F474539

General Info

Members Datasets Scaffolds Average Seq Length
676 316 1352 207

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0048757|Ga0466967_0048757_1681_2346
Length 221
Sequence MATVMNLLTPRSQHPGWPVPVGPLRVPAGLVRLRPVRLRDAATWSRIRLADRAHLEPWEPSTDFDWEVRHAVSAWPSVCSGLRAEARKGRMLPYAIELDGQFAGQLTIGNVTHGALRSAWIGYWVASASTGGGVATAALALGLDHCFGPVMLHRVEATVRPENAASRAVLAKAGFREEGLLKRYLDVDGAWRDHLLVAITFEELNGSVTSALVRAGHASWV

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 2547132424 Nocardia nova SH22a Isolate Unclassified
290 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
291 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
292 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
293 2643221692 Nocardia sp. Root136 Isolate Unclassified
294 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
295 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
296 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
297 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
298 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
299 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
300 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
301 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
302 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
303 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
304 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
305 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
306 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
307 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
308 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
309 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
310 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
311 2922554459 Rhodococcus sp. 66b Isolate Unclassified
312 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
313 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
314 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
315 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
316 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.69
Nodule 0
Rhizoplane 11.09
Rhizosphere 72.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0048757 3300045976 Bacteria 3701
2 JGI24746J21847_1000249 3300001977 Bacteria 7535
3 JGI24737J22298_10038251 3300001990 Bacteria 1477
4 JGI24744J21845_10002207 3300002077 Bacteria 3956
5 JGI24744J21845_10016152 3300002077 Bacteria 1488
6 rootH2_10146445 3300003320 Bacteria 1509
7 rootL2_10160125 3300003322 Bacteria 1569
8 Ga0055540_1001795 3300003792 Bacteria 12207
9 Ga0055540_1009417 3300003792 Bacteria 3378
10 Ga0055540_1011152 3300003792 Bacteria 2926
11 Ga0070658_10607210 3300005327 Bacteria 948
12 Ga0070676_10010723 3300005328 Bacteria 4973
13 Ga0070683_100167466 3300005329 Bacteria 2085
14 Ga0070683_100219247 3300005329 Bacteria 1808
15 Ga0070683_100241042 3300005329 Bacteria 1720
16 Ga0070690_100151061 3300005330 Bacteria 1585
17 Ga0070670_100708862 3300005331 Bacteria 905
18 Ga0068869_100096412 3300005334 Bacteria 2232
19 Ga0070666_10179911 3300005335 Bacteria 1483
20 Ga0070666_10189511 3300005335 Bacteria 1445
21 Ga0070680_100239401 3300005336 Bacteria 1534
22 Ga0070682_100088168 3300005337 Bacteria 2025
23 Ga0068868_100040396 3300005338 Bacteria 3631
24 Ga0068868_100480219 3300005338 Bacteria 1085
25 Ga0070660_100188710 3300005339 Bacteria 1669
26 Ga0070689_100004126 3300005340 Bacteria 9782
27 Ga0070691_10038194 3300005341 Bacteria 2267
28 Ga0070691_10062532 3300005341 Bacteria 1793
29 Ga0070691_10274739 3300005341 Bacteria 912
30 Ga0070692_10078001 3300005345 Bacteria 1778
31 Ga0070668_100008191 3300005347 Bacteria 7762
32 Ga0070668_100061451 3300005347 Bacteria 2910
33 Ga0070668_100610737 3300005347 Bacteria 955
34 Ga0070669_100043553 3300005353 Bacteria 3269
35 Ga0070669_100076749 3300005353 Bacteria 2481
36 Ga0070675_100468309 3300005354 Bacteria 1132
37 Ga0070675_100679253 3300005354 Bacteria 937
38 Ga0070671_100012064 3300005355 Bacteria 6952
39 Ga0070671_100661155 3300005355 Bacteria 905
40 Ga0070674_100003905 3300005356 Bacteria 8442
41 Ga0070673_100063938 3300005364 Bacteria 2930
42 Ga0070659_100167850 3300005366 Bacteria 1796
43 Ga0070667_100000207 3300005367 Bacteria 69147
44 Ga0070667_100008191 3300005367 Bacteria 8664
45 Ga0070667_100045426 3300005367 Bacteria 3693
46 Ga0070667_100047120 3300005367 Bacteria 3627
47 Ga0070703_10021993 3300005406 Bacteria 1868
48 Ga0070709_10015484 3300005434 Bacteria 4340
49 Ga0070714_100251570 3300005435 Bacteria 1634
50 Ga0070714_100274286 3300005435 Bacteria 1565
51 Ga0070714_100471712 3300005435 Bacteria 1194
52 Ga0070714_101046158 3300005435 Bacteria 795
53 Ga0070713_100407450 3300005436 Bacteria 1271
54 Ga0070710_10002949 3300005437 Bacteria 8079
55 Ga0070710_10067081 3300005437 Bacteria 2058
56 Ga0070701_10009581 3300005438 Bacteria 4248
57 Ga0070701_10112075 3300005438 Bacteria 1525
58 Ga0070711_100008390 3300005439 Bacteria 6326
59 Ga0070711_100028157 3300005439 Bacteria 3694
60 Ga0070705_100130391 3300005440 Bacteria 1639
61 Ga0070663_100010779 3300005455 Bacteria 5706
62 Ga0070663_100142894 3300005455 Bacteria 1829
63 Ga0070678_100004244 3300005456 Bacteria 8098
64 Ga0070678_100307025 3300005456 Bacteria 1350
65 Ga0070662_100015171 3300005457 Bacteria 5155
66 Ga0070662_100107732 3300005457 Bacteria 2119
67 Ga0068867_100013125 3300005459 Bacteria 5865
68 Ga0070685_10007226 3300005466 Bacteria 5677
69 Ga0070679_100178923 3300005530 Bacteria 2093
70 Ga0070684_100314547 3300005535 Bacteria 1438
71 Ga0070684_100341054 3300005535 Bacteria 1378
72 Ga0068853_100009963 3300005539 Bacteria 7675
73 Ga0068853_100037295 3300005539 Bacteria 4136
74 Ga0068853_100476191 3300005539 Bacteria 1177
75 Ga0070672_100098550 3300005543 Bacteria 2367
76 Ga0070672_100354081 3300005543 Bacteria 1252
77 Ga0070686_100089807 3300005544 Bacteria 2053
78 Ga0070686_100269187 3300005544 Bacteria 1252
79 Ga0070695_100222085 3300005545 Bacteria 1361
80 Ga0070696_100059198 3300005546 Bacteria 2676
81 Ga0070693_100014322 3300005547 Bacteria 4061
82 Ga0070693_100263816 3300005547 Bacteria 1147
83 Ga0070665_100012212 3300005548 Bacteria 8658
84 Ga0070665_100166458 3300005548 Bacteria 2207
85 Ga0070665_100306262 3300005548 Bacteria 1592
86 Ga0070665_100801159 3300005548 Bacteria 955
87 Ga0070704_100030388 3300005549 Bacteria 3619
88 Ga0068854_100054668 3300005578 Bacteria 2872
89 Ga0070702_100022094 3300005615 Bacteria 3358
90 Ga0070702_100076639 3300005615 Bacteria 1990
