F474416

General Info

Members Datasets Scaffolds Average Seq Length
675 192 1350 299

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100018682|Ga0070660_1000186826
Length 325
Sequence MLTRQSWIALGVALVLGLLAVYIANVYLNGSRAQAQLGGTTKIAVAAVPMDYGNDITPDKVRYVDFPNRSIPAGAFQNAAQLLPTGQKRFALMPIGINEPILASKISGAGQGASIAALLPAGMRAATVRINDVSGVAGFIQPNDTVDVLVTRQVTNGQQLTDVLLQNVRVMALDQESKNPDGTPKVARTATLQVSPLDSQKLALAQEAGTLSLVLRKPGDTSNPVVETVSLNDLRYNMYGGARYPAPATVGGFGSLGNAMSGAMERTASEISRPRRAPSTPKAPAKSMWTTSHIAGDKSATPAPVTGPSVEIYRGTTSNSYQVGG

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 1.78
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100018682 3300005339 Bacteria 5070
2 JGI24736J21556_1001638 3300001904 Bacteria 4069
3 JGI24747J21853_1003056 3300001978 Unclassified 1423
4 JGI24739J22299_10001181 3300001989 Bacteria 9774
5 JGI24739J22299_10023688 3300001989 Bacteria 2168
6 JGI24737J22298_10005984 3300001990 Bacteria 4176
7 JGI24737J22298_10012166 3300001990 Bacteria 2806
8 JGI24735J21928_10002331 3300002067 Bacteria 6615
9 JGI24738J21930_10001170 3300002075 Bacteria 7394
10 JGI24738J21930_10019942 3300002075 Bacteria 1395
11 JGI24744J21845_10000023 3300002077 Bacteria 17990
12 Ga0070658_10083311 3300005327 Unclassified 2629
13 Ga0070658_10177544 3300005327 Unclassified 1791
14 Ga0070658_10204795 3300005327 Bacteria 1666
15 Ga0070658_10220668 3300005327 Bacteria 1603
16 Ga0070658_10295667 3300005327 Bacteria 1380
17 Ga0070676_10013601 3300005328 Bacteria 4463
18 Ga0070676_10033735 3300005328 Bacteria 2937
19 Ga0070676_10038736 3300005328 Unclassified 2754
20 Ga0070676_10045224 3300005328 Bacteria 2564
21 Ga0070676_10076821 3300005328 Bacteria 2017
22 Ga0070676_10133467 3300005328 Bacteria 1572
23 Ga0070683_100247905 3300005329 Bacteria 1694
24 Ga0070683_100322684 3300005329 Bacteria 1470
25 Ga0070670_100015213 3300005331 Bacteria 6604
26 Ga0070670_100029293 3300005331 Bacteria 4738
27 Ga0070670_100276796 3300005331 Bacteria 1465
28 Ga0070670_100496892 3300005331 Unclassified 1084
29 Ga0070677_10086869 3300005333 Unclassified 1352
30 Ga0070677_10137766 3300005333 Bacteria 1122
31 Ga0068869_100000611 3300005334 Bacteria 20169
32 Ga0068869_100011274 3300005334 Bacteria 5856
33 Ga0068869_100106791 3300005334 Bacteria 2125
34 Ga0068869_100210293 3300005334 Unclassified 1537
35 Ga0070680_100059271 3300005336 Bacteria 3131
36 Ga0070682_100166037 3300005337 Bacteria 1529
37 Ga0068868_100001045 3300005338 Bacteria 18935
38 Ga0068868_100002511 3300005338 Bacteria 12749
39 Ga0068868_100014559 3300005338 Bacteria 5801
40 Ga0068868_100064165 3300005338 Bacteria 2915
41 Ga0070660_100005465 3300005339 Bacteria 8798
42 Ga0070660_100007968 3300005339 Bacteria 7400
43 Ga0070660_100036759 3300005339 Bacteria 3711
44 Ga0070660_100045319 3300005339 Bacteria 3366
45 Ga0070660_100101534 3300005339 Bacteria 2279
