 | 3300005545 | Bacteria | 1361 |
| 80 | Ga0070696_100059198 | 3300005546 | Bacteria | 2676 |
| 81 | Ga0070693_100014322 | 3300005547 | Bacteria | 4061 |
| 82 | Ga0070693_100263816 | 3300005547 | Bacteria | 1147 |
| 83 | Ga0070665_100012212 | 3300005548 | Bacteria | 8658 |
| 84 | Ga0070665_100166458 | 3300005548 | Bacteria | 2207 |
| 85 | Ga0070665_100306262 | 3300005548 | Bacteria | 1592 |
| 86 | Ga0070665_100801159 | 3300005548 | Bacteria | 955 |
| 87 | Ga0070704_100030388 | 3300005549 | Bacteria | 3619 |
| 88 | Ga0068854_100054668 | 3300005578 | Bacteria | 2872 |
| 89 | Ga0070702_100022094 | 3300005615 | Bacteria | 3358 |
| 90 | Ga0070702_100076639 | 3300005615 | Bacteria | 1990 |
| 91 | Ga0070702_100408423 | 3300005615 | Bacteria | 973 |
| 92 | Ga0068852_100056062 | 3300005616 | Bacteria | 3404 |
| 93 | Ga0068859_100061979 | 3300005617 | Bacteria | 3769 |
| 94 | Ga0068859_100097718 | 3300005617 | Bacteria | 2989 |
| 95 | Ga0068859_100564112 | 3300005617 | Bacteria | 1233 |
| 96 | Ga0068859_100822505 | 3300005617 | Bacteria | 1016 |
| 97 | Ga0068864_100054331 | 3300005618 | Bacteria | 3457 |
| 98 | Ga0068864_100177382 | 3300005618 | Bacteria | 1946 |
| 99 | Ga0068866_10384840 | 3300005718 | Bacteria | 900 |
| 100 | Ga0068861_100017161 | 3300005719 | Bacteria | 5133 |
| 101 | Ga0068861_100136918 | 3300005719 | Bacteria | 1994 |
| 102 | Ga0068861_100210179 | 3300005719 | Bacteria | 1639 |
| 103 | Ga0068870_10009240 | 3300005840 | Bacteria | 4475 |
| 104 | Ga0068863_100008676 | 3300005841 | Bacteria | 9932 |
| 105 | Ga0068863_100217975 | 3300005841 | Bacteria | 1838 |
| 106 | Ga0068863_100948513 | 3300005841 | Bacteria | 862 |
| 107 | Ga0068858_100012734 | 3300005842 | Bacteria | 7925 |
| 108 | Ga0068858_100179477 | 3300005842 | Bacteria | 1998 |
| 109 | Ga0068858_100362660 | 3300005842 | Bacteria | 1389 |
| 110 | Ga0068860_100012921 | 3300005843 | Bacteria | 8202 |
| 111 | Ga0068862_100024124 | 3300005844 | Bacteria | 5101 |
| 112 | Ga0068862_100480084 | 3300005844 | Bacteria | 1176 |
| 113 | Ga0081455_10047330 | 3300005937 | Bacteria | 3726 |
| 114 | Ga0075365_10006497 | 3300006038 | Bacteria | 6438 |
| 115 | Ga0075365_10033249 | 3300006038 | Bacteria | 3321 |
| 116 | Ga0075365_10049016 | 3300006038 | Bacteria | 2781 |
| 117 | Ga0075365_10050995 | 3300006038 | Bacteria | 2732 |
| 118 | Ga0075365_10159998 | 3300006038 | Bacteria | 1569 |
| 119 | Ga0075365_10179955 | 3300006038 | Bacteria | 1478 |
| 120 | Ga0075368_10023140 | 3300006042 | Bacteria | 2370 |
| 121 | Ga0075363_100000752 | 3300006048 | Bacteria | 11078 |
| 122 | Ga0075363_100064429 | 3300006048 | Bacteria | 1980 |
| 123 | Ga0075363_100072411 | 3300006048 | Bacteria | 1874 |
| 124 | Ga0075364_10001726 | 3300006051 | Bacteria | 12028 |
| 125 | Ga0075364_10026141 | 3300006051 | Bacteria | 3721 |
| 126 | Ga0075364_10042128 | 3300006051 | Bacteria | 2966 |
| 127 | Ga0075364_10085326 | 3300006051 | Bacteria | 2091 |
| 128 | Ga0075364_10214141 | 3300006051 | Bacteria | 1307 |
| 129 | Ga0070715_10253668 | 3300006163 | Bacteria | 920 |
| 130 | Ga0070716_100012068 | 3300006173 | Bacteria | 4367 |
| 131 | Ga0070716_100099726 | 3300006173 | Bacteria | 1778 |
| 132 | Ga0070712_100005319 | 3300006175 | Bacteria | 7968 |
| 133 | Ga0070712_100041669 | 3300006175 | Bacteria | 3153 |
| 134 | Ga0070712_100217057 | 3300006175 | Bacteria | 1512 |
| 135 | Ga0075362_10021887 | 3300006177 | Bacteria | 2688 |
| 136 | Ga0075362_10024279 | 3300006177 | Bacteria | 2571 |
| 137 | Ga0075367_10037673 | 3300006178 | Bacteria | 2811 |
| 138 | Ga0075367_10204958 | 3300006178 | Bacteria | 1232 |
| 139 | Ga0075367_10367867 | 3300006178 | Bacteria | 908 |
| 140 | Ga0075369_10003028 | 3300006186 | Bacteria | 6076 |
| 141 | Ga0075369_10004827 | 3300006186 | Bacteria | 5015 |
| 142 | Ga0075369_10046042 | 3300006186 | Bacteria | 1877 |
| 143 | Ga0075369_10070799 | 3300006186 | Bacteria | 1535 |
| 144 | Ga0075369_10092927 | 3300006186 | Bacteria | 1348 |
| 145 | Ga0075369_10132862 | 3300006186 | Bacteria | 1132 |
| 146 | Ga0075369_10181604 | 3300006186 | Bacteria | 968 |
| 147 | Ga0075369_10271215 | 3300006186 | Bacteria | 789 |
| 148 | Ga0075366_10046485 | 3300006195 | Bacteria | 2572 |
| 149 | Ga0075370_10000341 | 3300006353 | Bacteria | 16842 |
| 150 | Ga0075370_10033558 | 3300006353 | Bacteria | 2874 |
| 151 | Ga0075370_10068216 | 3300006353 | Bacteria | 2031 |
| 152 | Ga0075370_10080177 | 3300006353 | Bacteria | 1875 |
| 153 | Ga0075370_10134468 | 3300006353 | Bacteria | 1444 |
| 154 | Ga0068871_100324065 | 3300006358 | Bacteria | 1357 |
| 155 | Ga0075428_100007312 | 3300006844 | Bacteria | 12235 |
| 156 | Ga0075430_100058874 | 3300006846 | Bacteria | 3229 |
| 157 | Ga0075430_100203186 | 3300006846 | Bacteria | 1645 |
| 158 | Ga0068865_100003973 | 3300006881 | Bacteria | 8874 |
| 159 | Ga0068865_100355231 | 3300006881 | Bacteria | 1188 |
| 160 | Ga0075436_100562509 | 3300006914 | Bacteria | 838 |
| 161 | Ga0097620_100061977 | 3300006931 | Bacteria | 3769 |
| 162 | Ga0097620_100097721 | 3300006931 | Bacteria | 2989 |
| 163 | Ga0097620_100564065 | 3300006931 | Bacteria | 1233 |
| 164 | Ga0097620_100822498 | 3300006931 | Bacteria | 1016 |
| 165 | Ga0099795_10014471 | 3300007788 | Bacteria | 2447 |
| 166 | Ga0105250_10098049 | 3300009092 | Bacteria | 1195 |
| 167 | Ga0105250_10126503 | 3300009092 | Bacteria | 1053 |
| 168 | Ga0105245_10011752 | 3300009098 | Bacteria | 7617 |
| 169 | Ga0105245_10437888 | 3300009098 | Bacteria | 1313 |
| 170 | Ga0105245_10727364 | 3300009098 | Bacteria | 1027 |
| 171 | Ga0105247_10213411 | 3300009101 | Bacteria | 1303 |
| 172 | Ga0105247_10381803 | 3300009101 | Bacteria | 999 |
| 173 | Ga0114129_10018369 | 3300009147 | Bacteria | 9960 |
| 174 | Ga0105243_10004112 | 3300009148 | Bacteria | 11567 |
| 175 | Ga0105243_10091180 | 3300009148 | Bacteria | 2509 |
| 176 | Ga0105243_10622929 | 3300009148 | Bacteria | 1042 |
| 177 | Ga0105241_10084060 | 3300009174 | Bacteria | 2498 |
| 178 | Ga0105241_10719454 | 3300009174 | Bacteria | 913 |
| 179 | Ga0105242_10007699 | 3300009176 | Bacteria | 8289 |
| 180 | Ga0105242_10213964 | 3300009176 | Bacteria | 1719 |
| 181 | Ga0105248_10014903 | 3300009177 | Bacteria | 8560 |
| 182 | Ga0105248_10016636 | 3300009177 | Bacteria | 8095 |
| 183 | Ga0105237_10115171 | 3300009545 | Bacteria | 2681 |
| 184 | Ga0105237_10382390 | 3300009545 | Bacteria | 1413 |
| 185 | Ga0105237_10530859 | 3300009545 | Bacteria | 1183 |
| 186 | Ga0105238_10356790 | 3300009551 | Bacteria | 1451 |
| 187 | Ga0105238_10539435 | 3300009551 | Bacteria | 1170 |
| 188 | Ga0105238_10655490 | 3300009551 | Bacteria | 1060 |
| 189 | Ga0105249_10162835 | 3300009553 | Bacteria | 2157 |
| 190 | Ga0105249_10304708 | 3300009553 | Bacteria | 1599 |
| 191 | Ga0105249_10321414 | 3300009553 | Bacteria | 1559 |
| 192 | Ga0157369_10247069 | 3300013105 | Bacteria | 1863 |
| 193 | Ga0157374_10048291 | 3300013296 | Bacteria | 3949 |
| 194 | Ga0157374_10441970 | 3300013296 | Bacteria | 1301 |
| 195 | Ga0157378_10009418 | 3300013297 | Bacteria | 8509 |
| 196 | Ga0157378_10263176 | 3300013297 | Bacteria | 1656 |
| 197 | Ga0157378_10789661 | 3300013297 | Bacteria | 975 |
| 198 | Ga0163162_10036034 | 3300013306 | Bacteria | 4929 |
| 199 | Ga0163162_10180314 | 3300013306 | Bacteria | 2238 |
| 200 | Ga0157375_10084168 | 3300013308 | Bacteria | 3228 |
| 201 | Ga0163163_10017194 | 3300014325 | Bacteria | 6740 |
| 202 | Ga0163163_10256273 | 3300014325 | Bacteria | 1800 |
| 203 | Ga0163163_10670829 | 3300014325 | Bacteria | 1100 |