91 Ga0070702_100408423 3300005615 Bacteria 973
92 Ga0068852_100056062 3300005616 Bacteria 3404
93 Ga0068859_100061979 3300005617 Bacteria 3769
94 Ga0068859_100097718 3300005617 Bacteria 2989
95 Ga0068859_100564112 3300005617 Bacteria 1233
96 Ga0068859_100822505 3300005617 Bacteria 1016
97 Ga0068864_100054331 3300005618 Bacteria 3457
98 Ga0068864_100177382 3300005618 Bacteria 1946
99 Ga0068866_10384840 3300005718 Bacteria 900
100 Ga0068861_100017161 3300005719 Bacteria 5133
101 Ga0068861_100136918 3300005719 Bacteria 1994
102 Ga0068861_100210179 3300005719 Bacteria 1639
103 Ga0068870_10009240 3300005840 Bacteria 4475
104 Ga0068863_100008676 3300005841 Bacteria 9932
105 Ga0068863_100217975 3300005841 Bacteria 1838
106 Ga0068863_100948513 3300005841 Bacteria 862
107 Ga0068858_100012734 3300005842 Bacteria 7925
108 Ga0068858_100179477 3300005842 Bacteria 1998
109 Ga0068858_100362660 3300005842 Bacteria 1389
110 Ga0068860_100012921 3300005843 Bacteria 8202
111 Ga0068862_100024124 3300005844 Bacteria 5101
112 Ga0068862_100480084 3300005844 Bacteria 1176
113 Ga0081455_10047330 3300005937 Bacteria 3726
114 Ga0075365_10006497 3300006038 Bacteria 6438
115 Ga0075365_10033249 3300006038 Bacteria 3321
116 Ga0075365_10049016 3300006038 Bacteria 2781
117 Ga0075365_10050995 3300006038 Bacteria 2732
118 Ga0075365_10159998 3300006038 Bacteria 1569
119 Ga0075365_10179955 3300006038 Bacteria 1478
120 Ga0075368_10023140 3300006042 Bacteria 2370
121 Ga0075363_100000752 3300006048 Bacteria 11078
122 Ga0075363_100064429 3300006048 Bacteria 1980
123 Ga0075363_100072411 3300006048 Bacteria 1874
124 Ga0075364_10001726 3300006051 Bacteria 12028
125 Ga0075364_10026141 3300006051 Bacteria 3721
126 Ga0075364_10042128 3300006051 Bacteria 2966
127 Ga0075364_10085326 3300006051 Bacteria 2091
128 Ga0075364_10214141 3300006051 Bacteria 1307
129 Ga0070715_10253668 3300006163 Bacteria 920
130 Ga0070716_100012068 3300006173 Bacteria 4367
131 Ga0070716_100099726 3300006173 Bacteria 1778
132 Ga0070712_100005319 3300006175 Bacteria 7968
133 Ga0070712_100041669 3300006175 Bacteria 3153
134 Ga0070712_100217057 3300006175 Bacteria 1512
135 Ga0075362_10021887 3300006177 Bacteria 2688
136 Ga0075362_10024279 3300006177 Bacteria 2571
137 Ga0075367_10037673 3300006178 Bacteria 2811
138 Ga0075367_10204958 3300006178 Bacteria 1232
139 Ga0075367_10367867 3300006178 Bacteria 908
140 Ga0075369_10003028 3300006186 Bacteria 6076
141 Ga0075369_10004827 3300006186 Bacteria 5015
142 Ga0075369_10046042 3300006186 Bacteria 1877
143 Ga0075369_10070799 3300006186 Bacteria 1535
144 Ga0075369_10092927 3300006186 Bacteria 1348
145 Ga0075369_10132862 3300006186 Bacteria 1132
146 Ga0075369_10181604 3300006186 Bacteria 968
147 Ga0075369_10271215 3300006186 Bacteria 789
148 Ga0075366_10046485 3300006195 Bacteria 2572
149 Ga0075370_10000341 3300006353 Bacteria 16842
150 Ga0075370_10033558 3300006353 Bacteria 2874
151 Ga0075370_10068216 3300006353 Bacteria 2031
152 Ga0075370_10080177 3300006353 Bacteria 1875
153 Ga0075370_10134468 3300006353 Bacteria 1444
154 Ga0068871_100324065 3300006358 Bacteria 1357
155 Ga0075428_100007312 3300006844 Bacteria 12235
156 Ga0075430_100058874 3300006846 Bacteria 3229
157 Ga0075430_100203186 3300006846 Bacteria 1645
158 Ga0068865_100003973 3300006881 Bacteria 8874
159 Ga0068865_100355231 3300006881 Bacteria 1188
160 Ga0075436_100562509 3300006914 Bacteria 838
161 Ga0097620_100061977 3300006931 Bacteria 3769
162 Ga0097620_100097721 3300006931 Bacteria 2989
163 Ga0097620_100564065 3300006931 Bacteria 1233
164 Ga0097620_100822498 3300006931 Bacteria 1016
165 Ga0099795_10014471 3300007788 Bacteria 2447
166 Ga0105250_10098049 3300009092 Bacteria 1195
167 Ga0105250_10126503 3300009092 Bacteria 1053
168 Ga0105245_10011752 3300009098 Bacteria 7617
169 Ga0105245_10437888 3300009098 Bacteria 1313
170 Ga0105245_10727364 3300009098 Bacteria 1027
171 Ga0105247_10213411 3300009101 Bacteria 1303
172 Ga0105247_10381803 3300009101 Bacteria 999
173 Ga0114129_10018369 3300009147 Bacteria 9960
174 Ga0105243_10004112 3300009148 Bacteria 11567
175 Ga0105243_10091180 3300009148 Bacteria 2509
176 Ga0105243_10622929 3300009148 Bacteria 1042
177 Ga0105241_10084060 3300009174 Bacteria 2498
178 Ga0105241_10719454 3300009174 Bacteria 913
179 Ga0105242_10007699 3300009176 Bacteria 8289
180 Ga0105242_10213964 3300009176 Bacteria 1719
181 Ga0105248_10014903 3300009177 Bacteria 8560
182 Ga0105248_10016636 3300009177 Bacteria 8095
183 Ga0105237_10115171 3300009545 Bacteria 2681
184 Ga0105237_10382390 3300009545 Bacteria 1413
185 Ga0105237_10530859 3300009545 Bacteria 1183
186 Ga0105238_10356790 3300009551 Bacteria 1451
187 Ga0105238_10539435 3300009551 Bacteria 1170
188 Ga0105238_10655490 3300009551 Bacteria 1060
189 Ga0105249_10162835 3300009553 Bacteria 2157
190 Ga0105249_10304708 3300009553 Bacteria 1599
191 Ga0105249_10321414 3300009553 Bacteria 1559
192 Ga0157369_10247069 3300013105 Bacteria 1863
193 Ga0157374_10048291 3300013296 Bacteria 3949
194 Ga0157374_10441970 3300013296 Bacteria 1301
195 Ga0157378_10009418 3300013297 Bacteria 8509
196 Ga0157378_10263176 3300013297 Bacteria 1656
197 Ga0157378_10789661 3300013297 Bacteria 975
198 Ga0163162_10036034 3300013306 Bacteria 4929
199 Ga0163162_10180314 3300013306 Bacteria 2238
200 Ga0157375_10084168 3300013308 Bacteria 3228
201 Ga0163163_10017194 3300014325 Bacteria 6740
202 Ga0163163_10256273 3300014325 Bacteria 1800
203 Ga0163163_10670829 3300014325 Bacteria 1100
204 Ga0157380_10038541 3300014326 Bacteria 3712
205 Ga0157377_10003584 3300014745 Bacteria 7028
206 Ga0157379_10015516 3300014968 Bacteria 6686
207 Ga0157379_10163347 3300014968 Bacteria 2010
208 Ga0157376_10763132 3300014969 Bacteria 977
209 Ga0163161_10062208 3300017792 Bacteria 2719
210 Ga0163161_10070186 3300017792 Bacteria 2561
211 Ga0163161_10086070 3300017792 Bacteria 2320
212 Ga0213876_10016537 3300021384 Bacteria 3899
213 Ga0213875_10013950 3300021388 Bacteria 3930
214 Ga0209051_1004009 3300025303 Bacteria 9330
215 Ga0209051_1012702 3300025303 Bacteria 4057
216 Ga0209051_1014796 3300025303 Bacteria 3623
217 Ga0209051_1033969 3300025303 Bacteria 1919
218 Ga0207696_1067118 3300025711 Bacteria 1001
219 Ga0207653_10075585 3300025885 Bacteria 1158
220 Ga0207642_10010536 3300025899 Bacteria 3264
221 Ga0207710_10025602 3300025900 Bacteria 2546
222 Ga0207710_10197496 3300025900 Bacteria 992
223 Ga0207688_10003584 3300025901 Bacteria 8476
224 Ga0207688_10008767 3300025901 Bacteria 5503