46 Ga0070689_100050684 3300005340 Bacteria 3208
47 Ga0070689_100213639 3300005340 Bacteria 1580
48 Ga0070661_100014125 3300005344 Bacteria 5625
49 Ga0070661_100031802 3300005344 Bacteria 3816
50 Ga0070661_100139025 3300005344 Bacteria 1829
51 Ga0070661_100250944 3300005344 Unclassified 1365
52 Ga0070692_10117802 3300005345 Unclassified 1477
53 Ga0070692_10128529 3300005345 Bacteria 1421
54 Ga0070668_100000431 3300005347 Bacteria 27697
55 Ga0070668_100010308 3300005347 Bacteria 6939
56 Ga0070668_100042329 3300005347 Bacteria 3491
57 Ga0070669_100001196 3300005353 Bacteria 18911
58 Ga0070669_100056196 3300005353 Bacteria 2885
59 Ga0070669_100235028 3300005353 Bacteria 1454
60 Ga0070675_100097483 3300005354 Bacteria 2472
61 Ga0070671_100045787 3300005355 Bacteria 3637
62 Ga0070671_100060530 3300005355 Bacteria 3152
63 Ga0070671_100089569 3300005355 Bacteria 2576
64 Ga0070671_100212262 3300005355 Bacteria 1642
65 Ga0070671_100442450 3300005355 Bacteria 1115
66 Ga0070674_100025535 3300005356 Bacteria 3848
67 Ga0070674_100067876 3300005356 Bacteria 2510
68 Ga0070674_100374976 3300005356 Bacteria 1156
69 Ga0070673_100000262 3300005364 Bacteria 26910
70 Ga0070673_100013977 3300005364 Bacteria 5575
71 Ga0070673_100197558 3300005364 Bacteria 1731
72 Ga0070673_100262589 3300005364 Unclassified 1509
73 Ga0070673_100311487 3300005364 Unclassified 1389
74 Ga0070673_100367862 3300005364 Bacteria 1279
75 Ga0070659_100000972 3300005366 Bacteria 21069
76 Ga0070659_100002128 3300005366 Bacteria 14118
77 Ga0070659_100008755 3300005366 Bacteria 7407
78 Ga0070659_100009122 3300005366 Bacteria 7274
79 Ga0070659_100032202 3300005366 Bacteria 4065
80 Ga0070659_100033781 3300005366 Bacteria 3976
81 Ga0070659_100093888 3300005366 Bacteria 2408
82 Ga0070659_100115727 3300005366 Bacteria 2167
83 Ga0070659_100134186 3300005366 Bacteria 2013
84 Ga0070659_100248830 3300005366 Bacteria 1473
85 Ga0070659_100447234 3300005366 Bacteria 1096
86 Ga0070667_100006111 3300005367 Bacteria 10002
87 Ga0070667_100008789 3300005367 Bacteria 8369
88 Ga0070667_100019050 3300005367 Bacteria 5690
89 Ga0070667_100060123 3300005367 Bacteria 3216
90 Ga0070667_100090560 3300005367 Bacteria 2629
91 Ga0070694_100004297 3300005444 Bacteria 8564
92 Ga0070663_100013719 3300005455 Bacteria 5178
93 Ga0070663_100052988 3300005455 Bacteria 2895
94 Ga0070663_100166578 3300005455 Unclassified 1700
95 Ga0070663_100176084 3300005455 Bacteria 1656
96 Ga0070663_100252801 3300005455 Bacteria 1395
97 Ga0070663_100378991 3300005455 Bacteria 1152
98 Ga0070678_100044133 3300005456 Bacteria 3181
99 Ga0070678_100183457 3300005456 Bacteria 1715
100 Ga0070662_100000323 3300005457 Bacteria 28556
101 Ga0070662_100014533 3300005457 Bacteria 5263
102 Ga0070662_100015525 3300005457 Bacteria 5104
103 Ga0070662_100017903 3300005457 Bacteria 4782