| 204 | Ga0157380_10038541 | 3300014326 | Bacteria | 3712 |
| 205 | Ga0157377_10003584 | 3300014745 | Bacteria | 7028 |
| 206 | Ga0157379_10015516 | 3300014968 | Bacteria | 6686 |
| 207 | Ga0157379_10163347 | 3300014968 | Bacteria | 2010 |
| 208 | Ga0157376_10763132 | 3300014969 | Bacteria | 977 |
| 209 | Ga0163161_10062208 | 3300017792 | Bacteria | 2719 |
| 210 | Ga0163161_10070186 | 3300017792 | Bacteria | 2561 |
| 211 | Ga0163161_10086070 | 3300017792 | Bacteria | 2320 |
| 212 | Ga0213876_10016537 | 3300021384 | Bacteria | 3899 |
| 213 | Ga0213875_10013950 | 3300021388 | Bacteria | 3930 |
| 214 | Ga0209051_1004009 | 3300025303 | Bacteria | 9330 |
| 215 | Ga0209051_1012702 | 3300025303 | Bacteria | 4057 |
| 216 | Ga0209051_1014796 | 3300025303 | Bacteria | 3623 |
| 217 | Ga0209051_1033969 | 3300025303 | Bacteria | 1919 |
| 218 | Ga0207696_1067118 | 3300025711 | Bacteria | 1001 |
| 219 | Ga0207653_10075585 | 3300025885 | Bacteria | 1158 |
| 220 | Ga0207642_10010536 | 3300025899 | Bacteria | 3264 |
| 221 | Ga0207710_10025602 | 3300025900 | Bacteria | 2546 |
| 222 | Ga0207710_10197496 | 3300025900 | Bacteria | 992 |
| 223 | Ga0207688_10003584 | 3300025901 | Bacteria | 8476 |
| 224 | Ga0207688_10008767 | 3300025901 | Bacteria | 5503 |
| 225 | Ga0207647_10083676 | 3300025904 | Bacteria | 1910 |
| 226 | Ga0207699_10007946 | 3300025906 | Bacteria | 5206 |
| 227 | Ga0207705_10268766 | 3300025909 | Bacteria | 1304 |
| 228 | Ga0207671_10045140 | 3300025914 | Bacteria | 3258 |
| 229 | Ga0207671_10151767 | 3300025914 | Bacteria | 1790 |
| 230 | Ga0207671_10235919 | 3300025914 | Bacteria | 1436 |
| 231 | Ga0207693_10009413 | 3300025915 | Bacteria | 7968 |
| 232 | Ga0207693_10069987 | 3300025915 | Bacteria | 2746 |
| 233 | Ga0207663_10036716 | 3300025916 | Bacteria | 2949 |
| 234 | Ga0207663_10500122 | 3300025916 | Bacteria | 944 |
| 235 | Ga0207657_10171176 | 3300025919 | Bacteria | 1759 |
| 236 | Ga0207681_10353286 | 3300025923 | Bacteria | 1177 |
| 237 | Ga0207694_10508085 | 3300025924 | Bacteria | 1009 |
| 238 | Ga0207659_10358568 | 3300025926 | Bacteria | 1211 |
| 239 | Ga0207687_10009671 | 3300025927 | Bacteria | 6306 |
| 240 | Ga0207687_10287753 | 3300025927 | Bacteria | 1320 |
| 241 | Ga0207700_10420688 | 3300025928 | Bacteria | 1174 |
| 242 | Ga0207664_10103874 | 3300025929 | Bacteria | 2352 |
| 243 | Ga0207664_10151344 | 3300025929 | Bacteria | 1971 |
| 244 | Ga0207664_10405475 | 3300025929 | Bacteria | 1213 |
| 245 | Ga0207664_10418065 | 3300025929 | Bacteria | 1194 |
| 246 | Ga0207644_10020036 | 3300025931 | Bacteria | 4543 |
| 247 | Ga0207644_10514456 | 3300025931 | Bacteria | 988 |
| 248 | Ga0207690_10153844 | 3300025932 | Bacteria | 1707 |
| 249 | Ga0207706_10018529 | 3300025933 | Bacteria | 6263 |
| 250 | Ga0207706_10318744 | 3300025933 | Bacteria | 1353 |
| 251 | Ga0207686_10114754 | 3300025934 | Bacteria | 1823 |
| 252 | Ga0207709_10004934 | 3300025935 | Bacteria | 7636 |
| 253 | Ga0207709_10005610 | 3300025935 | Bacteria | 7096 |
| 254 | Ga0207709_10136439 | 3300025935 | Bacteria | 1680 |
| 255 | Ga0207670_10066091 | 3300025936 | Bacteria | 2483 |
| 256 | Ga0207669_10006346 | 3300025937 | Bacteria | 5395 |
| 257 | Ga0207669_10064784 | 3300025937 | Bacteria | 2263 |
| 258 | Ga0207704_10005939 | 3300025938 | Bacteria | 5658 |
| 259 | Ga0207704_10278385 | 3300025938 | Bacteria | 1270 |
| 260 | Ga0207665_10015671 | 3300025939 | Bacteria | 4975 |
| 261 | Ga0207665_10044280 | 3300025939 | Bacteria | 2978 |
| 262 | Ga0207691_10102466 | 3300025940 | Bacteria | 2553 |
| 263 | Ga0207691_10627063 | 3300025940 | Bacteria | 909 |
| 264 | Ga0207711_10021885 | 3300025941 | Bacteria | 5341 |
| 265 | Ga0207689_10110945 | 3300025942 | Bacteria | 2254 |
| 266 | Ga0207661_10229991 | 3300025944 | Bacteria | 1642 |
| 267 | Ga0207667_10155041 | 3300025949 | Bacteria | 2357 |
| 268 | Ga0207667_10238937 | 3300025949 | Bacteria | 1859 |
| 269 | Ga0207712_10009714 | 3300025961 | Bacteria | 6098 |
| 270 | Ga0207668_10000526 | 3300025972 | Bacteria | 24008 |
| 271 | Ga0207668_10009108 | 3300025972 | Bacteria | 5934 |
| 272 | Ga0207658_10018649 | 3300025986 | Bacteria | 4796 |
| 273 | Ga0207658_10069945 | 3300025986 | Bacteria | 2654 |
| 274 | Ga0207658_10215988 | 3300025986 | Bacteria | 1610 |
| 275 | Ga0207703_10009089 | 3300026035 | Bacteria | 7823 |
| 276 | Ga0207703_10059867 | 3300026035 | Bacteria | 3112 |
| 277 | Ga0207703_10506386 | 3300026035 | Bacteria | 1134 |
| 278 | Ga0207703_10719974 | 3300026035 | Bacteria | 950 |
| 279 | Ga0207639_10028496 | 3300026041 | Bacteria | 4078 |
| 280 | Ga0207639_10045475 | 3300026041 | Bacteria | 3306 |
| 281 | Ga0207678_10005752 | 3300026067 | Bacteria | 11060 |
| 282 | Ga0207678_10016047 | 3300026067 | Bacteria | 6578 |
| 283 | Ga0207678_10018037 | 3300026067 | Bacteria | 6201 |
| 284 | Ga0207708_10065683 | 3300026075 | Bacteria | 2774 |
| 285 | Ga0207702_10067164 | 3300026078 | Bacteria | 3077 |
| 286 | Ga0207641_10003476 | 3300026088 | Bacteria | 13956 |
| 287 | Ga0207641_10063120 | 3300026088 | Bacteria | 3164 |
| 288 | Ga0207648_10010554 | 3300026089 | Bacteria | 8742 |
| 289 | Ga0207648_10209207 | 3300026089 | Bacteria | 1731 |
| 290 | Ga0207676_10479195 | 3300026095 | Bacteria | 1178 |
| 291 | Ga0207676_10920883 | 3300026095 | Bacteria | 858 |
| 292 | Ga0207675_100012618 | 3300026118 | Bacteria | 7894 |
| 293 | Ga0207675_100116178 | 3300026118 | Bacteria | 2529 |
| 294 | Ga0207675_100403263 | 3300026118 | Bacteria | 1348 |
| 295 | Ga0207675_100457508 | 3300026118 | Bacteria | 1265 |
| 296 | Ga0207683_10011339 | 3300026121 | Bacteria | 7605 |
| 297 | Ga0207683_10097174 | 3300026121 | Bacteria | 2626 |
| 298 | Ga0207698_10288110 | 3300026142 | Bacteria | 1522 |
| 299 | Ga0207698_11020449 | 3300026142 | Bacteria | 838 |
| 300 | Ga0209179_1025803 | 3300027512 | Bacteria | 1174 |
| 301 | Ga0268266_10013715 | 3300028379 | Bacteria | 6979 |
| 302 | Ga0268266_10069761 | 3300028379 | Bacteria | 3046 |
| 303 | Ga0268266_10092239 | 3300028379 | Bacteria | 2657 |
| 304 | Ga0268266_10605161 | 3300028379 | Bacteria | 1053 |
| 305 | Ga0268265_10067910 | 3300028380 | Bacteria | 2762 |
| 306 | Ga0268264_10059530 | 3300028381 | Bacteria | 3200 |
| 307 | Ga0268264_10247271 | 3300028381 | Bacteria | 1655 |
| 308 | Ga0265327_10000018 | 3300031251 | Bacteria | 439197 |
| 309 | Ga0265327_10001055 | 3300031251 | Bacteria | 38529 |
| 310 | Ga0265327_10012159 | 3300031251 | Bacteria | 5840 |
| 311 | Ga0307408_100079665 | 3300031548 | Bacteria | 2445 |
| 312 | Ga0307408_100113899 | 3300031548 | Bacteria | 2082 |
| 313 | Ga0307405_10034901 | 3300031731 | Bacteria | 2998 |
| 314 | Ga0307405_10225861 | 3300031731 | Bacteria | 1377 |
| 315 | Ga0307405_10292107 | 3300031731 | Bacteria | 1232 |
| 316 | Ga0307405_10486831 | 3300031731 | Bacteria | 986 |
| 317 | Ga0307413_10045379 | 3300031824 | Bacteria | 2605 |
| 318 | Ga0307413_10159572 | 3300031824 | Bacteria | 1582 |
| 319 | Ga0307410_10027563 | 3300031852 | Bacteria | 3592 |
| 320 | Ga0307410_10030483 | 3300031852 | Bacteria | 3448 |
| 321 | Ga0307410_10035295 | 3300031852 | Bacteria | 3246 |
| 322 | Ga0307410_10161485 | 3300031852 | Bacteria | 1679 |
| 323 | Ga0307410_10252391 | 3300031852 | Bacteria | 1372 |
| 324 | Ga0307410_10290186 | 3300031852 | Bacteria | 1287 |
| 325 | Ga0307410_10382653 | 3300031852 | Bacteria | 1132 |
| 326 | Ga0307410_10520573 | 3300031852 | Bacteria | 981 |
| 327 | Ga0307410_11075128 | 3300031852 | Bacteria | 696 |