225 Ga0207647_10083676 3300025904 Bacteria 1910
226 Ga0207699_10007946 3300025906 Bacteria 5206
227 Ga0207705_10268766 3300025909 Bacteria 1304
228 Ga0207671_10045140 3300025914 Bacteria 3258
229 Ga0207671_10151767 3300025914 Bacteria 1790
230 Ga0207671_10235919 3300025914 Bacteria 1436
231 Ga0207693_10009413 3300025915 Bacteria 7968
232 Ga0207693_10069987 3300025915 Bacteria 2746
233 Ga0207663_10036716 3300025916 Bacteria 2949
234 Ga0207663_10500122 3300025916 Bacteria 944
235 Ga0207657_10171176 3300025919 Bacteria 1759
236 Ga0207681_10353286 3300025923 Bacteria 1177
237 Ga0207694_10508085 3300025924 Bacteria 1009
238 Ga0207659_10358568 3300025926 Bacteria 1211
239 Ga0207687_10009671 3300025927 Bacteria 6306
240 Ga0207687_10287753 3300025927 Bacteria 1320
241 Ga0207700_10420688 3300025928 Bacteria 1174
242 Ga0207664_10103874 3300025929 Bacteria 2352
243 Ga0207664_10151344 3300025929 Bacteria 1971
244 Ga0207664_10405475 3300025929 Bacteria 1213
245 Ga0207664_10418065 3300025929 Bacteria 1194
246 Ga0207644_10020036 3300025931 Bacteria 4543
247 Ga0207644_10514456 3300025931 Bacteria 988
248 Ga0207690_10153844 3300025932 Bacteria 1707
249 Ga0207706_10018529 3300025933 Bacteria 6263
250 Ga0207706_10318744 3300025933 Bacteria 1353
251 Ga0207686_10114754 3300025934 Bacteria 1823
252 Ga0207709_10004934 3300025935 Bacteria 7636
253 Ga0207709_10005610 3300025935 Bacteria 7096
254 Ga0207709_10136439 3300025935 Bacteria 1680
255 Ga0207670_10066091 3300025936 Bacteria 2483
256 Ga0207669_10006346 3300025937 Bacteria 5395
257 Ga0207669_10064784 3300025937 Bacteria 2263
258 Ga0207704_10005939 3300025938 Bacteria 5658
259 Ga0207704_10278385 3300025938 Bacteria 1270
260 Ga0207665_10015671 3300025939 Bacteria 4975
261 Ga0207665_10044280 3300025939 Bacteria 2978
262 Ga0207691_10102466 3300025940 Bacteria 2553
263 Ga0207691_10627063 3300025940 Bacteria 909
264 Ga0207711_10021885 3300025941 Bacteria 5341
265 Ga0207689_10110945 3300025942 Bacteria 2254
266 Ga0207661_10229991 3300025944 Bacteria 1642
267 Ga0207667_10155041 3300025949 Bacteria 2357
268 Ga0207667_10238937 3300025949 Bacteria 1859
269 Ga0207712_10009714 3300025961 Bacteria 6098
270 Ga0207668_10000526 3300025972 Bacteria 24008
271 Ga0207668_10009108 3300025972 Bacteria 5934
272 Ga0207658_10018649 3300025986 Bacteria 4796
273 Ga0207658_10069945 3300025986 Bacteria 2654
274 Ga0207658_10215988 3300025986 Bacteria 1610
275 Ga0207703_10009089 3300026035 Bacteria 7823
276 Ga0207703_10059867 3300026035 Bacteria 3112
277 Ga0207703_10506386 3300026035 Bacteria 1134
278 Ga0207703_10719974 3300026035 Bacteria 950
279 Ga0207639_10028496 3300026041 Bacteria 4078
280 Ga0207639_10045475 3300026041 Bacteria 3306
281 Ga0207678_10005752 3300026067 Bacteria 11060
282 Ga0207678_10016047 3300026067 Bacteria 6578
283 Ga0207678_10018037 3300026067 Bacteria 6201
284 Ga0207708_10065683 3300026075 Bacteria 2774
285 Ga0207702_10067164 3300026078 Bacteria 3077
286 Ga0207641_10003476 3300026088 Bacteria 13956
287 Ga0207641_10063120 3300026088 Bacteria 3164
288 Ga0207648_10010554 3300026089 Bacteria 8742
289 Ga0207648_10209207 3300026089 Bacteria 1731
290 Ga0207676_10479195 3300026095 Bacteria 1178
291 Ga0207676_10920883 3300026095 Bacteria 858
292 Ga0207675_100012618 3300026118 Bacteria 7894
293 Ga0207675_100116178 3300026118 Bacteria 2529
294 Ga0207675_100403263 3300026118 Bacteria 1348
295 Ga0207675_100457508 3300026118 Bacteria 1265
296 Ga0207683_10011339 3300026121 Bacteria 7605
297 Ga0207683_10097174 3300026121 Bacteria 2626
298 Ga0207698_10288110 3300026142 Bacteria 1522
299 Ga0207698_11020449 3300026142 Bacteria 838
300 Ga0209179_1025803 3300027512 Bacteria 1174
301 Ga0268266_10013715 3300028379 Bacteria 6979
302 Ga0268266_10069761 3300028379 Bacteria 3046
303 Ga0268266_10092239 3300028379 Bacteria 2657
304 Ga0268266_10605161 3300028379 Bacteria 1053
305 Ga0268265_10067910 3300028380 Bacteria 2762
306 Ga0268264_10059530 3300028381 Bacteria 3200
307 Ga0268264_10247271 3300028381 Bacteria 1655
308 Ga0265327_10000018 3300031251 Bacteria 439197
309 Ga0265327_10001055 3300031251 Bacteria 38529
310 Ga0265327_10012159 3300031251 Bacteria 5840
311 Ga0307408_100079665 3300031548 Bacteria 2445
312 Ga0307408_100113899 3300031548 Bacteria 2082
313 Ga0307405_10034901 3300031731 Bacteria 2998
314 Ga0307405_10225861 3300031731 Bacteria 1377
315 Ga0307405_10292107 3300031731 Bacteria 1232
316 Ga0307405_10486831 3300031731 Bacteria 986
317 Ga0307413_10045379 3300031824 Bacteria 2605
318 Ga0307413_10159572 3300031824 Bacteria 1582
319 Ga0307410_10027563 3300031852 Bacteria 3592
320 Ga0307410_10030483 3300031852 Bacteria 3448
321 Ga0307410_10035295 3300031852 Bacteria 3246
322 Ga0307410_10161485 3300031852 Bacteria 1679
323 Ga0307410_10252391 3300031852 Bacteria 1372
324 Ga0307410_10290186 3300031852 Bacteria 1287
325 Ga0307410_10382653 3300031852 Bacteria 1132
326 Ga0307410_10520573 3300031852 Bacteria 981
327 Ga0307410_11075128 3300031852 Bacteria 696
328 Ga0307406_10083322 3300031901 Bacteria 2132
329 Ga0307406_10094734 3300031901 Bacteria 2019
330 Ga0307406_10200135 3300031901 Bacteria 1469
331 Ga0307406_10525545 3300031901 Bacteria 964
332 Ga0307406_11102180 3300031901 Bacteria 685
333 Ga0307407_10265598 3300031903 Bacteria 1182
334 Ga0307407_10482602 3300031903 Bacteria 905
335 Ga0307407_10509218 3300031903 Bacteria 884
336 Ga0307412_10064726 3300031911 Bacteria 2471
337 Ga0307412_10161283 3300031911 Bacteria 1666
338 Ga0307412_10191651 3300031911 Bacteria 1546
339 Ga0307409_100049766 3300031995 Bacteria 3197
340 Ga0307409_100074821 3300031995 Bacteria 2708
341 Ga0307409_100114532 3300031995 Bacteria 2268
342 Ga0307409_100121219 3300031995 Bacteria 2215
343 Ga0307409_100168247 3300031995 Bacteria 1926
344 Ga0307409_100182036 3300031995 Bacteria 1861
345 Ga0307409_100336892 3300031995 Bacteria 1418
346 Ga0307409_100345788 3300031995 Bacteria 1401
347 Ga0307409_100479588 3300031995 Bacteria 1206
348 Ga0307409_100898232 3300031995 Bacteria 899
349 Ga0307416_100070336 3300032002 Bacteria 2901
350 Ga0307416_100100337 3300032002 Bacteria 2517
351 Ga0307416_100152629 3300032002 Bacteria 2121
352 Ga0307416_100292024 3300032002 Bacteria 1614
353 Ga0307416_100562654 3300032002 Bacteria 1215
354 Ga0307416_101576004 3300032002 Bacteria 762
355 Ga0307416_101778903 3300032002 Bacteria 720
356 Ga0307414_10069910 3300032004 Bacteria 2526
357 Ga0307414_10169616 3300032004 Bacteria 1743
358 Ga0307414_10211218 3300032004 Bacteria 1586