104 Ga0070662_100027411 3300005457 Unclassified 3954
105 Ga0070662_100060539 3300005457 Bacteria 2761
106 Ga0070662_100077205 3300005457 Bacteria 2471
107 Ga0070681_10014899 3300005458 Bacteria 7730
108 Ga0070681_10206149 3300005458 Bacteria 1883
109 Ga0070681_10212930 3300005458 Bacteria 1848
110 Ga0068867_100013784 3300005459 Bacteria 5724
111 Ga0068867_100021913 3300005459 Bacteria 4563
112 Ga0068867_100073559 3300005459 Bacteria 2559
113 Ga0068867_100148213 3300005459 Bacteria 1841
114 Ga0068867_100159468 3300005459 Bacteria 1778
115 Ga0068867_100227906 3300005459 Bacteria 1505
116 Ga0070679_100181783 3300005530 Bacteria 2075
117 Ga0070679_100187403 3300005530 Bacteria 2039
118 Ga0070684_100241427 3300005535 Bacteria 1651
119 Ga0070684_100418948 3300005535 Bacteria 1236
120 Ga0068853_100004654 3300005539 Bacteria 10643
121 Ga0068853_100083910 3300005539 Unclassified 2791
122 Ga0068853_100105927 3300005539 Bacteria 2491
123 Ga0068853_100189813 3300005539 Bacteria 1866
124 Ga0068853_100199837 3300005539 Bacteria 1819
125 Ga0068853_100290703 3300005539 Bacteria 1509
126 Ga0068853_100349835 3300005539 Bacteria 1374
127 Ga0068853_100534097 3300005539 Bacteria 1110
128 Ga0070672_100000647 3300005543 Bacteria 20424
129 Ga0070695_100112074 3300005545 Bacteria 1853
130 Ga0070693_100047650 3300005547 Bacteria 2439
131 Ga0070693_100071321 3300005547 Bacteria 2047
132 Ga0070665_100002737 3300005548 Bacteria 19094
133 Ga0070665_100006889 3300005548 Bacteria 11553
134 Ga0070665_100175898 3300005548 Unclassified 2141
135 Ga0070665_100356167 3300005548 Bacteria 1469
136 Ga0070704_100073928 3300005549 Bacteria 2484
137 Ga0068855_100016601 3300005563 Bacteria 8854
138 Ga0068855_100035286 3300005563 Bacteria 5957
139 Ga0068855_100095054 3300005563 Bacteria 3435
140 Ga0068855_100121645 3300005563 Bacteria 2987
141 Ga0068855_100411833 3300005563 Bacteria 1480
142 Ga0068855_100478433 3300005563 Bacteria 1356
143 Ga0070664_100030968 3300005564 Unclassified 4466
144 Ga0070664_100048343 3300005564 Bacteria 3595
145 Ga0070664_100063255 3300005564 Bacteria 3155
146 Ga0070664_100063276 3300005564 Bacteria 3155
147 Ga0070664_100109423 3300005564 Unclassified 2410
148 Ga0070664_100131281 3300005564 Bacteria 2200
149 Ga0070664_100229990 3300005564 Unclassified 1662
150 Ga0070664_100231248 3300005564 Bacteria 1657
151 Ga0070664_100250702 3300005564 Bacteria 1591
152 Ga0068857_100002656 3300005577 Bacteria 14675
153 Ga0068857_100002954 3300005577 Bacteria 14004
154 Ga0068857_100015018 3300005577 Bacteria 6756
155 Ga0068857_100082082 3300005577 Bacteria 2879
156 Ga0068857_100082692 3300005577 Bacteria 2868
157 Ga0068857_100306101 3300005577 Bacteria 1465
158 Ga0068854_100001315 3300005578 Bacteria 14980
159 Ga0068854_100013360 3300005578 Bacteria 5386
160 Ga0068854_100023211 3300005578 Bacteria 4235
161 Ga0068854_100032965 3300005578 Bacteria 3608