| 328 | Ga0307406_10083322 | 3300031901 | Bacteria | 2132 |
| 329 | Ga0307406_10094734 | 3300031901 | Bacteria | 2019 |
| 330 | Ga0307406_10200135 | 3300031901 | Bacteria | 1469 |
| 331 | Ga0307406_10525545 | 3300031901 | Bacteria | 964 |
| 332 | Ga0307406_11102180 | 3300031901 | Bacteria | 685 |
| 333 | Ga0307407_10265598 | 3300031903 | Bacteria | 1182 |
| 334 | Ga0307407_10482602 | 3300031903 | Bacteria | 905 |
| 335 | Ga0307407_10509218 | 3300031903 | Bacteria | 884 |
| 336 | Ga0307412_10064726 | 3300031911 | Bacteria | 2471 |
| 337 | Ga0307412_10161283 | 3300031911 | Bacteria | 1666 |
| 338 | Ga0307412_10191651 | 3300031911 | Bacteria | 1546 |
| 339 | Ga0307409_100049766 | 3300031995 | Bacteria | 3197 |
| 340 | Ga0307409_100074821 | 3300031995 | Bacteria | 2708 |
| 341 | Ga0307409_100114532 | 3300031995 | Bacteria | 2268 |
| 342 | Ga0307409_100121219 | 3300031995 | Bacteria | 2215 |
| 343 | Ga0307409_100168247 | 3300031995 | Bacteria | 1926 |
| 344 | Ga0307409_100182036 | 3300031995 | Bacteria | 1861 |
| 345 | Ga0307409_100336892 | 3300031995 | Bacteria | 1418 |
| 346 | Ga0307409_100345788 | 3300031995 | Bacteria | 1401 |
| 347 | Ga0307409_100479588 | 3300031995 | Bacteria | 1206 |
| 348 | Ga0307409_100898232 | 3300031995 | Bacteria | 899 |
| 349 | Ga0307416_100070336 | 3300032002 | Bacteria | 2901 |
| 350 | Ga0307416_100100337 | 3300032002 | Bacteria | 2517 |
| 351 | Ga0307416_100152629 | 3300032002 | Bacteria | 2121 |
| 352 | Ga0307416_100292024 | 3300032002 | Bacteria | 1614 |
| 353 | Ga0307416_100562654 | 3300032002 | Bacteria | 1215 |
| 354 | Ga0307416_101576004 | 3300032002 | Bacteria | 762 |
| 355 | Ga0307416_101778903 | 3300032002 | Bacteria | 720 |
| 356 | Ga0307414_10069910 | 3300032004 | Bacteria | 2526 |
| 357 | Ga0307414_10169616 | 3300032004 | Bacteria | 1743 |
| 358 | Ga0307414_10211218 | 3300032004 | Bacteria | 1586 |
| 359 | Ga0307414_10231482 | 3300032004 | Bacteria | 1524 |
| 360 | Ga0307414_10468208 | 3300032004 | Bacteria | 1109 |
| 361 | Ga0307414_10617807 | 3300032004 | Bacteria | 974 |
| 362 | Ga0307411_10036755 | 3300032005 | Bacteria | 3072 |
| 363 | Ga0307411_10049088 | 3300032005 | Bacteria | 2740 |
| 364 | Ga0307411_10103015 | 3300032005 | Bacteria | 2024 |
| 365 | Ga0307411_10133597 | 3300032005 | Bacteria | 1818 |
| 366 | Ga0307411_10314709 | 3300032005 | Bacteria | 1261 |
| 367 | Ga0307415_100051496 | 3300032126 | Bacteria | 2794 |
| 368 | Ga0307415_100113811 | 3300032126 | Bacteria | 2013 |
| 369 | Ga0307415_100297193 | 3300032126 | Bacteria | 1336 |
| 370 | Ga0307415_100308246 | 3300032126 | Bacteria | 1315 |
| 371 | Ga0307415_100376709 | 3300032126 | Bacteria | 1203 |
| 372 | Ga0307415_100381204 | 3300032126 | Bacteria | 1197 |
| 373 | Ga0307415_100504186 | 3300032126 | Bacteria | 1059 |
| 374 | Ga0307415_100642380 | 3300032126 | Bacteria | 950 |
| 375 | Ga0307415_101105670 | 3300032126 | Bacteria | 742 |
| 376 | Ga0373932_0203610 | 3300035112 | Bacteria | 705 |
| 377 | Ga0373943_0054214 | 3300035170 | Bacteria | 1983 |
| 378 | Ga0373931_0046329 | 3300035691 | Bacteria | 2298 |
| 379 | Ga0316584_0233041 | 3300036712 | Bacteria | 1349 |
| 380 | Ga0395899_0358439 | 3300037312 | Bacteria | 974 |
| 381 | Ga0395900_0060881 | 3300037418 | Bacteria | 3883 |
| 382 | Ga0395898_0011113 | 3300037466 | Bacteria | 9372 |
| 383 | Ga0436364_0815483 | 3300037853 | Bacteria | 10253 |
| 384 | Ga0436364_1009898 | 3300037853 | Bacteria | 3993 |
| 385 | Ga0395901_0007866 | 3300038443 | Bacteria | 10751 |
| 386 | Ga0395901_0685346 | 3300038443 | Bacteria | 1024 |
| 387 | Ga0436365_1064965 | 3300039437 | Bacteria | 9165 |
| 388 | Ga0436365_1630628 | 3300039437 | Bacteria | 72743 |
| 389 | Ga0436363_1156190 | 3300039450 | Bacteria | 5094 |
| 390 | Ga0439466_0041890 | 3300041411 | Bacteria | 1526 |
| 391 | Ga0439466_0054626 | 3300041411 | Bacteria | 1300 |
| 392 | Ga0439466_0107995 | 3300041411 | Bacteria | 864 |
| 393 | Ga0439465_0014461 | 3300041413 | Bacteria | 2459 |
| 394 | Ga0439465_0071915 | 3300041413 | Bacteria | 1160 |
| 395 | Ga0451802_1930661 | 3300041460 | Bacteria | 627 |
| 396 | Ga0451806_754557 | 3300041462 | Bacteria | 1284 |
| 397 | Ga0451841_1132979 | 3300041498 | Bacteria | 1091 |
| 398 | Ga0439442_004527 | 3300042002 | Bacteria | 2761 |
| 399 | Ga0439445_0016618 | 3300042004 | Bacteria | 1812 |
| 400 | Ga0439434_0007518 | 3300042435 | Bacteria | 3193 |
| 401 | Ga0439460_0093333 | 3300042461 | Bacteria | 959 |
| 402 | Ga0466969_0162829 | 3300044656 | Bacteria | 1025 |
| 403 | Ga0466969_0190549 | 3300044656 | Bacteria | 937 |
| 404 | Ga0466972_0005077 | 3300044658 | Bacteria | 6595 |
| 405 | Ga0466972_0080684 | 3300044658 | Bacteria | 1549 |
| 406 | Ga0466972_0436576 | 3300044658 | Bacteria | 615 |
| 407 | Ga0466965_0003274 | 3300044683 | Bacteria | 7085 |
| 408 | Ga0466966_0102580 | 3300044684 | Bacteria | 1768 |
| 409 | Ga0466966_0187352 | 3300044684 | Bacteria | 1254 |
| 410 | Ga0466966_0302036 | 3300044684 | Bacteria | 962 |
| 411 | Ga0466966_0342842 | 3300044684 | Bacteria | 898 |
| 412 | Ga0466961_0102915 | 3300044693 | Bacteria | 1798 |
| 413 | Ga0466961_0121933 | 3300044693 | Bacteria | 1636 |
| 414 | Ga0466963_0051985 | 3300044694 | Bacteria | 2717 |
| 415 | Ga0466963_0077109 | 3300044694 | Bacteria | 2251 |
| 416 | Ga0466963_0152553 | 3300044694 | Bacteria | 1605 |
| 417 | Ga0466963_0805105 | 3300044694 | Bacteria | 663 |
| 418 | Ga0466971_0009094 | 3300044719 | Bacteria | 4342 |
| 419 | Ga0466971_0106889 | 3300044719 | Bacteria | 1289 |
| 420 | Ga0466968_0007618 | 3300044735 | Bacteria | 4122 |
| 421 | Ga0466968_0175590 | 3300044735 | Bacteria | 994 |
| 422 | Ga0466968_0226600 | 3300044735 | Bacteria | 882 |
| 423 | Ga0466970_0003951 | 3300044765 | Bacteria | 7267 |
| 424 | Ga0466970_0032862 | 3300044765 | Bacteria | 2742 |
| 425 | Ga0466970_0040508 | 3300044765 | Bacteria | 2474 |
| 426 | Ga0466970_0055238 | 3300044765 | Bacteria | 2121 |
| 427 | Ga0466970_0382177 | 3300044765 | Bacteria | 802 |
| 428 | Ga0466970_0405379 | 3300044765 | Bacteria | 778 |
| 429 | Ga0466957_0022676 | 3300044842 | Bacteria | 3705 |
| 430 | Ga0466957_0034944 | 3300044842 | Bacteria | 3015 |
| 431 | Ga0466957_0086013 | 3300044842 | Bacteria | 1964 |
| 432 | Ga0466957_0091350 | 3300044842 | Bacteria | 1908 |
| 433 | Ga0466957_0160496 | 3300044842 | Bacteria | 1460 |
| 434 | Ga0466957_0171224 | 3300044842 | Bacteria | 1414 |
| 435 | Ga0466957_0445666 | 3300044842 | Bacteria | 891 |
| 436 | Ga0466960_0000265 | 3300044901 | Bacteria | 18060 |
| 437 | Ga0466960_0006050 | 3300044901 | Bacteria | 4834 |
| 438 | Ga0466960_0018707 | 3300044901 | Bacteria | 3041 |
| 439 | Ga0466960_0022165 | 3300044901 | Bacteria | 2836 |
| 440 | Ga0466960_0038680 | 3300044901 | Bacteria | 2245 |
| 441 | Ga0466960_0053050 | 3300044901 | Bacteria | 1964 |
| 442 | Ga0466960_0253385 | 3300044901 | Bacteria | 978 |
| 443 | Ga0466960_0396245 | 3300044901 | Bacteria | 794 |
| 444 | Ga0466959_0054959 | 3300045049 | Bacteria | 2908 |
| 445 | Ga0466959_0093606 | 3300045049 | Bacteria | 2156 |
| 446 | Ga0466959_0139325 | 3300045049 | Bacteria | 1715 |
| 447 | Ga0466959_0174485 | 3300045049 | Bacteria | 1507 |
| 448 | Ga0466959_0242173 | 3300045049 | Bacteria | 1245 |
| 449 | Ga0466959_0419627 | 3300045049 | Bacteria | 908 |
| 450 | Ga0466959_0568260 | 3300045049 | Bacteria | 764 |
| 451 | Ga0466958_0040833 | 3300045836 | Bacteria | 2789 |
| 452 | Ga0466958_0110327 | 3300045836 | Bacteria | 1717 |
| 453 | Ga0466958_0142499 | 3300045836 | Bacteria | 1509 |