359 Ga0307414_10231482 3300032004 Bacteria 1524
360 Ga0307414_10468208 3300032004 Bacteria 1109
361 Ga0307414_10617807 3300032004 Bacteria 974
362 Ga0307411_10036755 3300032005 Bacteria 3072
363 Ga0307411_10049088 3300032005 Bacteria 2740
364 Ga0307411_10103015 3300032005 Bacteria 2024
365 Ga0307411_10133597 3300032005 Bacteria 1818
366 Ga0307411_10314709 3300032005 Bacteria 1261
367 Ga0307415_100051496 3300032126 Bacteria 2794
368 Ga0307415_100113811 3300032126 Bacteria 2013
369 Ga0307415_100297193 3300032126 Bacteria 1336
370 Ga0307415_100308246 3300032126 Bacteria 1315
371 Ga0307415_100376709 3300032126 Bacteria 1203
372 Ga0307415_100381204 3300032126 Bacteria 1197
373 Ga0307415_100504186 3300032126 Bacteria 1059
374 Ga0307415_100642380 3300032126 Bacteria 950
375 Ga0307415_101105670 3300032126 Bacteria 742
376 Ga0373932_0203610 3300035112 Bacteria 705
377 Ga0373943_0054214 3300035170 Bacteria 1983
378 Ga0373931_0046329 3300035691 Bacteria 2298
379 Ga0316584_0233041 3300036712 Bacteria 1349
380 Ga0395899_0358439 3300037312 Bacteria 974
381 Ga0395900_0060881 3300037418 Bacteria 3883
382 Ga0395898_0011113 3300037466 Bacteria 9372
383 Ga0436364_0815483 3300037853 Bacteria 10253
384 Ga0436364_1009898 3300037853 Bacteria 3993
385 Ga0395901_0007866 3300038443 Bacteria 10751
386 Ga0395901_0685346 3300038443 Bacteria 1024
387 Ga0436365_1064965 3300039437 Bacteria 9165
388 Ga0436365_1630628 3300039437 Bacteria 72743
389 Ga0436363_1156190 3300039450 Bacteria 5094
390 Ga0439466_0041890 3300041411 Bacteria 1526
391 Ga0439466_0054626 3300041411 Bacteria 1300
392 Ga0439466_0107995 3300041411 Bacteria 864
393 Ga0439465_0014461 3300041413 Bacteria 2459
394 Ga0439465_0071915 3300041413 Bacteria 1160
395 Ga0451802_1930661 3300041460 Bacteria 627
396 Ga0451806_754557 3300041462 Bacteria 1284
397 Ga0451841_1132979 3300041498 Bacteria 1091
398 Ga0439442_004527 3300042002 Bacteria 2761
399 Ga0439445_0016618 3300042004 Bacteria 1812
400 Ga0439434_0007518 3300042435 Bacteria 3193
401 Ga0439460_0093333 3300042461 Bacteria 959
402 Ga0466969_0162829 3300044656 Bacteria 1025
403 Ga0466969_0190549 3300044656 Bacteria 937
404 Ga0466972_0005077 3300044658 Bacteria 6595
405 Ga0466972_0080684 3300044658 Bacteria 1549
406 Ga0466972_0436576 3300044658 Bacteria 615
407 Ga0466965_0003274 3300044683 Bacteria 7085
408 Ga0466966_0102580 3300044684 Bacteria 1768
409 Ga0466966_0187352 3300044684 Bacteria 1254
410 Ga0466966_0302036 3300044684 Bacteria 962
411 Ga0466966_0342842 3300044684 Bacteria 898
412 Ga0466961_0102915 3300044693 Bacteria 1798
413 Ga0466961_0121933 3300044693 Bacteria 1636
414 Ga0466963_0051985 3300044694 Bacteria 2717
415 Ga0466963_0077109 3300044694 Bacteria 2251
416 Ga0466963_0152553 3300044694 Bacteria 1605
417 Ga0466963_0805105 3300044694 Bacteria 663
418 Ga0466971_0009094 3300044719 Bacteria 4342
419 Ga0466971_0106889 3300044719 Bacteria 1289
420 Ga0466968_0007618 3300044735 Bacteria 4122
421 Ga0466968_0175590 3300044735 Bacteria 994
422 Ga0466968_0226600 3300044735 Bacteria 882
423 Ga0466970_0003951 3300044765 Bacteria 7267
424 Ga0466970_0032862 3300044765 Bacteria 2742
425 Ga0466970_0040508 3300044765 Bacteria 2474
426 Ga0466970_0055238 3300044765 Bacteria 2121
427 Ga0466970_0382177 3300044765 Bacteria 802
428 Ga0466970_0405379 3300044765 Bacteria 778
429 Ga0466957_0022676 3300044842 Bacteria 3705
430 Ga0466957_0034944 3300044842 Bacteria 3015
431 Ga0466957_0086013 3300044842 Bacteria 1964
432 Ga0466957_0091350 3300044842 Bacteria 1908
433 Ga0466957_0160496 3300044842 Bacteria 1460
434 Ga0466957_0171224 3300044842 Bacteria 1414
435 Ga0466957_0445666 3300044842 Bacteria 891
436 Ga0466960_0000265 3300044901 Bacteria 18060
437 Ga0466960_0006050 3300044901 Bacteria 4834
438 Ga0466960_0018707 3300044901 Bacteria 3041
439 Ga0466960_0022165 3300044901 Bacteria 2836
440 Ga0466960_0038680 3300044901 Bacteria 2245
441 Ga0466960_0053050 3300044901 Bacteria 1964
442 Ga0466960_0253385 3300044901 Bacteria 978
443 Ga0466960_0396245 3300044901 Bacteria 794
444 Ga0466959_0054959 3300045049 Bacteria 2908
445 Ga0466959_0093606 3300045049 Bacteria 2156
446 Ga0466959_0139325 3300045049 Bacteria 1715
447 Ga0466959_0174485 3300045049 Bacteria 1507
448 Ga0466959_0242173 3300045049 Bacteria 1245
449 Ga0466959_0419627 3300045049 Bacteria 908
450 Ga0466959_0568260 3300045049 Bacteria 764
451 Ga0466958_0040833 3300045836 Bacteria 2789
452 Ga0466958_0110327 3300045836 Bacteria 1717
453 Ga0466958_0142499 3300045836 Bacteria 1509
454 Ga0466958_0179823 3300045836 Bacteria 1342
455 Ga0466958_0194556 3300045836 Bacteria 1289
456 Ga0466958_0285821 3300045836 Bacteria 1057
457 Ga0466958_0312897 3300045836 Bacteria 1009
458 Ga0466958_0328469 3300045836 Bacteria 983
459 Ga0466958_0467917 3300045836 Bacteria 817
460 Ga0466967_0011184 3300045976 Bacteria 6782
461 Ga0466967_0024884 3300045976 Bacteria 4929
462 Ga0466967_0029991 3300045976 Bacteria 4559
463 Ga0466967_0032663 3300045976 Bacteria 4397
464 Ga0466967_0060463 3300045976 Bacteria 3357
465 Ga0466967_0063212 3300045976 Bacteria 3288
466 Ga0466967_0192506 3300045976 Bacteria 1928
467 Ga0466967_0369529 3300045976 Bacteria 1391
468 Ga0466967_0395429 3300045976 Bacteria 1344
469 Ga0466967_0611173 3300045976 Bacteria 1076
470 Ga0466967_0939101 3300045976 Bacteria 861
471 Ga0495603_0211809 3300046455 Bacteria 1119
472 Ga0495629_0030982 3300046459 Bacteria 3789
473 Ga0495638_0001570 3300046460 Bacteria 20486
474 Ga0495641_0032769 3300046461 Bacteria 2471
475 Ga0495582_0162613 3300046473 Bacteria 1270
476 Ga0495639_0068454 3300046475 Bacteria 1637
477 Ga0495607_0022173 3300046501 Bacteria 3993
478 Ga0495618_0251761 3300046514 Bacteria 1108
479 Ga0495648_0004296 3300046524 Bacteria 12210
480 Ga0495663_0034452 3300046525 Bacteria 1516
481 Ga0495654_0109509 3300046530 Bacteria 1262
482 Ga0495640_0096179 3300046533 Bacteria 1949
483 Ga0495668_0001186 3300046616 Bacteria 26476
484 Ga0495668_0305887 3300046616 Bacteria 872
485 Ga0495611_0054672 3300046648 Bacteria 1805
486 Ga0495658_0317500 3300046683 Bacteria 987
487 Ga0495624_0427289 3300046690 Bacteria 794
488 Ga0495671_0117006 3300046692 Bacteria 1301
489 Ga0495581_0020291 3300047315 Bacteria 3858
490 Ga0495674_0073343 3300047319 Bacteria 2951
491 Ga0495672_0010022 3300047320 Bacteria 6793
492 Ga0495672_0094110 3300047320 Bacteria 1639
493 Ga0495683_0002024 3300047323 Bacteria 12559
494 Ga0495685_097122 3300047447 Bacteria 974
495 Ga0495673_0002913 3300047469 Bacteria 11603
496 Ga0495686_0038965 3300047472 Bacteria 3038