162 Ga0068854_100146387 3300005578 Bacteria 1818
163 Ga0068854_100204091 3300005578 Bacteria 1556
164 Ga0068854_100220811 3300005578 Bacteria 1499
165 Ga0068854_100248599 3300005578 Bacteria 1419
166 Ga0068854_100346097 3300005578 Bacteria 1215
167 Ga0068856_100026026 3300005614 Bacteria 5706
168 Ga0068856_100061331 3300005614 Bacteria 3714
169 Ga0070702_100161950 3300005615 Unclassified 1447
170 Ga0068852_100002402 3300005616 Bacteria 12906
171 Ga0068852_100003288 3300005616 Bacteria 11288
172 Ga0068852_100007580 3300005616 Bacteria 7931
173 Ga0068852_100045769 3300005616 Bacteria 3724
174 Ga0068852_100098819 3300005616 Bacteria 2629
175 Ga0068852_100105913 3300005616 Bacteria 2548
176 Ga0068852_100270352 3300005616 Bacteria 1635
177 Ga0068859_100000978 3300005617 Bacteria 29288
178 Ga0068859_100066043 3300005617 Bacteria 3652
179 Ga0068859_100078438 3300005617 Bacteria 3343
180 Ga0068859_100098597 3300005617 Bacteria 2976
181 Ga0068859_100287196 3300005617 Bacteria 1738
182 Ga0068859_100291365 3300005617 Bacteria 1725
183 Ga0068859_100303911 3300005617 Bacteria 1689
184 Ga0068864_100000222 3300005618 Bacteria 51430
185 Ga0068864_100006950 3300005618 Bacteria 9281
186 Ga0068864_100039661 3300005618 Bacteria 4025
187 Ga0068864_100098612 3300005618 Bacteria 2588
188 Ga0068864_100139980 3300005618 Bacteria 2182
189 Ga0068864_100235502 3300005618 Bacteria 1694
190 Ga0068861_100028076 3300005719 Bacteria 4105
191 Ga0068851_10004351 3300005834 Bacteria 6373
192 Ga0068851_10018334 3300005834 Bacteria 3371
193 Ga0068851_10054653 3300005834 Bacteria 2034
194 Ga0068870_10017762 3300005840 Bacteria 3423
195 Ga0068863_100003001 3300005841 Bacteria 16683
196 Ga0068863_100008351 3300005841 Bacteria 10113
197 Ga0068863_100044627 3300005841 Bacteria 4206
198 Ga0068863_100144790 3300005841 Bacteria 2272
199 Ga0068863_100377686 3300005841 Bacteria 1384
200 Ga0068858_100147033 3300005842 Bacteria 2214
201 Ga0068858_100441155 3300005842 Bacteria 1254
202 Ga0068860_100004347 3300005843 Bacteria 14478
203 Ga0068860_100005308 3300005843 Bacteria 13085
204 Ga0068860_100022263 3300005843 Bacteria 6133
205 Ga0068860_100089549 3300005843 Bacteria 2930
206 Ga0068860_100209975 3300005843 Bacteria 1888
207 Ga0068862_100005318 3300005844 Bacteria 10785
208 Ga0068862_100065957 3300005844 Bacteria 3119
209 Ga0068862_100100891 3300005844 Bacteria 2524
210 Ga0068862_100102803 3300005844 Bacteria 2501
211 Ga0081539_10007926 3300005985 Bacteria 9459
212 Ga0081539_10015138 3300005985 Bacteria 5636
213 Ga0070717_10083127 3300006028 Bacteria 2692
214 Ga0075366_10207894 3300006195 Bacteria 1191
215 Ga0097621_100058624 3300006237 Bacteria 3150
216 Ga0097621_100141523 3300006237 Bacteria 2056
217 Ga0068871_100081797 3300006358 Bacteria 2677
218 Ga0068871_100180261 3300006358 Bacteria 1815