| 454 | Ga0466958_0179823 | 3300045836 | Bacteria | 1342 |
| 455 | Ga0466958_0194556 | 3300045836 | Bacteria | 1289 |
| 456 | Ga0466958_0285821 | 3300045836 | Bacteria | 1057 |
| 457 | Ga0466958_0312897 | 3300045836 | Bacteria | 1009 |
| 458 | Ga0466958_0328469 | 3300045836 | Bacteria | 983 |
| 459 | Ga0466958_0467917 | 3300045836 | Bacteria | 817 |
| 460 | Ga0466967_0011184 | 3300045976 | Bacteria | 6782 |
| 461 | Ga0466967_0024884 | 3300045976 | Bacteria | 4929 |
| 462 | Ga0466967_0029991 | 3300045976 | Bacteria | 4559 |
| 463 | Ga0466967_0032663 | 3300045976 | Bacteria | 4397 |
| 464 | Ga0466967_0060463 | 3300045976 | Bacteria | 3357 |
| 465 | Ga0466967_0063212 | 3300045976 | Bacteria | 3288 |
| 466 | Ga0466967_0192506 | 3300045976 | Bacteria | 1928 |
| 467 | Ga0466967_0369529 | 3300045976 | Bacteria | 1391 |
| 468 | Ga0466967_0395429 | 3300045976 | Bacteria | 1344 |
| 469 | Ga0466967_0611173 | 3300045976 | Bacteria | 1076 |
| 470 | Ga0466967_0939101 | 3300045976 | Bacteria | 861 |
| 471 | Ga0495603_0211809 | 3300046455 | Bacteria | 1119 |
| 472 | Ga0495629_0030982 | 3300046459 | Bacteria | 3789 |
| 473 | Ga0495638_0001570 | 3300046460 | Bacteria | 20486 |
| 474 | Ga0495641_0032769 | 3300046461 | Bacteria | 2471 |
| 475 | Ga0495582_0162613 | 3300046473 | Bacteria | 1270 |
| 476 | Ga0495639_0068454 | 3300046475 | Bacteria | 1637 |
| 477 | Ga0495607_0022173 | 3300046501 | Bacteria | 3993 |
| 478 | Ga0495618_0251761 | 3300046514 | Bacteria | 1108 |
| 479 | Ga0495648_0004296 | 3300046524 | Bacteria | 12210 |
| 480 | Ga0495663_0034452 | 3300046525 | Bacteria | 1516 |
| 481 | Ga0495654_0109509 | 3300046530 | Bacteria | 1262 |
| 482 | Ga0495640_0096179 | 3300046533 | Bacteria | 1949 |
| 483 | Ga0495668_0001186 | 3300046616 | Bacteria | 26476 |
| 484 | Ga0495668_0305887 | 3300046616 | Bacteria | 872 |
| 485 | Ga0495611_0054672 | 3300046648 | Bacteria | 1805 |
| 486 | Ga0495658_0317500 | 3300046683 | Bacteria | 987 |
| 487 | Ga0495624_0427289 | 3300046690 | Bacteria | 794 |
| 488 | Ga0495671_0117006 | 3300046692 | Bacteria | 1301 |
| 489 | Ga0495581_0020291 | 3300047315 | Bacteria | 3858 |
| 490 | Ga0495674_0073343 | 3300047319 | Bacteria | 2951 |
| 491 | Ga0495672_0010022 | 3300047320 | Bacteria | 6793 |
| 492 | Ga0495672_0094110 | 3300047320 | Bacteria | 1639 |
| 493 | Ga0495683_0002024 | 3300047323 | Bacteria | 12559 |
| 494 | Ga0495685_097122 | 3300047447 | Bacteria | 974 |
| 495 | Ga0495673_0002913 | 3300047469 | Bacteria | 11603 |
| 496 | Ga0495686_0038965 | 3300047472 | Bacteria | 3038 |
| 497 | Ga0495593_0044410 | 3300047673 | Bacteria | 2377 |
| 498 | Ga0496100_0004691 | 3300048903 | Bacteria | 7284 |
| 499 | Ga0496100_0099020 | 3300048903 | Bacteria | 2005 |
| 500 | Ga0496100_0119906 | 3300048903 | Bacteria | 1839 |
| 501 | Ga0496100_0716930 | 3300048903 | Bacteria | 781 |
| 502 | Ga0496100_0846532 | 3300048903 | Bacteria | 717 |
| 503 | Ga0496101_0000963 | 3300048904 | Bacteria | 16982 |
| 504 | Ga0496101_0006448 | 3300048904 | Bacteria | 7549 |
| 505 | Ga0496102_0011113 | 3300048905 | Bacteria | 7755 |
| 506 | Ga0496102_0070431 | 3300048905 | Bacteria | 3211 |
| 507 | Ga0496102_0086508 | 3300048905 | Bacteria | 2895 |
| 508 | Ga0496102_0134456 | 3300048905 | Bacteria | 2316 |
| 509 | Ga0496102_0226822 | 3300048905 | Bacteria | 1761 |
| 510 | Ga0496102_0294592 | 3300048905 | Bacteria | 1529 |
| 511 | Ga0496102_0322256 | 3300048905 | Bacteria | 1456 |
| 512 | Ga0496102_1057105 | 3300048905 | Bacteria | 732 |
| 513 | Ga0496103_0004904 | 3300048906 | Bacteria | 8079 |
| 514 | Ga0496103_0043706 | 3300048906 | Bacteria | 2759 |
| 515 | Ga0496103_0086625 | 3300048906 | Bacteria | 1974 |
| 516 | Ga0496103_0098600 | 3300048906 | Bacteria | 1848 |
| 517 | Ga0496103_0243217 | 3300048906 | Bacteria | 1158 |
| 518 | Ga0496104_0028128 | 3300048907 | Bacteria | 5209 |
| 519 | Ga0496104_0149634 | 3300048907 | Bacteria | 2241 |
| 520 | Ga0496104_0293892 | 3300048907 | Bacteria | 1537 |
| 521 | Ga0496104_0491873 | 3300048907 | Bacteria | 1138 |
| 522 | Ga0496105_0010203 | 3300048908 | Bacteria | 7382 |
| 523 | Ga0496105_0110807 | 3300048908 | Bacteria | 2266 |
| 524 | Ga0496105_0116794 | 3300048908 | Bacteria | 2201 |
| 525 | Ga0496105_0281009 | 3300048908 | Bacteria | 1342 |
| 526 | Ga0496106_0020218 | 3300048909 | Bacteria | 4939 |
| 527 | Ga0496106_0049074 | 3300048909 | Bacteria | 3179 |
| 528 | Ga0496106_0083781 | 3300048909 | Bacteria | 2452 |
| 529 | Ga0496107_0007986 | 3300048910 | Bacteria | 7304 |
| 530 | Ga0496107_0039156 | 3300048910 | Bacteria | 3400 |
| 531 | Ga0496107_0069752 | 3300048910 | Bacteria | 2552 |
| 532 | Ga0496107_0070780 | 3300048910 | Bacteria | 2533 |
| 533 | Ga0496107_0444963 | 3300048910 | Bacteria | 963 |
| 534 | Ga0496108_0002078 | 3300048911 | Bacteria | 16016 |
| 535 | Ga0496108_0073213 | 3300048911 | Bacteria | 2893 |
| 536 | Ga0496108_0142949 | 3300048911 | Bacteria | 2062 |
| 537 | Ga0496108_0175706 | 3300048911 | Bacteria | 1854 |
| 538 | Ga0496108_0223466 | 3300048911 | Bacteria | 1636 |
| 539 | Ga0496108_0235450 | 3300048911 | Bacteria | 1592 |
| 540 | Ga0496108_0461773 | 3300048911 | Bacteria | 1109 |
| 541 | Ga0496109_0011117 | 3300048912 | Bacteria | 7720 |
| 542 | Ga0496109_0028832 | 3300048912 | Bacteria | 4969 |
| 543 | Ga0496109_0032560 | 3300048912 | Bacteria | 4686 |
| 544 | Ga0496109_0061059 | 3300048912 | Bacteria | 3445 |
| 545 | Ga0496109_0662556 | 3300048912 | Bacteria | 981 |
| 546 | Ga0496110_0018791 | 3300048913 | Bacteria | 5803 |
| 547 | Ga0496110_0119208 | 3300048913 | Bacteria | 2377 |
| 548 | Ga0496110_0150376 | 3300048913 | Bacteria | 2108 |
| 549 | Ga0496110_0376783 | 3300048913 | Bacteria | 1293 |
| 550 | Ga0496110_0540933 | 3300048913 | Bacteria | 1059 |
| 551 | Ga0496110_1064488 | 3300048913 | Bacteria | 717 |
| 552 | Ga0496111_0054531 | 3300048914 | Bacteria | 2890 |
| 553 | Ga0496112_0005618 | 3300048915 | Bacteria | 10878 |
| 554 | Ga0496112_0032517 | 3300048915 | Bacteria | 5066 |
| 555 | Ga0496112_0058532 | 3300048915 | Bacteria | 3795 |
| 556 | Ga0496112_0141790 | 3300048915 | Bacteria | 2372 |
| 557 | Ga0496112_0150836 | 3300048915 | Bacteria | 2292 |
| 558 | Ga0496112_1091487 | 3300048915 | Bacteria | 716 |
| 559 | Ga0496113_0082838 | 3300048916 | Bacteria | 2461 |
| 560 | Ga0496113_0096089 | 3300048916 | Bacteria | 2290 |
| 561 | Ga0496113_0387891 | 3300048916 | Bacteria | 1121 |
| 562 | Ga0496113_0390993 | 3300048916 | Bacteria | 1116 |
| 563 | Ga0496113_0414029 | 3300048916 | Bacteria | 1082 |
| 564 | Ga0496114_0011079 | 3300048917 | Bacteria | 7196 |
| 565 | Ga0496114_0024447 | 3300048917 | Bacteria | 4932 |
| 566 | Ga0496114_0326492 | 3300048917 | Bacteria | 1356 |
| 567 | Ga0496114_1226494 | 3300048917 | Bacteria | 636 |
| 568 | Ga0496115_0007857 | 3300048918 | Bacteria | 7866 |
| 569 | Ga0496115_0025818 | 3300048918 | Bacteria | 4578 |
| 570 | Ga0496115_0361526 | 3300048918 | Bacteria | 1183 |
| 571 | Ga0496118_0000730 | 3300048921 | Bacteria | 53095 |
| 572 | Ga0496118_0282549 | 3300048921 | Bacteria | 923 |
| 573 | Ga0496120_0168771 | 3300048923 | Bacteria | 1084 |
| 574 | Ga0496122_0003041 | 3300048925 | Bacteria | 22684 |
| 575 | Ga0496122_0140757 | 3300048925 | Bacteria | 1510 |
| 576 | Ga0496123_0002126 | 3300048926 | Bacteria | 25354 |
| 577 | Ga0496126_0018195 | 3300048929 | Bacteria | 6972 |
| 578 | Ga0496126_0282728 | 3300048929 | Bacteria | 1374 |
| 579 | Ga0501032_0014425 | 3300049569 | Bacteria | 5597 |
| 580 | Ga0501032_0056002 | 3300049569 | Bacteria | 2651 |