497 Ga0495593_0044410 3300047673 Bacteria 2377
498 Ga0496100_0004691 3300048903 Bacteria 7284
499 Ga0496100_0099020 3300048903 Bacteria 2005
500 Ga0496100_0119906 3300048903 Bacteria 1839
501 Ga0496100_0716930 3300048903 Bacteria 781
502 Ga0496100_0846532 3300048903 Bacteria 717
503 Ga0496101_0000963 3300048904 Bacteria 16982
504 Ga0496101_0006448 3300048904 Bacteria 7549
505 Ga0496102_0011113 3300048905 Bacteria 7755
506 Ga0496102_0070431 3300048905 Bacteria 3211
507 Ga0496102_0086508 3300048905 Bacteria 2895
508 Ga0496102_0134456 3300048905 Bacteria 2316
509 Ga0496102_0226822 3300048905 Bacteria 1761
510 Ga0496102_0294592 3300048905 Bacteria 1529
511 Ga0496102_0322256 3300048905 Bacteria 1456
512 Ga0496102_1057105 3300048905 Bacteria 732
513 Ga0496103_0004904 3300048906 Bacteria 8079
514 Ga0496103_0043706 3300048906 Bacteria 2759
515 Ga0496103_0086625 3300048906 Bacteria 1974
516 Ga0496103_0098600 3300048906 Bacteria 1848
517 Ga0496103_0243217 3300048906 Bacteria 1158
518 Ga0496104_0028128 3300048907 Bacteria 5209
519 Ga0496104_0149634 3300048907 Bacteria 2241
520 Ga0496104_0293892 3300048907 Bacteria 1537
521 Ga0496104_0491873 3300048907 Bacteria 1138
522 Ga0496105_0010203 3300048908 Bacteria 7382
523 Ga0496105_0110807 3300048908 Bacteria 2266
524 Ga0496105_0116794 3300048908 Bacteria 2201
525 Ga0496105_0281009 3300048908 Bacteria 1342
526 Ga0496106_0020218 3300048909 Bacteria 4939
527 Ga0496106_0049074 3300048909 Bacteria 3179
528 Ga0496106_0083781 3300048909 Bacteria 2452
529 Ga0496107_0007986 3300048910 Bacteria 7304
530 Ga0496107_0039156 3300048910 Bacteria 3400
531 Ga0496107_0069752 3300048910 Bacteria 2552
532 Ga0496107_0070780 3300048910 Bacteria 2533
533 Ga0496107_0444963 3300048910 Bacteria 963
534 Ga0496108_0002078 3300048911 Bacteria 16016
535 Ga0496108_0073213 3300048911 Bacteria 2893
536 Ga0496108_0142949 3300048911 Bacteria 2062
537 Ga0496108_0175706 3300048911 Bacteria 1854
538 Ga0496108_0223466 3300048911 Bacteria 1636
539 Ga0496108_0235450 3300048911 Bacteria 1592
540 Ga0496108_0461773 3300048911 Bacteria 1109
541 Ga0496109_0011117 3300048912 Bacteria 7720
542 Ga0496109_0028832 3300048912 Bacteria 4969
543 Ga0496109_0032560 3300048912 Bacteria 4686
544 Ga0496109_0061059 3300048912 Bacteria 3445
545 Ga0496109_0662556 3300048912 Bacteria 981
546 Ga0496110_0018791 3300048913 Bacteria 5803
547 Ga0496110_0119208 3300048913 Bacteria 2377
548 Ga0496110_0150376 3300048913 Bacteria 2108
549 Ga0496110_0376783 3300048913 Bacteria 1293
550 Ga0496110_0540933 3300048913 Bacteria 1059
551 Ga0496110_1064488 3300048913 Bacteria 717
552 Ga0496111_0054531 3300048914 Bacteria 2890
553 Ga0496112_0005618 3300048915 Bacteria 10878
554 Ga0496112_0032517 3300048915 Bacteria 5066
555 Ga0496112_0058532 3300048915 Bacteria 3795
556 Ga0496112_0141790 3300048915 Bacteria 2372
557 Ga0496112_0150836 3300048915 Bacteria 2292
558 Ga0496112_1091487 3300048915 Bacteria 716
559 Ga0496113_0082838 3300048916 Bacteria 2461
560 Ga0496113_0096089 3300048916 Bacteria 2290
561 Ga0496113_0387891 3300048916 Bacteria 1121
562 Ga0496113_0390993 3300048916 Bacteria 1116
563 Ga0496113_0414029 3300048916 Bacteria 1082
564 Ga0496114_0011079 3300048917 Bacteria 7196
565 Ga0496114_0024447 3300048917 Bacteria 4932
566 Ga0496114_0326492 3300048917 Bacteria 1356
567 Ga0496114_1226494 3300048917 Bacteria 636
568 Ga0496115_0007857 3300048918 Bacteria 7866
569 Ga0496115_0025818 3300048918 Bacteria 4578
570 Ga0496115_0361526 3300048918 Bacteria 1183
571 Ga0496118_0000730 3300048921 Bacteria 53095
572 Ga0496118_0282549 3300048921 Bacteria 923
573 Ga0496120_0168771 3300048923 Bacteria 1084
574 Ga0496122_0003041 3300048925 Bacteria 22684
575 Ga0496122_0140757 3300048925 Bacteria 1510
576 Ga0496123_0002126 3300048926 Bacteria 25354
577 Ga0496126_0018195 3300048929 Bacteria 6972
578 Ga0496126_0282728 3300048929 Bacteria 1374
579 Ga0501032_0014425 3300049569 Bacteria 5597
580 Ga0501032_0056002 3300049569 Bacteria 2651
581 Ga0501033_0108369 3300049570 Bacteria 2023
582 Ga0501034_0035636 3300049571 Bacteria 5044
583 Ga0501036_0001863 3300049572 Bacteria 16348
584 Ga0501037_0004680 3300049573 Bacteria 9943
585 Ga0501037_0104482 3300049573 Bacteria 2042
586 Ga0501038_0002617 3300049574 Bacteria 16826
587 Ga0501039_0000771 3300049575 Bacteria 23004
588 Ga0501040_0124171 3300049576 Bacteria 1812
589 Ga0501043_0000790 3300049579 Bacteria 28168
590 Ga0501043_0074624 3300049579 Bacteria 2664
591 Ga0501043_0751641 3300049579 Bacteria 709
592 Ga0501046_0000382 3300049580 Bacteria 44315
593 Ga0501047_0002654 3300049581 Bacteria 17016
594 Ga0501048_0073165 3300049582 Bacteria 2419
595 Ga0501067_0045878 3300049583 Bacteria 2426
596 Ga0501069_0144743 3300049585 Bacteria 1364
597 Ga0501070_0008026 3300049586 Bacteria 8939
598 Ga0501070_0008775 3300049586 Bacteria 8547
599 Ga0501070_0088482 3300049586 Bacteria 2563
600 Ga0501071_0282176 3300049587 Bacteria 1257
601 Ga0501080_0117808 3300049742 Bacteria 2462
602 Ga0501035_0007912 3300049822 Bacteria 9926
603 Ga0501044_0002938 3300049823 Bacteria 19390
604 nmdc:mga03683_114047_c1 3300050489 Bacteria 1197
605 nmdc:mga03683_17280_c1 3300050489 Bacteria 2728
606 nmdc:mga03683_25184_c1 3300050489 Bacteria 2334
607 nmdc:mga03683_31353_c1 3300050489 Bacteria 2132
608 nmdc:mga03n38_107191_c1 3300050490 Bacteria 1356
609 nmdc:mga03n38_431516_c1 3300050490 Bacteria 730
610 nmdc:mga03n38_48527_c1 3300050490 Bacteria 1884
611 nmdc:mga03n38_613084_c1 3300050490 Bacteria 621
612 nmdc:mga03n38_65217_c1 3300050490 Bacteria 1669
613 nmdc:mga03n38_9908_c1 3300050490 Bacteria 3485
614 nmdc:mga00v17_10325_c1 3300050491 Bacteria 3679
615 nmdc:mga00v17_1611_c1 3300050491 Bacteria 11784
616 nmdc:mga00v17_227940_c1 3300050491 Bacteria 1207
617 nmdc:mga00v17_269044_c1 3300050491 Bacteria 1106
618 nmdc:mga00v17_91095_c1 3300050491 Bacteria 1915
619 nmdc:mga00v17_94471_c1 3300050491 Bacteria 1881
620 nmdc:mga0yw44_14561_c1 3300050492 Bacteria 4180
621 nmdc:mga0yw44_176334_c1 3300050492 Bacteria 1405
622 nmdc:mga0yw44_46969_c1 3300050492 Bacteria 2596
623 nmdc:mga0yw44_77644_c1 3300050492 Bacteria 2075
624 nmdc:mga06z11_11649_c1 3300050494 Bacteria 3800
625 nmdc:mga06z11_376728_c1 3300050494 Bacteria 852
626 nmdc:mga04h51_1888_c1 3300050495 Bacteria 3567
627 nmdc:mga07m45_1189_c1 3300050496 Bacteria 11749
628 nmdc:mga07m45_161182_c1 3300050496 Bacteria 1302
629 nmdc:mga07m45_16453_c1 3300050496 Bacteria 2891
630 nmdc:mga07m45_37616_c1 3300050496 Bacteria 2699