219 Ga0075431_100000885 3300006847 Bacteria 26369
220 Ga0075434_100105515 3300006871 Bacteria 2828
221 Ga0068865_100006977 3300006881 Bacteria 6926
222 Ga0068865_100199495 3300006881 Bacteria 1553
223 Ga0097620_100000978 3300006931 Bacteria 29288
224 Ga0097620_100066046 3300006931 Bacteria 3652
225 Ga0097620_100078435 3300006931 Bacteria 3343
226 Ga0097620_100098599 3300006931 Bacteria 2976
227 Ga0097620_100287220 3300006931 Bacteria 1738
228 Ga0097620_100291347 3300006931 Bacteria 1725
229 Ga0097620_100303927 3300006931 Bacteria 1689
230 Ga0105251_10046703 3300009011 Bacteria 2083
231 Ga0105250_10079823 3300009092 Bacteria 1326
232 Ga0105240_10007907 3300009093 Bacteria 15338
233 Ga0105240_10244398 3300009093 Bacteria 2079
234 Ga0105240_10316406 3300009093 Unclassified 1780
235 Ga0105245_10001658 3300009098 Bacteria 20254
236 Ga0105245_10037688 3300009098 Bacteria 4299
237 Ga0105245_10038946 3300009098 Bacteria 4230
238 Ga0105245_10074409 3300009098 Bacteria 3091
239 Ga0105247_10116956 3300009101 Bacteria 1723
240 Ga0105243_10006957 3300009148 Bacteria 8711
241 Ga0105243_10109364 3300009148 Bacteria 2309
242 Ga0105243_10146879 3300009148 Unclassified 2018
243 Ga0105241_10138577 3300009174 Bacteria 1978
244 Ga0105241_10255075 3300009174 Bacteria 1488
245 Ga0105242_10182099 3300009176 Unclassified 1854
246 Ga0105248_10001119 3300009177 Bacteria 29831
247 Ga0105248_10007549 3300009177 Bacteria 11942
248 Ga0105248_10021445 3300009177 Bacteria 7155
249 Ga0105248_10090223 3300009177 Bacteria 3451
250 Ga0105248_10092601 3300009177 Bacteria 3404
251 Ga0105248_10137212 3300009177 Bacteria 2759
252 Ga0105248_10165576 3300009177 Bacteria 2493
253 Ga0105238_10008769 3300009551 Bacteria 10116
254 Ga0105238_10011654 3300009551 Bacteria 8859
255 Ga0105238_10040891 3300009551 Bacteria 4697
256 Ga0105249_10027871 3300009553 Bacteria 5098
257 Ga0105249_10360551 3300009553 Bacteria 1475
258 Ga0105239_10054510 3300010375 Bacteria 4386
259 Ga0105239_10179067 3300010375 Bacteria 2371
260 Ga0105239_10320191 3300010375 Bacteria 1748
261 Ga0105246_10070190 3300011119 Bacteria 2463
262 Ga0105246_10138102 3300011119 Bacteria 1829
263 Ga0157373_10011058 3300013100 Bacteria 6646
264 Ga0157373_10014984 3300013100 Bacteria 5673
265 Ga0157373_10033733 3300013100 Bacteria 3679
266 Ga0157373_10064514 3300013100 Bacteria 2592
267 Ga0157373_10067993 3300013100 Bacteria 2519
268 Ga0157373_10072132 3300013100 Bacteria 2438
269 Ga0157373_10229238 3300013100 Bacteria 1311
270 Ga0157371_10004984 3300013102 Bacteria 11395
271 Ga0157371_10103416 3300013102 Bacteria 2021
272 Ga0157371_10105831 3300013102 Bacteria 1996
273 Ga0157371_10126849 3300013102 Bacteria 1815
274 Ga0157370_10009555 3300013104 Bacteria 10339
275 Ga0157370_10099113 3300013104 Bacteria 2731
276 Ga0157369_10002143 3300013105 Bacteria 23814