| 581 | Ga0501033_0108369 | 3300049570 | Bacteria | 2023 |
| 582 | Ga0501034_0035636 | 3300049571 | Bacteria | 5044 |
| 583 | Ga0501036_0001863 | 3300049572 | Bacteria | 16348 |
| 584 | Ga0501037_0004680 | 3300049573 | Bacteria | 9943 |
| 585 | Ga0501037_0104482 | 3300049573 | Bacteria | 2042 |
| 586 | Ga0501038_0002617 | 3300049574 | Bacteria | 16826 |
| 587 | Ga0501039_0000771 | 3300049575 | Bacteria | 23004 |
| 588 | Ga0501040_0124171 | 3300049576 | Bacteria | 1812 |
| 589 | Ga0501043_0000790 | 3300049579 | Bacteria | 28168 |
| 590 | Ga0501043_0074624 | 3300049579 | Bacteria | 2664 |
| 591 | Ga0501043_0751641 | 3300049579 | Bacteria | 709 |
| 592 | Ga0501046_0000382 | 3300049580 | Bacteria | 44315 |
| 593 | Ga0501047_0002654 | 3300049581 | Bacteria | 17016 |
| 594 | Ga0501048_0073165 | 3300049582 | Bacteria | 2419 |
| 595 | Ga0501067_0045878 | 3300049583 | Bacteria | 2426 |
| 596 | Ga0501069_0144743 | 3300049585 | Bacteria | 1364 |
| 597 | Ga0501070_0008026 | 3300049586 | Bacteria | 8939 |
| 598 | Ga0501070_0008775 | 3300049586 | Bacteria | 8547 |
| 599 | Ga0501070_0088482 | 3300049586 | Bacteria | 2563 |
| 600 | Ga0501071_0282176 | 3300049587 | Bacteria | 1257 |
| 601 | Ga0501080_0117808 | 3300049742 | Bacteria | 2462 |
| 602 | Ga0501035_0007912 | 3300049822 | Bacteria | 9926 |
| 603 | Ga0501044_0002938 | 3300049823 | Bacteria | 19390 |
| 604 | nmdc:mga03683_114047_c1 | 3300050489 | Bacteria | 1197 |
| 605 | nmdc:mga03683_17280_c1 | 3300050489 | Bacteria | 2728 |
| 606 | nmdc:mga03683_25184_c1 | 3300050489 | Bacteria | 2334 |
| 607 | nmdc:mga03683_31353_c1 | 3300050489 | Bacteria | 2132 |
| 608 | nmdc:mga03n38_107191_c1 | 3300050490 | Bacteria | 1356 |
| 609 | nmdc:mga03n38_431516_c1 | 3300050490 | Bacteria | 730 |
| 610 | nmdc:mga03n38_48527_c1 | 3300050490 | Bacteria | 1884 |
| 611 | nmdc:mga03n38_613084_c1 | 3300050490 | Bacteria | 621 |
| 612 | nmdc:mga03n38_65217_c1 | 3300050490 | Bacteria | 1669 |
| 613 | nmdc:mga03n38_9908_c1 | 3300050490 | Bacteria | 3485 |
| 614 | nmdc:mga00v17_10325_c1 | 3300050491 | Bacteria | 3679 |
| 615 | nmdc:mga00v17_1611_c1 | 3300050491 | Bacteria | 11784 |
| 616 | nmdc:mga00v17_227940_c1 | 3300050491 | Bacteria | 1207 |
| 617 | nmdc:mga00v17_269044_c1 | 3300050491 | Bacteria | 1106 |
| 618 | nmdc:mga00v17_91095_c1 | 3300050491 | Bacteria | 1915 |
| 619 | nmdc:mga00v17_94471_c1 | 3300050491 | Bacteria | 1881 |
| 620 | nmdc:mga0yw44_14561_c1 | 3300050492 | Bacteria | 4180 |
| 621 | nmdc:mga0yw44_176334_c1 | 3300050492 | Bacteria | 1405 |
| 622 | nmdc:mga0yw44_46969_c1 | 3300050492 | Bacteria | 2596 |
| 623 | nmdc:mga0yw44_77644_c1 | 3300050492 | Bacteria | 2075 |
| 624 | nmdc:mga06z11_11649_c1 | 3300050494 | Bacteria | 3800 |
| 625 | nmdc:mga06z11_376728_c1 | 3300050494 | Bacteria | 852 |
| 626 | nmdc:mga04h51_1888_c1 | 3300050495 | Bacteria | 3567 |
| 627 | nmdc:mga07m45_1189_c1 | 3300050496 | Bacteria | 11749 |
| 628 | nmdc:mga07m45_161182_c1 | 3300050496 | Bacteria | 1302 |
| 629 | nmdc:mga07m45_16453_c1 | 3300050496 | Bacteria | 2891 |
| 630 | nmdc:mga07m45_37616_c1 | 3300050496 | Bacteria | 2699 |
| 631 | nmdc:mga0qj67_87209_c1 | 3300050509 | Bacteria | 2504 |
| 632 | nmdc:mga08y16_674320_c1 | 3300050511 | Bacteria | 1036 |
| 633 | nmdc:mga0sz30_18360_c2 | 3300050516 | Bacteria | 2206 |
| 634 | nmdc:mga0sz30_211790_c1 | 3300050516 | Bacteria | 861 |
| 635 | nmdc:mga0sz30_49626_c1 | 3300050516 | Bacteria | 1778 |
| 636 | nmdc:mga0sz30_654_c2 | 3300050516 | Bacteria | 10386 |
| 637 | nmdc:mga0sz30_716_c1 | 3300050516 | Bacteria | 12200 |
| 638 | Ga0495655_0011622 | 3300053083 | Bacteria | 1774 |
| 639 | Ga0495619_0495635 | 3300053085 | Bacteria | 840 |
| 640 | Ga0500643_001666 | 3300053087 | Bacteria | 12380 |
| 641 | Ga0500641_0051007 | 3300053096 | Bacteria | 1702 |
| 642 | Ga0500652_000149 | 3300053131 | Bacteria | 26512 |
| 643 | Ga0500616_0003317 | 3300053153 | Bacteria | 12408 |
| 644 | Ga0500616_0009322 | 3300053153 | Bacteria | 5979 |
| 645 | Ga0500620_131167 | 3300053155 | Bacteria | 877 |
| 646 | Ga0466962_0004482 | 3300061719 | Bacteria | 6693 |
| 647 | Ga0466962_0009524 | 3300061719 | Bacteria | 4658 |
| 648 | Ga0466962_0232267 | 3300061719 | Bacteria | 904 |
| 649 | 2548699026 | 2547132424 | Bacteria | 8348532 |
| 650 | 2552110699 | 2551306166 | Bacteria | 9731570 |
| 651 | 2566992133 | 2565956761 | Bacteria | 6601618 |
| 652 | 2644490601 | 2643221687 | Bacteria | 6500351 |
| 653 | 2644513926 | 2643221692 | Bacteria | 7282860 |
| 654 | 2644636998 | 2643221715 | Bacteria | 6671032 |
| 655 | 2739204182 | 2738543005 | Bacteria | 5278128 |
| 656 | 2739238171 | 2738543011 | Bacteria | 5731169 |
| 657 | 2739364820 | 2738543034 | Bacteria | 6084756 |
| 658 | 2753037782 | 2751185725 | Bacteria | 5740550 |
| 659 | 2753325650 | 2751185792 | Bacteria | 5739090 |
| 660 | 2889303293 | 2889300758 | Bacteria | 5690814 |
| 661 | 2902800516 | 2902799365 | Bacteria | 5419524 |
| 662 | 2902814849 | 2902810491 | Bacteria | 6794147 |
| 663 | 2902843245 | 2902837492 | Bacteria | 6697721 |
| 664 | 2904538045 | 2904535858 | Bacteria | 6308016 |
| 665 | 2904766538 | 2904765812 | Bacteria | 5369154 |
| 666 | 2904772706 | 2904770941 | Bacteria | 5580202 |
| 667 | 2908811497 | 2908811453 | Bacteria | 5478616 |
| 668 | 2919421026 | 2919420072 | Bacteria | 5390363 |
| 669 | 2919433216 | 2919432681 | Bacteria | 5390474 |
| 670 | 2919716983 | 2919713450 | Bacteria | 7431245 |
| 671 | 2922557229 | 2922554459 | Bacteria | 6683962 |
| 672 | 2928145069 | 2928142448 | Bacteria | 5288925 |
| 673 | 2929217500 | 2929212328 | Bacteria | 7708288 |
| 674 | 2932400450 | 2932398195 | Bacteria | 3847976 |
| 675 | 2939584758 | 2939582691 | Bacteria | 7088898 |
| 676 | 2939745818 | 2939743619 | Bacteria | 5762299 |
| 677 | Ga0466967_0048757 | |||
| 678 | JGI24746J21847_1000249 | |||
| 679 | JGI24737J22298_10038251 | |||
| 680 | JGI24744J21845_10002207 | |||
| 681 | JGI24744J21845_10016152 | |||
| 682 | rootH2_10146445 | |||
| 683 | rootL2_10160125 | |||
| 684 | Ga0055540_1001795 | |||
| 685 | Ga0055540_1009417 | |||
| 686 | Ga0055540_1011152 | |||
| 687 | Ga0070658_10607210 | |||
| 688 | Ga0070676_10010723 | |||
| 689 | Ga0070683_100167466 | |||
| 690 | Ga0070683_100219247 | |||
| 691 | Ga0070683_100241042 | |||
| 692 | Ga0070690_100151061 | |||
| 693 | Ga0070670_100708862 | |||
| 694 | Ga0068869_100096412 | |||
| 695 | Ga0070666_10179911 | |||
| 696 | Ga0070666_10189511 | |||
| 697 | Ga0070680_100239401 | |||
| 698 | Ga0070682_100088168 | |||
| 699 | Ga0068868_100040396 | |||
| 700 | Ga0068868_100480219 | |||
| 701 | Ga0070660_100188710 | |||
| 702 | Ga0070689_100004126 | |||
| 703 | Ga0070691_10038194 | |||
| 704 | Ga0070691_10062532 | |||
| 705 | Ga0070691_10274739 | |||
| 706 | Ga0070692_10078001 | |||
| 707 | Ga0070668_100008191 | |||
| 708 | Ga0070668_100061451 | |||
| 709 | Ga0070668_100610737 | |||
| 710 | Ga0070669_100043553 | |||
| 711 | Ga0070669_100076749 | |||
| 712 | Ga0070675_100468309 | |||
| 713 | Ga0070675_100679253 | |||
| 714 | Ga0070671_100012064 | |||
| 715 | Ga0070671_100661155 | |||
| 716 | Ga0070674_100003905 | |||
| 717 | Ga0070673_100063938 | |||
| 718 | Ga0070659_100167850 | |||
| 719 | Ga0070667_100000207 | |||
| 720 | Ga0070667_100008191 | |||
| 721 | Ga0070667_100045426 | |||
| 722 | Ga0070667_100047120 | |||
| 723 | Ga0070703_10021993 | |||
| 724 | Ga0070709_10015484 | |||
| 725 | Ga0070714_100251570 | |||
| 726 | Ga0070714_100274286 | |||
| 727 | Ga0070714_100471712 | |||
| 728 | Ga0070714_101046158 | |||