631 nmdc:mga0qj67_87209_c1 3300050509 Bacteria 2504
632 nmdc:mga08y16_674320_c1 3300050511 Bacteria 1036
633 nmdc:mga0sz30_18360_c2 3300050516 Bacteria 2206
634 nmdc:mga0sz30_211790_c1 3300050516 Bacteria 861
635 nmdc:mga0sz30_49626_c1 3300050516 Bacteria 1778
636 nmdc:mga0sz30_654_c2 3300050516 Bacteria 10386
637 nmdc:mga0sz30_716_c1 3300050516 Bacteria 12200
638 Ga0495655_0011622 3300053083 Bacteria 1774
639 Ga0495619_0495635 3300053085 Bacteria 840
640 Ga0500643_001666 3300053087 Bacteria 12380
641 Ga0500641_0051007 3300053096 Bacteria 1702
642 Ga0500652_000149 3300053131 Bacteria 26512
643 Ga0500616_0003317 3300053153 Bacteria 12408
644 Ga0500616_0009322 3300053153 Bacteria 5979
645 Ga0500620_131167 3300053155 Bacteria 877
646 Ga0466962_0004482 3300061719 Bacteria 6693
647 Ga0466962_0009524 3300061719 Bacteria 4658
648 Ga0466962_0232267 3300061719 Bacteria 904
649 2548699026 2547132424 Bacteria 8348532
650 2552110699 2551306166 Bacteria 9731570
651 2566992133 2565956761 Bacteria 6601618
652 2644490601 2643221687 Bacteria 6500351
653 2644513926 2643221692 Bacteria 7282860
654 2644636998 2643221715 Bacteria 6671032
655 2739204182 2738543005 Bacteria 5278128
656 2739238171 2738543011 Bacteria 5731169
657 2739364820 2738543034 Bacteria 6084756
658 2753037782 2751185725 Bacteria 5740550
659 2753325650 2751185792 Bacteria 5739090
660 2889303293 2889300758 Bacteria 5690814
661 2902800516 2902799365 Bacteria 5419524
662 2902814849 2902810491 Bacteria 6794147
663 2902843245 2902837492 Bacteria 6697721
664 2904538045 2904535858 Bacteria 6308016
665 2904766538 2904765812 Bacteria 5369154
666 2904772706 2904770941 Bacteria 5580202
667 2908811497 2908811453 Bacteria 5478616
668 2919421026 2919420072 Bacteria 5390363
669 2919433216 2919432681 Bacteria 5390474
670 2919716983 2919713450 Bacteria 7431245
671 2922557229 2922554459 Bacteria 6683962
672 2928145069 2928142448 Bacteria 5288925
673 2929217500 2929212328 Bacteria 7708288
674 2932400450 2932398195 Bacteria 3847976
675 2939584758 2939582691 Bacteria 7088898
676 2939745818 2939743619 Bacteria 5762299
677 Ga0466967_0048757
678 JGI24746J21847_1000249
679 JGI24737J22298_10038251
680 JGI24744J21845_10002207
681 JGI24744J21845_10016152
682 rootH2_10146445
683 rootL2_10160125
684 Ga0055540_1001795
685 Ga0055540_1009417
686 Ga0055540_1011152
687 Ga0070658_10607210
688 Ga0070676_10010723
689 Ga0070683_100167466
690 Ga0070683_100219247
691 Ga0070683_100241042
692 Ga0070690_100151061
693 Ga0070670_100708862
694 Ga0068869_100096412
695 Ga0070666_10179911
696 Ga0070666_10189511
697 Ga0070680_100239401
698 Ga0070682_100088168
699 Ga0068868_100040396
700 Ga0068868_100480219
701 Ga0070660_100188710
702 Ga0070689_100004126
703 Ga0070691_10038194
704 Ga0070691_10062532
705 Ga0070691_10274739
706 Ga0070692_10078001
707 Ga0070668_100008191
708 Ga0070668_100061451
709 Ga0070668_100610737
710 Ga0070669_100043553
711 Ga0070669_100076749
712 Ga0070675_100468309
713 Ga0070675_100679253
714 Ga0070671_100012064
715 Ga0070671_100661155
716 Ga0070674_100003905
717 Ga0070673_100063938
718 Ga0070659_100167850
719 Ga0070667_100000207
720 Ga0070667_100008191
721 Ga0070667_100045426
722 Ga0070667_100047120
723 Ga0070703_10021993
724 Ga0070709_10015484
725 Ga0070714_100251570
726 Ga0070714_100274286
727 Ga0070714_100471712
728 Ga0070714_101046158
729 Ga0070713_100407450
730 Ga0070710_10002949
731 Ga0070710_10067081
732 Ga0070701_10009581
733 Ga0070701_10112075
734 Ga0070711_100008390
735 Ga0070711_100028157
736 Ga0070705_100130391
737 Ga0070663_100010779
738 Ga0070663_100142894
739 Ga0070678_100004244
740 Ga0070678_100307025
741 Ga0070662_100015171
742 Ga0070662_100107732
743 Ga0068867_100013125
744 Ga0070685_10007226
745 Ga0070679_100178923
746 Ga0070684_100314547
747 Ga0070684_100341054
748 Ga0068853_100009963
749 Ga0068853_100037295
750 Ga0068853_100476191
751 Ga0070672_100098550
752 Ga0070672_100354081
753 Ga0070686_100089807
754 Ga0070686_100269187
755 Ga0070695_100222085
756 Ga0070696_100059198
757 Ga0070693_100014322
758 Ga0070693_100263816
759 Ga0070665_100012212
760 Ga0070665_100166458
761 Ga0070665_100306262
762 Ga0070665_100801159
763 Ga0070704_100030388
764 Ga0068854_100054668
765 Ga0070702_100022094
766 Ga0070702_100076639
767 Ga0070702_100408423
768 Ga0068852_100056062
769 Ga0068859_100061979
770 Ga0068859_100097718
771 Ga0068859_100564112
772 Ga0068859_100822505
773 Ga0068864_100054331
774 Ga0068864_100177382
775 Ga0068866_10384840
776 Ga0068861_100017161
777 Ga0068861_100136918
778 Ga0068861_100210179
779 Ga0068870_10009240
780 Ga0068863_100008676
781 Ga0068863_100217975
782 Ga0068863_100948513
783 Ga0068858_100012734
784 Ga0068858_100179477
785 Ga0068858_100362660
786 Ga0068860_100012921
787 Ga0068862_100024124
788 Ga0068862_100480084
789 Ga0081455_10047330
790 Ga0075365_10006497
791 Ga0075365_10033249
792 Ga0075365_10049016
793 Ga0075365_10050995
794 Ga0075365_10159998
795 Ga0075365_10179955
796 Ga0075368_10023140
797 Ga0075363_100000752
798 Ga0075363_100064429
799 Ga0075363_100072411
800 Ga0075364_10001726
801 Ga0075364_10026141
802 Ga0075364_10042128
803 Ga0075364_10085326
804 Ga0075364_10214141
805 Ga0070715_10253668
806 Ga0070716_100012068
807 Ga0070716_100099726
808 Ga0070712_100005319
809 Ga0070712_100041669
810 Ga0070712_100217057
811 Ga0075362_10021887
812 Ga0075362_10024279
813 Ga0075367_10037673
814 Ga0075367_10204958
815 Ga0075367_10367867
816 Ga0075369_10003028
817 Ga0075369_10004827
818 Ga0075369_10046042
819 Ga0075369_10070799
820 Ga0075369_10092927
821 Ga0075369_10132862
822 Ga0075369_10181604
823 Ga0075369_10271215
824 Ga0075366_10046485
825 Ga0075370_10000341
826 Ga0075370_10033558
827 Ga0075370_10068216
828 Ga0075370_10080177
829 Ga0075370_10134468
830 Ga0068871_100324065
831 Ga0075428_100007312
832 Ga0075430_100058874
833 Ga0075430_100203186
834 Ga0068865_100003973
835 Ga0068865_100355231
836 Ga0075436_100562509
837 Ga0097620_100061977
838 Ga0097620_100097721
839 Ga0097620_100564065
840 Ga0097620_100822498
841 Ga0099795_10014471
842 Ga0105250_10098049
843 Ga0105250_10126503
844 Ga0105245_10011752
845 Ga0105245_10437888
846 Ga0105245_10727364
847 Ga0105247_10213411
848 Ga0105247_10381803
849 Ga0114129_10018369
850 Ga0105243_10004112
851 Ga0105243_10091180
852 Ga0105243_10622929
853 Ga0105241_10084060
854 Ga0105241_10719454
855 Ga0105242_10007699
856 Ga0105242_10213964
857 Ga0105248_10014903
858 Ga0105248_10016636
859 Ga0105237_10115171
860 Ga0105237_10382390
861 Ga0105237_10530859
862 Ga0105238_10356790