277 Ga0157369_10004627 3300013105 Bacteria 16166
278 Ga0157369_10133073 3300013105 Bacteria 2634
279 Ga0157369_10243323 3300013105 Bacteria 1879
280 Ga0157374_10062082 3300013296 Bacteria 3501
281 Ga0157374_10184616 3300013296 Bacteria 2039
282 Ga0157374_10216286 3300013296 Bacteria 1880
283 Ga0163162_10087499 3300013306 Bacteria 3194
284 Ga0163162_10094810 3300013306 Bacteria 3071
285 Ga0157372_10096003 3300013307 Bacteria 3378
286 Ga0157372_10257515 3300013307 Bacteria 2026
287 Ga0157372_10266996 3300013307 Bacteria 1988
288 Ga0157372_10373384 3300013307 Bacteria 1662
289 Ga0157375_10208900 3300013308 Bacteria 2109
290 Ga0157375_10251211 3300013308 Unclassified 1929
291 Ga0163163_10200310 3300014325 Bacteria 2045
292 Ga0163163_10410291 3300014325 Bacteria 1413
293 Ga0163163_10665433 3300014325 Bacteria 1105
294 Ga0157379_10094217 3300014968 Bacteria 2687
295 Ga0157379_10115587 3300014968 Bacteria 2412
296 Ga0157379_10273288 3300014968 Unclassified 1537
297 Ga0207697_10000228 3300025315 Bacteria 30449
298 Ga0207656_10032012 3300025321 Bacteria 2182
299 Ga0207682_10007246 3300025893 Unclassified 4430
300 Ga0207682_10021679 3300025893 Bacteria 2528
301 Ga0207642_10021601 3300025899 Bacteria 2537
302 Ga0207688_10000145 3300025901 Bacteria 29979
303 Ga0207688_10000767 3300025901 Bacteria 15959
304 Ga0207688_10027386 3300025901 Bacteria 3135
305 Ga0207688_10154198 3300025901 Bacteria 1359
306 Ga0207680_10012158 3300025903 Bacteria 4377
307 Ga0207680_10123411 3300025903 Bacteria 1697
308 Ga0207647_10000114 3300025904 Bacteria 62368
309 Ga0207647_10001417 3300025904 Bacteria 18404
310 Ga0207647_10011940 3300025904 Bacteria 6065
311 Ga0207647_10039803 3300025904 Bacteria 2963
312 Ga0207647_10056951 3300025904 Bacteria 2397
313 Ga0207647_10181346 3300025904 Bacteria 1223
314 Ga0207645_10001405 3300025907 Bacteria 19720
315 Ga0207645_10008531 3300025907 Bacteria 7144
316 Ga0207645_10017904 3300025907 Bacteria 4672
317 Ga0207645_10021378 3300025907 Bacteria 4219
318 Ga0207645_10044955 3300025907 Bacteria 2824
319 Ga0207645_10065681 3300025907 Bacteria 2319
320 Ga0207645_10084007 3300025907 Bacteria 2043
321 Ga0207705_10000059 3300025909 Bacteria 155683
322 Ga0207705_10015898 3300025909 Bacteria 5403
323 Ga0207705_10057848 3300025909 Bacteria 2797
324 Ga0207705_10080074 3300025909 Unclassified 2380
325 Ga0207705_10096032 3300025909 Bacteria 2176
326 Ga0207705_10131559 3300025909 Unclassified 1862
327 Ga0207705_10158202 3300025909 Bacteria 1701
328 Ga0207705_10162250 3300025909 Bacteria 1680
329 Ga0207695_10005397 3300025913 Bacteria 16978
330 Ga0207695_10030964 3300025913 Bacteria 5881
331 Ga0207660_10255691 3300025917 Bacteria 1383
332 Ga0207657_10001957 3300025919 Bacteria 22218
333 Ga0207657_10004884 3300025919 Bacteria 14106
334 Ga0207657_10006537 3300025919 Bacteria 12073
335 Ga0207657_10009689 3300025919 Bacteria 9664