| 729 | Ga0070713_100407450 | |||
| 730 | Ga0070710_10002949 | |||
| 731 | Ga0070710_10067081 | |||
| 732 | Ga0070701_10009581 | |||
| 733 | Ga0070701_10112075 | |||
| 734 | Ga0070711_100008390 | |||
| 735 | Ga0070711_100028157 | |||
| 736 | Ga0070705_100130391 | |||
| 737 | Ga0070663_100010779 | |||
| 738 | Ga0070663_100142894 | |||
| 739 | Ga0070678_100004244 | |||
| 740 | Ga0070678_100307025 | |||
| 741 | Ga0070662_100015171 | |||
| 742 | Ga0070662_100107732 | |||
| 743 | Ga0068867_100013125 | |||
| 744 | Ga0070685_10007226 | |||
| 745 | Ga0070679_100178923 | |||
| 746 | Ga0070684_100314547 | |||
| 747 | Ga0070684_100341054 | |||
| 748 | Ga0068853_100009963 | |||
| 749 | Ga0068853_100037295 | |||
| 750 | Ga0068853_100476191 | |||
| 751 | Ga0070672_100098550 | |||
| 752 | Ga0070672_100354081 | |||
| 753 | Ga0070686_100089807 | |||
| 754 | Ga0070686_100269187 | |||
| 755 | Ga0070695_100222085 | |||
| 756 | Ga0070696_100059198 | |||
| 757 | Ga0070693_100014322 | |||
| 758 | Ga0070693_100263816 | |||
| 759 | Ga0070665_100012212 | |||
| 760 | Ga0070665_100166458 | |||
| 761 | Ga0070665_100306262 | |||
| 762 | Ga0070665_100801159 | |||
| 763 | Ga0070704_100030388 | |||
| 764 | Ga0068854_100054668 | |||
| 765 | Ga0070702_100022094 | |||
| 766 | Ga0070702_100076639 | |||
| 767 | Ga0070702_100408423 | |||
| 768 | Ga0068852_100056062 | |||
| 769 | Ga0068859_100061979 | |||
| 770 | Ga0068859_100097718 | |||
| 771 | Ga0068859_100564112 | |||
| 772 | Ga0068859_100822505 | |||
| 773 | Ga0068864_100054331 | |||
| 774 | Ga0068864_100177382 | |||
| 775 | Ga0068866_10384840 | |||
| 776 | Ga0068861_100017161 | |||
| 777 | Ga0068861_100136918 | |||
| 778 | Ga0068861_100210179 | |||
| 779 | Ga0068870_10009240 | |||
| 780 | Ga0068863_100008676 | |||
| 781 | Ga0068863_100217975 | |||
| 782 | Ga0068863_100948513 | |||
| 783 | Ga0068858_100012734 | |||
| 784 | Ga0068858_100179477 | |||
| 785 | Ga0068858_100362660 | |||
| 786 | Ga0068860_100012921 | |||
| 787 | Ga0068862_100024124 | |||
| 788 | Ga0068862_100480084 | |||
| 789 | Ga0081455_10047330 | |||
| 790 | Ga0075365_10006497 | |||
| 791 | Ga0075365_10033249 | |||
| 792 | Ga0075365_10049016 | |||
| 793 | Ga0075365_10050995 | |||
| 794 | Ga0075365_10159998 | |||
| 795 | Ga0075365_10179955 | |||
| 796 | Ga0075368_10023140 | |||
| 797 | Ga0075363_100000752 | |||
| 798 | Ga0075363_100064429 | |||
| 799 | Ga0075363_100072411 | |||
| 800 | Ga0075364_10001726 | |||
| 801 | Ga0075364_10026141 | |||
| 802 | Ga0075364_10042128 | |||
| 803 | Ga0075364_10085326 | |||
| 804 | Ga0075364_10214141 | |||
| 805 | Ga0070715_10253668 | |||
| 806 | Ga0070716_100012068 | |||
| 807 | Ga0070716_100099726 | |||
| 808 | Ga0070712_100005319 | |||
| 809 | Ga0070712_100041669 | |||
| 810 | Ga0070712_100217057 | |||
| 811 | Ga0075362_10021887 | |||
| 812 | Ga0075362_10024279 | |||
| 813 | Ga0075367_10037673 | |||
| 814 | Ga0075367_10204958 | |||
| 815 | Ga0075367_10367867 | |||
| 816 | Ga0075369_10003028 | |||
| 817 | Ga0075369_10004827 | |||
| 818 | Ga0075369_10046042 | |||
| 819 | Ga0075369_10070799 | |||
| 820 | Ga0075369_10092927 | |||
| 821 | Ga0075369_10132862 | |||
| 822 | Ga0075369_10181604 | |||
| 823 | Ga0075369_10271215 | |||
| 824 | Ga0075366_10046485 | |||
| 825 | Ga0075370_10000341 | |||
| 826 | Ga0075370_10033558 | |||
| 827 | Ga0075370_10068216 | |||
| 828 | Ga0075370_10080177 | |||
| 829 | Ga0075370_10134468 | |||
| 830 | Ga0068871_100324065 | |||
| 831 | Ga0075428_100007312 | |||
| 832 | Ga0075430_100058874 | |||
| 833 | Ga0075430_100203186 | |||
| 834 | Ga0068865_100003973 | |||
| 835 | Ga0068865_100355231 | |||
| 836 | Ga0075436_100562509 | |||
| 837 | Ga0097620_100061977 | |||
| 838 | Ga0097620_100097721 | |||
| 839 | Ga0097620_100564065 | |||
| 840 | Ga0097620_100822498 | |||
| 841 | Ga0099795_10014471 | |||
| 842 | Ga0105250_10098049 | |||
| 843 | Ga0105250_10126503 | |||
| 844 | Ga0105245_10011752 | |||
| 845 | Ga0105245_10437888 | |||
| 846 | Ga0105245_10727364 | |||
| 847 | Ga0105247_10213411 | |||
| 848 | Ga0105247_10381803 | |||
| 849 | Ga0114129_10018369 | |||
| 850 | Ga0105243_10004112 | |||
| 851 | Ga0105243_10091180 | |||
| 852 | Ga0105243_10622929 | |||
| 853 | Ga0105241_10084060 | |||
| 854 | Ga0105241_10719454 | |||
| 855 | Ga0105242_10007699 | |||
| 856 | Ga0105242_10213964 | |||
| 857 | Ga0105248_10014903 | |||
| 858 | Ga0105248_10016636 | |||
| 859 | Ga0105237_10115171 | |||
| 860 | Ga0105237_10382390 | |||
| 861 | Ga0105237_10530859 | |||
| 862 | Ga0105238_10356790 | |||
| 863 | Ga0105238_10539435 | |||
| 864 | Ga0105238_10655490 | |||
| 865 | Ga0105249_10162835 | |||
| 866 | Ga0105249_10304708 | |||
| 867 | Ga0105249_10321414 | |||
| 868 | Ga0157369_10247069 | |||
| 869 | Ga0157374_10048291 | |||
| 870 | Ga0157374_10441970 | |||
| 871 | Ga0157378_10009418 | |||
| 872 | Ga0157378_10263176 | |||
| 873 | Ga0157378_10789661 | |||
| 874 | Ga0163162_10036034 | |||
| 875 | Ga0163162_10180314 | |||
| 876 | Ga0157375_10084168 | |||
| 877 | Ga0163163_10017194 | |||
| 878 | Ga0163163_10256273 | |||
| 879 | Ga0163163_10670829 | |||
| 880 | Ga0157380_10038541 | |||
| 881 | Ga0157377_10003584 | |||
| 882 | Ga0157379_10015516 | |||
| 883 | Ga0157379_10163347 | |||
| 884 | Ga0157376_10763132 | |||
| 885 | Ga0163161_10062208 | |||
| 886 | Ga0163161_10070186 | |||
| 887 | Ga0163161_10086070 | |||
| 888 | Ga0213876_10016537 | |||
| 889 | Ga0213875_10013950 | |||
| 890 | Ga0209051_1004009 | |||
| 891 | Ga0209051_1012702 | |||
| 892 | Ga0209051_1014796 | |||
| 893 | Ga0209051_1033969 | |||
| 894 | Ga0207696_1067118 | |||
| 895 | Ga0207653_10075585 | |||
| 896 | Ga0207642_10010536 | |||
| 897 | Ga0207710_10025602 | |||
| 898 | Ga0207710_10197496 | |||
| 899 | Ga0207688_10003584 | |||
| 900 | Ga0207688_10008767 | |||
| 901 | Ga0207647_10083676 | |||
| 902 | Ga0207699_10007946 | |||
| 903 | Ga0207705_10268766 | |||
| 904 | Ga0207671_10045140 | |||
| 905 | Ga0207671_10151767 | |||
| 906 | Ga0207671_10235919 | |||
| 907 | Ga0207693_10009413 | |||
| 908 | Ga0207693_10069987 | |||
| 909 | Ga0207663_10036716 | |||
| 910 | Ga0207663_10500122 | |||
| 911 | Ga0207657_10171176 | |||
| 912 | Ga0207681_10353286 | |||
| 913 | Ga0207694_10508085 | |||
| 914 | Ga0207659_10358568 | |||
| 915 | Ga0207687_10009671 | |||
| 916 | Ga0207687_10287753 | |||
| 917 | Ga0207700_10420688 | |||
| 918 | Ga0207664_10103874 | |||
| 919 | Ga0207664_10151344 | |||
| 920 | Ga0207664_10405475 | |||
| 921 | Ga0207664_10418065 | |||
| 922 | Ga0207644_10020036 | |||
| 923 | Ga0207644_10514456 | |||
| 924 | Ga0207690_10153844 | |||
| 925 | Ga0207706_10018529 | |||
| 926 | Ga0207706_10318744 | |||
| 927 | Ga0207686_10114754 | |||
| 928 | Ga0207709_10004934 | |||
| 929 | Ga0207709_10005610 | |||
| 930 | Ga0207709_10136439 | |||
| 931 | Ga0207670_10066091 | |||
| 932 | Ga0207669_10006346 | |||
| 933 | Ga0207669_10064784 | |||
| 934 | Ga0207704_10005939 | |||
| 935 | Ga0207704_10278385 | |||
| 936 | Ga0207665_10015671 | |||
| 937 | Ga0207665_10044280 | |||
| 938 | Ga0207691_10102466 | |||
| 939 | Ga0207691_10627063 | |||
| 940 | Ga0207711_10021885 | |||
| 941 | Ga0207689_10110945 | |||
| 942 | Ga0207661_10229991 | |||
| 943 | Ga0207667_10155041 | |||
| 944 | Ga0207667_10238937 | |||
| 945 | Ga0207712_10009714 | |||
| 946 | Ga0207668_10000526 | |||
| 947 | Ga0207668_10009108 | |||
| 948 | Ga0207658_10018649 | |||
| 949 | Ga0207658_10069945 | |||
| 950 | Ga0207658_10215988 | |||
| 951 | Ga0207703_10009089 | |||
| 952 | Ga0207703_10059867 | |||
| 953 | Ga0207703_10506386 | |||