863 Ga0105238_10539435
864 Ga0105238_10655490
865 Ga0105249_10162835
866 Ga0105249_10304708
867 Ga0105249_10321414
868 Ga0157369_10247069
869 Ga0157374_10048291
870 Ga0157374_10441970
871 Ga0157378_10009418
872 Ga0157378_10263176
873 Ga0157378_10789661
874 Ga0163162_10036034
875 Ga0163162_10180314
876 Ga0157375_10084168
877 Ga0163163_10017194
878 Ga0163163_10256273
879 Ga0163163_10670829
880 Ga0157380_10038541
881 Ga0157377_10003584
882 Ga0157379_10015516
883 Ga0157379_10163347
884 Ga0157376_10763132
885 Ga0163161_10062208
886 Ga0163161_10070186
887 Ga0163161_10086070
888 Ga0213876_10016537
889 Ga0213875_10013950
890 Ga0209051_1004009
891 Ga0209051_1012702
892 Ga0209051_1014796
893 Ga0209051_1033969
894 Ga0207696_1067118
895 Ga0207653_10075585
896 Ga0207642_10010536
897 Ga0207710_10025602
898 Ga0207710_10197496
899 Ga0207688_10003584
900 Ga0207688_10008767
901 Ga0207647_10083676
902 Ga0207699_10007946
903 Ga0207705_10268766
904 Ga0207671_10045140
905 Ga0207671_10151767
906 Ga0207671_10235919
907 Ga0207693_10009413
908 Ga0207693_10069987
909 Ga0207663_10036716
910 Ga0207663_10500122
911 Ga0207657_10171176
912 Ga0207681_10353286
913 Ga0207694_10508085
914 Ga0207659_10358568
915 Ga0207687_10009671
916 Ga0207687_10287753
917 Ga0207700_10420688
918 Ga0207664_10103874
919 Ga0207664_10151344
920 Ga0207664_10405475
921 Ga0207664_10418065
922 Ga0207644_10020036
923 Ga0207644_10514456
924 Ga0207690_10153844
925 Ga0207706_10018529
926 Ga0207706_10318744
927 Ga0207686_10114754
928 Ga0207709_10004934
929 Ga0207709_10005610
930 Ga0207709_10136439
931 Ga0207670_10066091
932 Ga0207669_10006346
933 Ga0207669_10064784
934 Ga0207704_10005939
935 Ga0207704_10278385
936 Ga0207665_10015671
937 Ga0207665_10044280
938 Ga0207691_10102466
939 Ga0207691_10627063
940 Ga0207711_10021885
941 Ga0207689_10110945
942 Ga0207661_10229991
943 Ga0207667_10155041
944 Ga0207667_10238937
945 Ga0207712_10009714
946 Ga0207668_10000526
947 Ga0207668_10009108
948 Ga0207658_10018649
949 Ga0207658_10069945
950 Ga0207658_10215988
951 Ga0207703_10009089
952 Ga0207703_10059867
953 Ga0207703_10506386
954 Ga0207703_10719974
955 Ga0207639_10028496
956 Ga0207639_10045475
957 Ga0207678_10005752
958 Ga0207678_10016047
959 Ga0207678_10018037
960 Ga0207708_10065683
961 Ga0207702_10067164
962 Ga0207641_10003476
963 Ga0207641_10063120
964 Ga0207648_10010554
965 Ga0207648_10209207
966 Ga0207676_10479195
967 Ga0207676_10920883
968 Ga0207675_100012618
969 Ga0207675_100116178
970 Ga0207675_100403263
971 Ga0207675_100457508
972 Ga0207683_10011339
973 Ga0207683_10097174
974 Ga0207698_10288110
975 Ga0207698_11020449
976 Ga0209179_1025803
977 Ga0268266_10013715
978 Ga0268266_10069761
979 Ga0268266_10092239
980 Ga0268266_10605161
981 Ga0268265_10067910
982 Ga0268264_10059530
983 Ga0268264_10247271
984 Ga0265327_10000018
985 Ga0265327_10001055
986 Ga0265327_10012159
987 Ga0307408_100079665
988 Ga0307408_100113899
989 Ga0307405_10034901
990 Ga0307405_10225861
991 Ga0307405_10292107
992 Ga0307405_10486831
993 Ga0307413_10045379
994 Ga0307413_10159572
995 Ga0307410_10027563
996 Ga0307410_10030483
997 Ga0307410_10035295
998 Ga0307410_10161485
999 Ga0307410_10252391
1000 Ga0307410_10290186
1001 Ga0307410_10382653
1002 Ga0307410_10520573
1003 Ga0307410_11075128
1004 Ga0307406_10083322
1005 Ga0307406_10094734
1006 Ga0307406_10200135
1007 Ga0307406_10525545
1008 Ga0307406_11102180
1009 Ga0307407_10265598
1010 Ga0307407_10482602
1011 Ga0307407_10509218
1012 Ga0307412_10064726
1013 Ga0307412_10161283
1014 Ga0307412_10191651
1015 Ga0307409_100049766
1016 Ga0307409_100074821
1017 Ga0307409_100114532
1018 Ga0307409_100121219
1019 Ga0307409_100168247
1020 Ga0307409_100182036
1021 Ga0307409_100336892
1022 Ga0307409_100345788
1023 Ga0307409_100479588
1024 Ga0307409_100898232
1025 Ga0307416_100070336
1026 Ga0307416_100100337
1027 Ga0307416_100152629
1028 Ga0307416_100292024
1029 Ga0307416_100562654
1030 Ga0307416_101576004
1031 Ga0307416_101778903
1032 Ga0307414_10069910
1033 Ga0307414_10169616
1034 Ga0307414_10211218
1035 Ga0307414_10231482
1036 Ga0307414_10468208
1037 Ga0307414_10617807
1038 Ga0307411_10036755
1039 Ga0307411_10049088
1040 Ga0307411_10103015
1041 Ga0307411_10133597
1042 Ga0307411_10314709
1043 Ga0307415_100051496
1044 Ga0307415_100113811
1045 Ga0307415_100297193
1046 Ga0307415_100308246
1047 Ga0307415_100376709
1048 Ga0307415_100381204
1049 Ga0307415_100504186
1050 Ga0307415_100642380
1051 Ga0307415_101105670
1052 Ga0373932_0203610
1053 Ga0373943_0054214
1054 Ga0373931_0046329
1055 Ga0316584_0233041
1056 Ga0395899_0358439
1057 Ga0395900_0060881
1058 Ga0395898_0011113
1059 Ga0436364_0815483
1060 Ga0436364_1009898
1061 Ga0395901_0007866
1062 Ga0395901_0685346
1063 Ga0436365_1064965
1064 Ga0436365_1630628
1065 Ga0436363_1156190
1066 Ga0439466_0041890
1067 Ga0439466_0054626
1068 Ga0439466_0107995
1069 Ga0439465_0014461
1070 Ga0439465_0071915
1071 Ga0451802_1930661
1072 Ga0451806_754557
1073 Ga0451841_1132979
1074 Ga0439442_004527
1075 Ga0439445_0016618
1076 Ga0439434_0007518
1077 Ga0439460_0093333
1078 Ga0466969_0162829
1079 Ga0466969_0190549
1080 Ga0466972_0005077
1081 Ga0466972_0080684
1082 Ga0466972_0436576
1083 Ga0466965_0003274
1084 Ga0466966_0102580
1085 Ga0466966_0187352
1086 Ga0466966_0302036
1087 Ga0466966_0342842
1088 Ga0466961_0102915
1089 Ga0466961_0121933
1090 Ga0466963_0051985
1091 Ga0466963_0077109
1092 Ga0466963_0152553
1093 Ga0466963_0805105
1094 Ga0466971_0009094
1095 Ga0466971_0106889
1096 Ga0466968_0007618
1097 Ga0466968_0175590
1098 Ga0466968_0226600
1099 Ga0466970_0003951
1100 Ga0466970_0032862
1101 Ga0466970_0040508
1102 Ga0466970_0055238
1103 Ga0466970_0382177
1104 Ga0466970_0405379
1105 Ga0466957_0022676
1106 Ga0466957_0034944
1107 Ga0466957_0086013
1108 Ga0466957_0091350
1109 Ga0466957_0160496
1110 Ga0466957_0171224
1111 Ga0466957_0445666
1112 Ga0466960_0000265
1113 Ga0466960_0006050
1114 Ga0466960_0018707
1115 Ga0466960_0022165
1116 Ga0466960_0038680
1117 Ga0466960_0053050
1118 Ga0466960_0253385
1119 Ga0466960_0396245
1120 Ga0466959_0054959
1121 Ga0466959_0093606
1122 Ga0466959_0139325
1123 Ga0466959_0174485
1124 Ga0466959_0242173
1125 Ga0466959_0419627
1126 Ga0466959_0568260
1127 Ga0466958_0040833
1128 Ga0466958_0110327
1129 Ga0466958_0142499
1130 Ga0466958_0179823
1131 Ga0466958_0194556
1132 Ga0466958_0285821
1133 Ga0466958_0312897
1134 Ga0466958_0328469
1135 Ga0466958_0467917
1136 Ga0466967_0011184
1137 Ga0466967_0024884
1138 Ga0466967_0029991
1139 Ga0466967_0032663
1140 Ga0466967_0060463