336 Ga0207657_10013496 3300025919 Bacteria 8012
337 Ga0207657_10031287 3300025919 Bacteria 4823
338 Ga0207657_10044470 3300025919 Bacteria 3903
339 Ga0207657_10057765 3300025919 Bacteria 3343
340 Ga0207657_10101975 3300025919 Bacteria 2381
341 Ga0207657_10188588 3300025919 Bacteria 1665
342 Ga0207657_10221124 3300025919 Bacteria 1517
343 Ga0207657_10336441 3300025919 Bacteria 1192
344 Ga0207649_10000995 3300025920 Bacteria 17556
345 Ga0207649_10005727 3300025920 Bacteria 6727
346 Ga0207649_10102869 3300025920 Bacteria 1894
347 Ga0207652_10126197 3300025921 Bacteria 2280
348 Ga0207652_10145899 3300025921 Bacteria 2118
349 Ga0207652_10205832 3300025921 Bacteria 1771
350 Ga0207681_10134595 3300025923 Bacteria 1832
351 Ga0207694_10000403 3300025924 Bacteria 40239
352 Ga0207694_10007248 3300025924 Bacteria 8413
353 Ga0207694_10056011 3300025924 Bacteria 3062
354 Ga0207694_10240080 3300025924 Bacteria 1481
355 Ga0207650_10029607 3300025925 Bacteria 3937
356 Ga0207650_10116611 3300025925 Bacteria 2074
357 Ga0207650_10189740 3300025925 Bacteria 1642
358 Ga0207659_10099290 3300025926 Bacteria 2191
359 Ga0207659_10107239 3300025926 Bacteria 2117
360 Ga0207687_10006295 3300025927 Bacteria 7849
361 Ga0207687_10021375 3300025927 Bacteria 4299
362 Ga0207687_10033290 3300025927 Bacteria 3495
363 Ga0207687_10166985 3300025927 Bacteria 1694
364 Ga0207644_10010285 3300025931 Bacteria 6166
365 Ga0207644_10147483 3300025931 Bacteria 1818
366 Ga0207644_10200762 3300025931 Bacteria 1573
367 Ga0207690_10002871 3300025932 Bacteria 10379
368 Ga0207690_10003131 3300025932 Bacteria 9946
369 Ga0207690_10004084 3300025932 Bacteria 8622
370 Ga0207690_10005550 3300025932 Bacteria 7447
371 Ga0207690_10067822 3300025932 Bacteria 2448
372 Ga0207690_10126823 3300025932 Bacteria 1862
373 Ga0207690_10148764 3300025932 Bacteria 1734
374 Ga0207690_10237732 3300025932 Bacteria 1401
375 Ga0207706_10001825 3300025933 Bacteria 20917
376 Ga0207706_10003606 3300025933 Bacteria 14782
377 Ga0207706_10003799 3300025933 Bacteria 14394
378 Ga0207706_10005754 3300025933 Bacteria 11534
379 Ga0207706_10008383 3300025933 Bacteria 9537
380 Ga0207706_10024216 3300025933 Bacteria 5442
381 Ga0207706_10087713 3300025933 Bacteria 2736
382 Ga0207706_10262946 3300025933 Bacteria 1506
383 Ga0207709_10028789 3300025935 Bacteria 3215
384 Ga0207670_10048386 3300025936 Bacteria 2837
385 Ga0207670_10360424 3300025936 Bacteria 1153
386 Ga0207669_10188329 3300025937 Bacteria 1486
387 Ga0207704_10018921 3300025938 Bacteria 3607
388 Ga0207704_10183349 3300025938 Bacteria 1515
389 Ga0207691_10022429 3300025940 Bacteria 5954
390 Ga0207691_10025350 3300025940 Bacteria 5569
391 Ga0207711_10003521 3300025941 Bacteria 13553
392 Ga0207711_10005167 3300025941 Bacteria 11061
393 Ga0207711_10011225 3300025941 Bacteria 7444