| 954 | Ga0207703_10719974 | |||
| 955 | Ga0207639_10028496 | |||
| 956 | Ga0207639_10045475 | |||
| 957 | Ga0207678_10005752 | |||
| 958 | Ga0207678_10016047 | |||
| 959 | Ga0207678_10018037 | |||
| 960 | Ga0207708_10065683 | |||
| 961 | Ga0207702_10067164 | |||
| 962 | Ga0207641_10003476 | |||
| 963 | Ga0207641_10063120 | |||
| 964 | Ga0207648_10010554 | |||
| 965 | Ga0207648_10209207 | |||
| 966 | Ga0207676_10479195 | |||
| 967 | Ga0207676_10920883 | |||
| 968 | Ga0207675_100012618 | |||
| 969 | Ga0207675_100116178 | |||
| 970 | Ga0207675_100403263 | |||
| 971 | Ga0207675_100457508 | |||
| 972 | Ga0207683_10011339 | |||
| 973 | Ga0207683_10097174 | |||
| 974 | Ga0207698_10288110 | |||
| 975 | Ga0207698_11020449 | |||
| 976 | Ga0209179_1025803 | |||
| 977 | Ga0268266_10013715 | |||
| 978 | Ga0268266_10069761 | |||
| 979 | Ga0268266_10092239 | |||
| 980 | Ga0268266_10605161 | |||
| 981 | Ga0268265_10067910 | |||
| 982 | Ga0268264_10059530 | |||
| 983 | Ga0268264_10247271 | |||
| 984 | Ga0265327_10000018 | |||
| 985 | Ga0265327_10001055 | |||
| 986 | Ga0265327_10012159 | |||
| 987 | Ga0307408_100079665 | |||
| 988 | Ga0307408_100113899 | |||
| 989 | Ga0307405_10034901 | |||
| 990 | Ga0307405_10225861 | |||
| 991 | Ga0307405_10292107 | |||
| 992 | Ga0307405_10486831 | |||
| 993 | Ga0307413_10045379 | |||
| 994 | Ga0307413_10159572 | |||
| 995 | Ga0307410_10027563 | |||
| 996 | Ga0307410_10030483 | |||
| 997 | Ga0307410_10035295 | |||
| 998 | Ga0307410_10161485 | |||
| 999 | Ga0307410_10252391 | |||
| 1000 | Ga0307410_10290186 | |||
| 1001 | Ga0307410_10382653 | |||
| 1002 | Ga0307410_10520573 | |||
| 1003 | Ga0307410_11075128 | |||
| 1004 | Ga0307406_10083322 | |||
| 1005 | Ga0307406_10094734 | |||
| 1006 | Ga0307406_10200135 | |||
| 1007 | Ga0307406_10525545 | |||
| 1008 | Ga0307406_11102180 | |||
| 1009 | Ga0307407_10265598 | |||
| 1010 | Ga0307407_10482602 | |||
| 1011 | Ga0307407_10509218 | |||
| 1012 | Ga0307412_10064726 | |||
| 1013 | Ga0307412_10161283 | |||
| 1014 | Ga0307412_10191651 | |||
| 1015 | Ga0307409_100049766 | |||
| 1016 | Ga0307409_100074821 | |||
| 1017 | Ga0307409_100114532 | |||
| 1018 | Ga0307409_100121219 | |||
| 1019 | Ga0307409_100168247 | |||
| 1020 | Ga0307409_100182036 | |||
| 1021 | Ga0307409_100336892 | |||
| 1022 | Ga0307409_100345788 | |||
| 1023 | Ga0307409_100479588 | |||
| 1024 | Ga0307409_100898232 | |||
| 1025 | Ga0307416_100070336 | |||
| 1026 | Ga0307416_100100337 | |||
| 1027 | Ga0307416_100152629 | |||
| 1028 | Ga0307416_100292024 | |||
| 1029 | Ga0307416_100562654 | |||
| 1030 | Ga0307416_101576004 | |||
| 1031 | Ga0307416_101778903 | |||
| 1032 | Ga0307414_10069910 | |||
| 1033 | Ga0307414_10169616 | |||
| 1034 | Ga0307414_10211218 | |||
| 1035 | Ga0307414_10231482 | |||
| 1036 | Ga0307414_10468208 | |||
| 1037 | Ga0307414_10617807 | |||
| 1038 | Ga0307411_10036755 | |||
| 1039 | Ga0307411_10049088 | |||
| 1040 | Ga0307411_10103015 | |||
| 1041 | Ga0307411_10133597 | |||
| 1042 | Ga0307411_10314709 | |||
| 1043 | Ga0307415_100051496 | |||
| 1044 | Ga0307415_100113811 | |||
| 1045 | Ga0307415_100297193 | |||
| 1046 | Ga0307415_100308246 | |||
| 1047 | Ga0307415_100376709 | |||
| 1048 | Ga0307415_100381204 | |||
| 1049 | Ga0307415_100504186 | |||
| 1050 | Ga0307415_100642380 | |||
| 1051 | Ga0307415_101105670 | |||
| 1052 | Ga0373932_0203610 | |||
| 1053 | Ga0373943_0054214 | |||
| 1054 | Ga0373931_0046329 | |||
| 1055 | Ga0316584_0233041 | |||
| 1056 | Ga0395899_0358439 | |||
| 1057 | Ga0395900_0060881 | |||
| 1058 | Ga0395898_0011113 | |||
| 1059 | Ga0436364_0815483 | |||
| 1060 | Ga0436364_1009898 | |||
| 1061 | Ga0395901_0007866 | |||
| 1062 | Ga0395901_0685346 | |||
| 1063 | Ga0436365_1064965 | |||
| 1064 | Ga0436365_1630628 | |||
| 1065 | Ga0436363_1156190 | |||
| 1066 | Ga0439466_0041890 | |||
| 1067 | Ga0439466_0054626 | |||
| 1068 | Ga0439466_0107995 | |||
| 1069 | Ga0439465_0014461 | |||
| 1070 | Ga0439465_0071915 | |||
| 1071 | Ga0451802_1930661 | |||
| 1072 | Ga0451806_754557 | |||
| 1073 | Ga0451841_1132979 | |||
| 1074 | Ga0439442_004527 | |||
| 1075 | Ga0439445_0016618 | |||
| 1076 | Ga0439434_0007518 | |||
| 1077 | Ga0439460_0093333 | |||
| 1078 | Ga0466969_0162829 | |||
| 1079 | Ga0466969_0190549 | |||
| 1080 | Ga0466972_0005077 | |||
| 1081 | Ga0466972_0080684 | |||
| 1082 | Ga0466972_0436576 | |||
| 1083 | Ga0466965_0003274 | |||
| 1084 | Ga0466966_0102580 | |||
| 1085 | Ga0466966_0187352 | |||
| 1086 | Ga0466966_0302036 | |||
| 1087 | Ga0466966_0342842 | |||
| 1088 | Ga0466961_0102915 | |||
| 1089 | Ga0466961_0121933 | |||
| 1090 | Ga0466963_0051985 | |||
| 1091 | Ga0466963_0077109 | |||
| 1092 | Ga0466963_0152553 | |||
| 1093 | Ga0466963_0805105 | |||
| 1094 | Ga0466971_0009094 | |||
| 1095 | Ga0466971_0106889 | |||
| 1096 | Ga0466968_0007618 | |||
| 1097 | Ga0466968_0175590 | |||
| 1098 | Ga0466968_0226600 | |||
| 1099 | Ga0466970_0003951 | |||
| 1100 | Ga0466970_0032862 | |||
| 1101 | Ga0466970_0040508 | |||
| 1102 | Ga0466970_0055238 | |||
| 1103 | Ga0466970_0382177 | |||
| 1104 | Ga0466970_0405379 | |||
| 1105 | Ga0466957_0022676 | |||
| 1106 | Ga0466957_0034944 | |||
| 1107 | Ga0466957_0086013 | |||
| 1108 | Ga0466957_0091350 | |||
| 1109 | Ga0466957_0160496 | |||
| 1110 | Ga0466957_0171224 | |||
| 1111 | Ga0466957_0445666 | |||
| 1112 | Ga0466960_0000265 | |||
| 1113 | Ga0466960_0006050 | |||
| 1114 | Ga0466960_0018707 | |||
| 1115 | Ga0466960_0022165 | |||
| 1116 | Ga0466960_0038680 | |||
| 1117 | Ga0466960_0053050 | |||
| 1118 | Ga0466960_0253385 | |||
| 1119 | Ga0466960_0396245 | |||
| 1120 | Ga0466959_0054959 | |||
| 1121 | Ga0466959_0093606 | |||
| 1122 | Ga0466959_0139325 | |||
| 1123 | Ga0466959_0174485 | |||
| 1124 | Ga0466959_0242173 | |||
| 1125 | Ga0466959_0419627 | |||
| 1126 | Ga0466959_0568260 | |||
| 1127 | Ga0466958_0040833 | |||
| 1128 | Ga0466958_0110327 | |||
| 1129 | Ga0466958_0142499 | |||
| 1130 | Ga0466958_0179823 | |||
| 1131 | Ga0466958_0194556 | |||
| 1132 | Ga0466958_0285821 | |||
| 1133 | Ga0466958_0312897 | |||
| 1134 | Ga0466958_0328469 | |||
| 1135 | Ga0466958_0467917 | |||
| 1136 | Ga0466967_0011184 | |||
| 1137 | Ga0466967_0024884 | |||
| 1138 | Ga0466967_0029991 | |||
| 1139 | Ga0466967_0032663 | |||
| 1140 | Ga0466967_0060463 | |||
| 1141 | Ga0466967_0063212 | |||
| 1142 | Ga0466967_0192506 | |||
| 1143 | Ga0466967_0369529 | |||
| 1144 | Ga0466967_0395429 | |||
| 1145 | Ga0466967_0611173 | |||
| 1146 | Ga0466967_0939101 | |||
| 1147 | Ga0495603_0211809 | |||
| 1148 | Ga0495629_0030982 | |||
| 1149 | Ga0495638_0001570 | |||
| 1150 | Ga0495641_0032769 | |||
| 1151 | Ga0495582_0162613 | |||
| 1152 | Ga0495639_0068454 | |||
| 1153 | Ga0495607_0022173 | |||
| 1154 | Ga0495618_0251761 | |||
| 1155 | Ga0495648_0004296 | |||
| 1156 | Ga0495663_0034452 | |||
| 1157 | Ga0495654_0109509 | |||
| 1158 | Ga0495640_0096179 | |||
| 1159 | Ga0495668_0001186 | |||
| 1160 | Ga0495668_0305887 | |||
| 1161 | Ga0495611_0054672 | |||
| 1162 | Ga0495658_0317500 | |||
| 1163 | Ga0495624_0427289 | |||
| 1164 | Ga0495671_0117006 | |||
| 1165 | Ga0495581_0020291 | |||
| 1166 | Ga0495674_0073343 | |||
| 1167 | Ga0495672_0010022 | |||
| 1168 | Ga0495672_0094110 | |||
| 1169 | Ga0495683_0002024 | |||
| 1170 | Ga0495685_097122 | |||
| 1171 | Ga0495673_0002913 | |||
| 1172 | Ga0495686_0038965 | |||
| 1173 | Ga0495593_0044410 | |||
| 1174 | Ga0496100_0004691 | |||
| 1175 | Ga0496100_0099020 | |||
| 1176 | Ga0496100_0119906 | |||
| 1177 | Ga0496100_0716930 | |||