1141 Ga0466967_0063212
1142 Ga0466967_0192506
1143 Ga0466967_0369529
1144 Ga0466967_0395429
1145 Ga0466967_0611173
1146 Ga0466967_0939101
1147 Ga0495603_0211809
1148 Ga0495629_0030982
1149 Ga0495638_0001570
1150 Ga0495641_0032769
1151 Ga0495582_0162613
1152 Ga0495639_0068454
1153 Ga0495607_0022173
1154 Ga0495618_0251761
1155 Ga0495648_0004296
1156 Ga0495663_0034452
1157 Ga0495654_0109509
1158 Ga0495640_0096179
1159 Ga0495668_0001186
1160 Ga0495668_0305887
1161 Ga0495611_0054672
1162 Ga0495658_0317500
1163 Ga0495624_0427289
1164 Ga0495671_0117006
1165 Ga0495581_0020291
1166 Ga0495674_0073343
1167 Ga0495672_0010022
1168 Ga0495672_0094110
1169 Ga0495683_0002024
1170 Ga0495685_097122
1171 Ga0495673_0002913
1172 Ga0495686_0038965
1173 Ga0495593_0044410
1174 Ga0496100_0004691
1175 Ga0496100_0099020
1176 Ga0496100_0119906
1177 Ga0496100_0716930
1178 Ga0496100_0846532
1179 Ga0496101_0000963
1180 Ga0496101_0006448
1181 Ga0496102_0011113
1182 Ga0496102_0070431
1183 Ga0496102_0086508
1184 Ga0496102_0134456
1185 Ga0496102_0226822
1186 Ga0496102_0294592
1187 Ga0496102_0322256
1188 Ga0496102_1057105
1189 Ga0496103_0004904
1190 Ga0496103_0043706
1191 Ga0496103_0086625
1192 Ga0496103_0098600
1193 Ga0496103_0243217
1194 Ga0496104_0028128
1195 Ga0496104_0149634
1196 Ga0496104_0293892
1197 Ga0496104_0491873
1198 Ga0496105_0010203
1199 Ga0496105_0110807
1200 Ga0496105_0116794
1201 Ga0496105_0281009
1202 Ga0496106_0020218
1203 Ga0496106_0049074
1204 Ga0496106_0083781
1205 Ga0496107_0007986
1206 Ga0496107_0039156
1207 Ga0496107_0069752
1208 Ga0496107_0070780
1209 Ga0496107_0444963
1210 Ga0496108_0002078
1211 Ga0496108_0073213
1212 Ga0496108_0142949
1213 Ga0496108_0175706
1214 Ga0496108_0223466
1215 Ga0496108_0235450
1216 Ga0496108_0461773
1217 Ga0496109_0011117
1218 Ga0496109_0028832
1219 Ga0496109_0032560
1220 Ga0496109_0061059
1221 Ga0496109_0662556
1222 Ga0496110_0018791
1223 Ga0496110_0119208
1224 Ga0496110_0150376
1225 Ga0496110_0376783
1226 Ga0496110_0540933
1227 Ga0496110_1064488
1228 Ga0496111_0054531
1229 Ga0496112_0005618
1230 Ga0496112_0032517
1231 Ga0496112_0058532
1232 Ga0496112_0141790
1233 Ga0496112_0150836
1234 Ga0496112_1091487
1235 Ga0496113_0082838
1236 Ga0496113_0096089
1237 Ga0496113_0387891
1238 Ga0496113_0390993
1239 Ga0496113_0414029
1240 Ga0496114_0011079
1241 Ga0496114_0024447
1242 Ga0496114_0326492
1243 Ga0496114_1226494
1244 Ga0496115_0007857
1245 Ga0496115_0025818
1246 Ga0496115_0361526
1247 Ga0496118_0000730
1248 Ga0496118_0282549
1249 Ga0496120_0168771
1250 Ga0496122_0003041
1251 Ga0496122_0140757
1252 Ga0496123_0002126
1253 Ga0496126_0018195
1254 Ga0496126_0282728
1255 Ga0501032_0014425
1256 Ga0501032_0056002
1257 Ga0501033_0108369
1258 Ga0501034_0035636
1259 Ga0501036_0001863
1260 Ga0501037_0004680
1261 Ga0501037_0104482
1262 Ga0501038_0002617
1263 Ga0501039_0000771
1264 Ga0501040_0124171
1265 Ga0501043_0000790
1266 Ga0501043_0074624
1267 Ga0501043_0751641
1268 Ga0501046_0000382
1269 Ga0501047_0002654
1270 Ga0501048_0073165
1271 Ga0501067_0045878
1272 Ga0501069_0144743
1273 Ga0501070_0008026
1274 Ga0501070_0008775
1275 Ga0501070_0088482
1276 Ga0501071_0282176
1277 Ga0501080_0117808
1278 Ga0501035_0007912
1279 Ga0501044_0002938
1280 nmdc:mga03683_114047_c1
1281 nmdc:mga03683_17280_c1
1282 nmdc:mga03683_25184_c1
1283 nmdc:mga03683_31353_c1
1284 nmdc:mga03n38_107191_c1
1285 nmdc:mga03n38_431516_c1
1286 nmdc:mga03n38_48527_c1
1287 nmdc:mga03n38_613084_c1
1288 nmdc:mga03n38_65217_c1
1289 nmdc:mga03n38_9908_c1
1290 nmdc:mga00v17_10325_c1
1291 nmdc:mga00v17_1611_c1
1292 nmdc:mga00v17_227940_c1
1293 nmdc:mga00v17_269044_c1
1294 nmdc:mga00v17_91095_c1
1295 nmdc:mga00v17_94471_c1
1296 nmdc:mga0yw44_14561_c1
1297 nmdc:mga0yw44_176334_c1
1298 nmdc:mga0yw44_46969_c1
1299 nmdc:mga0yw44_77644_c1
1300 nmdc:mga06z11_11649_c1
1301 nmdc:mga06z11_376728_c1
1302 nmdc:mga04h51_1888_c1
1303 nmdc:mga07m45_1189_c1
1304 nmdc:mga07m45_161182_c1
1305 nmdc:mga07m45_16453_c1
1306 nmdc:mga07m45_37616_c1
1307 nmdc:mga0qj67_87209_c1
1308 nmdc:mga08y16_674320_c1
1309 nmdc:mga0sz30_18360_c2
1310 nmdc:mga0sz30_211790_c1
1311 nmdc:mga0sz30_49626_c1
1312 nmdc:mga0sz30_654_c2
1313 nmdc:mga0sz30_716_c1
1314 Ga0495655_0011622
1315 Ga0495619_0495635
1316 Ga0500643_001666
1317 Ga0500641_0051007
1318 Ga0500652_000149
1319 Ga0500616_0003317
1320 Ga0500616_0009322
1321 Ga0500620_131167
1322 Ga0466962_0004482
1323 Ga0466962_0009524
1324 Ga0466962_0232267
1325 2548699026
1326 2552110699
1327 2566992133
1328 2644490601
1329 2644513926
1330 2644636998
1331 2739204182
1332 2739238171
1333 2739364820
1334 2753037782
1335 2753325650
1336 2889303293
1337 2902800516
1338 2902814849
1339 2902843245
1340 2904538045
1341 2904766538
1342 2904772706
1343 2908811497
1344 2919421026
1345 2919433216
1346 2919716983
1347 2922557229
1348 2928145069
1349 2929217500
1350 2932400450
1351 2939584758
1352 2939745818

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

31

176

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

45

175

0.8

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

33

196

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c37-assembly1.cif.gz_A mycobacterium smegmatis rimj in complex with coa-disulfide 0.995 1 203
6c37-assembly1.cif.gz_A mycobacterium smegmatis rimj in complex with coa-disulfide 0.9902 1 203
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.9278 13 186
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.9175 13 182
1s7k-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo) 0.9149 1 183
ID Description Score Start End Superfamily
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9973 10 186 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9862 10 186 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9685 115 184 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9396 13 182 3.40.630.30
af_P0A948_10_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9387 13 183 3.40.630.30
ID Description Score Start End GO Terms
AF-G0HHD7-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9859 1 198 GO:0005737
GO:0008999
AF-A0A4U3CE54-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9784 33 198 GO:0005737
GO:0008999
AF-A0A7D6VDL9-F1-model_v4 GNAT family N-acetyltransferase 0.9632 1 203 GO:0005737
GO:0008999
GO:1990189
AF-A0A7X2TRC5-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9625 13 182 GO:0005737
GO:0008999
AF-A0A6L6AAW3-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9623 102 184 GO:0005737
GO:0008999

Map