| 1178 | Ga0496100_0846532 | |||
| 1179 | Ga0496101_0000963 | |||
| 1180 | Ga0496101_0006448 | |||
| 1181 | Ga0496102_0011113 | |||
| 1182 | Ga0496102_0070431 | |||
| 1183 | Ga0496102_0086508 | |||
| 1184 | Ga0496102_0134456 | |||
| 1185 | Ga0496102_0226822 | |||
| 1186 | Ga0496102_0294592 | |||
| 1187 | Ga0496102_0322256 | |||
| 1188 | Ga0496102_1057105 | |||
| 1189 | Ga0496103_0004904 | |||
| 1190 | Ga0496103_0043706 | |||
| 1191 | Ga0496103_0086625 | |||
| 1192 | Ga0496103_0098600 | |||
| 1193 | Ga0496103_0243217 | |||
| 1194 | Ga0496104_0028128 | |||
| 1195 | Ga0496104_0149634 | |||
| 1196 | Ga0496104_0293892 | |||
| 1197 | Ga0496104_0491873 | |||
| 1198 | Ga0496105_0010203 | |||
| 1199 | Ga0496105_0110807 | |||
| 1200 | Ga0496105_0116794 | |||
| 1201 | Ga0496105_0281009 | |||
| 1202 | Ga0496106_0020218 | |||
| 1203 | Ga0496106_0049074 | |||
| 1204 | Ga0496106_0083781 | |||
| 1205 | Ga0496107_0007986 | |||
| 1206 | Ga0496107_0039156 | |||
| 1207 | Ga0496107_0069752 | |||
| 1208 | Ga0496107_0070780 | |||
| 1209 | Ga0496107_0444963 | |||
| 1210 | Ga0496108_0002078 | |||
| 1211 | Ga0496108_0073213 | |||
| 1212 | Ga0496108_0142949 | |||
| 1213 | Ga0496108_0175706 | |||
| 1214 | Ga0496108_0223466 | |||
| 1215 | Ga0496108_0235450 | |||
| 1216 | Ga0496108_0461773 | |||
| 1217 | Ga0496109_0011117 | |||
| 1218 | Ga0496109_0028832 | |||
| 1219 | Ga0496109_0032560 | |||
| 1220 | Ga0496109_0061059 | |||
| 1221 | Ga0496109_0662556 | |||
| 1222 | Ga0496110_0018791 | |||
| 1223 | Ga0496110_0119208 | |||
| 1224 | Ga0496110_0150376 | |||
| 1225 | Ga0496110_0376783 | |||
| 1226 | Ga0496110_0540933 | |||
| 1227 | Ga0496110_1064488 | |||
| 1228 | Ga0496111_0054531 | |||
| 1229 | Ga0496112_0005618 | |||
| 1230 | Ga0496112_0032517 | |||
| 1231 | Ga0496112_0058532 | |||
| 1232 | Ga0496112_0141790 | |||
| 1233 | Ga0496112_0150836 | |||
| 1234 | Ga0496112_1091487 | |||
| 1235 | Ga0496113_0082838 | |||
| 1236 | Ga0496113_0096089 | |||
| 1237 | Ga0496113_0387891 | |||
| 1238 | Ga0496113_0390993 | |||
| 1239 | Ga0496113_0414029 | |||
| 1240 | Ga0496114_0011079 | |||
| 1241 | Ga0496114_0024447 | |||
| 1242 | Ga0496114_0326492 | |||
| 1243 | Ga0496114_1226494 | |||
| 1244 | Ga0496115_0007857 | |||
| 1245 | Ga0496115_0025818 | |||
| 1246 | Ga0496115_0361526 | |||
| 1247 | Ga0496118_0000730 | |||
| 1248 | Ga0496118_0282549 | |||
| 1249 | Ga0496120_0168771 | |||
| 1250 | Ga0496122_0003041 | |||
| 1251 | Ga0496122_0140757 | |||
| 1252 | Ga0496123_0002126 | |||
| 1253 | Ga0496126_0018195 | |||
| 1254 | Ga0496126_0282728 | |||
| 1255 | Ga0501032_0014425 | |||
| 1256 | Ga0501032_0056002 | |||
| 1257 | Ga0501033_0108369 | |||
| 1258 | Ga0501034_0035636 | |||
| 1259 | Ga0501036_0001863 | |||
| 1260 | Ga0501037_0004680 | |||
| 1261 | Ga0501037_0104482 | |||
| 1262 | Ga0501038_0002617 | |||
| 1263 | Ga0501039_0000771 | |||
| 1264 | Ga0501040_0124171 | |||
| 1265 | Ga0501043_0000790 | |||
| 1266 | Ga0501043_0074624 | |||
| 1267 | Ga0501043_0751641 | |||
| 1268 | Ga0501046_0000382 | |||
| 1269 | Ga0501047_0002654 | |||
| 1270 | Ga0501048_0073165 | |||
| 1271 | Ga0501067_0045878 | |||
| 1272 | Ga0501069_0144743 | |||
| 1273 | Ga0501070_0008026 | |||
| 1274 | Ga0501070_0008775 | |||
| 1275 | Ga0501070_0088482 | |||
| 1276 | Ga0501071_0282176 | |||
| 1277 | Ga0501080_0117808 | |||
| 1278 | Ga0501035_0007912 | |||
| 1279 | Ga0501044_0002938 | |||
| 1280 | nmdc:mga03683_114047_c1 | |||
| 1281 | nmdc:mga03683_17280_c1 | |||
| 1282 | nmdc:mga03683_25184_c1 | |||
| 1283 | nmdc:mga03683_31353_c1 | |||
| 1284 | nmdc:mga03n38_107191_c1 | |||
| 1285 | nmdc:mga03n38_431516_c1 | |||
| 1286 | nmdc:mga03n38_48527_c1 | |||
| 1287 | nmdc:mga03n38_613084_c1 | |||
| 1288 | nmdc:mga03n38_65217_c1 | |||
| 1289 | nmdc:mga03n38_9908_c1 | |||
| 1290 | nmdc:mga00v17_10325_c1 | |||
| 1291 | nmdc:mga00v17_1611_c1 | |||
| 1292 | nmdc:mga00v17_227940_c1 | |||
| 1293 | nmdc:mga00v17_269044_c1 | |||
| 1294 | nmdc:mga00v17_91095_c1 | |||
| 1295 | nmdc:mga00v17_94471_c1 | |||
| 1296 | nmdc:mga0yw44_14561_c1 | |||
| 1297 | nmdc:mga0yw44_176334_c1 | |||
| 1298 | nmdc:mga0yw44_46969_c1 | |||
| 1299 | nmdc:mga0yw44_77644_c1 | |||
| 1300 | nmdc:mga06z11_11649_c1 | |||
| 1301 | nmdc:mga06z11_376728_c1 | |||
| 1302 | nmdc:mga04h51_1888_c1 | |||
| 1303 | nmdc:mga07m45_1189_c1 | |||
| 1304 | nmdc:mga07m45_161182_c1 | |||
| 1305 | nmdc:mga07m45_16453_c1 | |||
| 1306 | nmdc:mga07m45_37616_c1 | |||
| 1307 | nmdc:mga0qj67_87209_c1 | |||
| 1308 | nmdc:mga08y16_674320_c1 | |||
| 1309 | nmdc:mga0sz30_18360_c2 | |||
| 1310 | nmdc:mga0sz30_211790_c1 | |||
| 1311 | nmdc:mga0sz30_49626_c1 | |||
| 1312 | nmdc:mga0sz30_654_c2 | |||
| 1313 | nmdc:mga0sz30_716_c1 | |||
| 1314 | Ga0495655_0011622 | |||
| 1315 | Ga0495619_0495635 | |||
| 1316 | Ga0500643_001666 | |||
| 1317 | Ga0500641_0051007 | |||
| 1318 | Ga0500652_000149 | |||
| 1319 | Ga0500616_0003317 | |||
| 1320 | Ga0500616_0009322 | |||
| 1321 | Ga0500620_131167 | |||
| 1322 | Ga0466962_0004482 | |||
| 1323 | Ga0466962_0009524 | |||
| 1324 | Ga0466962_0232267 | |||
| 1325 | 2548699026 | |||
| 1326 | 2552110699 | |||
| 1327 | 2566992133 | |||
| 1328 | 2644490601 | |||
| 1329 | 2644513926 | |||
| 1330 | 2644636998 | |||
| 1331 | 2739204182 | |||
| 1332 | 2739238171 | |||
| 1333 | 2739364820 | |||
| 1334 | 2753037782 | |||
| 1335 | 2753325650 | |||
| 1336 | 2889303293 | |||
| 1337 | 2902800516 | |||
| 1338 | 2902814849 | |||
| 1339 | 2902843245 | |||
| 1340 | 2904538045 | |||
| 1341 | 2904766538 | |||
| 1342 | 2904772706 | |||
| 1343 | 2908811497 | |||
| 1344 | 2919421026 | |||
| 1345 | 2919433216 | |||
| 1346 | 2919716983 | |||
| 1347 | 2922557229 | |||
| 1348 | 2928145069 | |||
| 1349 | 2929217500 | |||
| 1350 | 2932400450 | |||
| 1351 | 2939584758 | |||
| 1352 | 2939745818 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6c37-assembly1.cif.gz_A | mycobacterium smegmatis rimj in complex with coa-disulfide | 0.995 | 1 | 203 |
| 6c37-assembly1.cif.gz_A | mycobacterium smegmatis rimj in complex with coa-disulfide | 0.9902 | 1 | 203 |
| 1nsl-assembly1.cif.gz_B | crystal structure of probable acetyltransferase | 0.9278 | 13 | 186 |
| 3igr-assembly1.cif.gz_A | the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a | 0.9175 | 13 | 182 |
| 1s7k-assembly1.cif.gz_A-2 | riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo) | 0.9149 | 1 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05578_9_186_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9973 | 10 | 186 | 3.40.630.30 |
| af_O05578_9_186_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9862 | 10 | 186 | 3.40.630.30 |
| af_A0A0R0ECR9_59_131_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9685 | 115 | 184 | 3.40.630.30 |
| af_Q2G132_3_176_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9396 | 13 | 182 | 3.40.630.30 |
| af_P0A948_10_192_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9387 | 13 | 183 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G0HHD7-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9859 | 1 | 198 |
GO:0005737
GO:0008999 |
| AF-A0A4U3CE54-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9784 | 33 | 198 |
GO:0005737
GO:0008999 |
| AF-A0A7D6VDL9-F1-model_v4 | GNAT family N-acetyltransferase | 0.9632 | 1 | 203 |
GO:0005737
GO:0008999 GO:1990189 |
| AF-A0A7X2TRC5-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9625 | 13 | 182 |
GO:0005737
GO:0008999 |
| AF-A0A6L6AAW3-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9623 | 102 | 184 |
GO:0005737
GO:0008999 |