394 Ga0207711_10073462 3300025941 Bacteria 2972
395 Ga0207711_10124213 3300025941 Bacteria 2307
396 Ga0207711_10131525 3300025941 Bacteria 2244
397 Ga0207711_10470173 3300025941 Bacteria 1171
398 Ga0207689_10000017 3300025942 Bacteria 117159
399 Ga0207689_10001652 3300025942 Bacteria 21138
400 Ga0207689_10006882 3300025942 Bacteria 9997
401 Ga0207689_10120570 3300025942 Bacteria 2157
402 Ga0207661_10135049 3300025944 Bacteria 2118
403 Ga0207661_10279547 3300025944 Bacteria 1492
404 Ga0207679_10041651 3300025945 Bacteria 3295
405 Ga0207679_10068614 3300025945 Bacteria 2664
406 Ga0207679_10131196 3300025945 Bacteria 2011
407 Ga0207679_10273777 3300025945 Bacteria 1445
408 Ga0207679_10376486 3300025945 Bacteria 1244
409 Ga0207667_10027300 3300025949 Bacteria 6216
410 Ga0207667_10045014 3300025949 Bacteria 4674
411 Ga0207667_10053039 3300025949 Bacteria 4268
412 Ga0207667_10086209 3300025949 Bacteria 3250
413 Ga0207667_10312786 3300025949 Bacteria 1604
414 Ga0207667_10747368 3300025949 Unclassified 978
415 Ga0207651_10000558 3300025960 Bacteria 15659
416 Ga0207651_10057636 3300025960 Bacteria 2680
417 Ga0207651_10153142 3300025960 Unclassified 1797
418 Ga0207712_10000721 3300025961 Bacteria 25395
419 Ga0207668_10000254 3300025972 Bacteria 35626
420 Ga0207668_10089919 3300025972 Unclassified 2252
421 Ga0207668_10174347 3300025972 Unclassified 1690
422 Ga0207668_10244995 3300025972 Bacteria 1452
423 Ga0207640_10000758 3300025981 Bacteria 18461
424 Ga0207640_10001757 3300025981 Bacteria 11638
425 Ga0207640_10020072 3300025981 Bacteria 3961
426 Ga0207640_10037795 3300025981 Bacteria 3041
427 Ga0207640_10204053 3300025981 Bacteria 1500
428 Ga0207640_10212715 3300025981 Bacteria 1474
429 Ga0207640_10392018 3300025981 Bacteria 1128
430 Ga0207658_10014606 3300025986 Bacteria 5378
431 Ga0207658_10021078 3300025986 Bacteria 4519
432 Ga0207658_10058726 3300025986 Bacteria 2864
433 Ga0207658_10149235 3300025986 Bacteria 1902
434 Ga0207658_10254545 3300025986 Unclassified 1493
435 Ga0207677_10001771 3300026023 Bacteria 11417
436 Ga0207677_10006840 3300026023 Bacteria 6264
437 Ga0207677_10043244 3300026023 Bacteria 2993
438 Ga0207677_10376392 3300026023 Bacteria 1197
439 Ga0207703_10017878 3300026035 Bacteria 5537
440 Ga0207703_10248120 3300026035 Bacteria 1603
441 Ga0207703_10385961 3300026035 Bacteria 1296
442 Ga0207639_10000121 3300026041 Bacteria 59338
443 Ga0207639_10016718 3300026041 Bacteria 5197
444 Ga0207639_10047384 3300026041 Bacteria 3248
445 Ga0207639_10091883 3300026041 Bacteria 2431
446 Ga0207639_10215388 3300026041 Bacteria 1656
447 Ga0207639_10265251 3300026041 Bacteria 1504
448 Ga0207678_10001124 3300026067 Bacteria 24510
449 Ga0207678_10005638 3300026067 Bacteria 11190
450 Ga0207678_10008928 3300026067 Bacteria 8825
451 Ga0207678_10016721 3300026067 Bacteria 6442
452 Ga0207678_10030285 3300026067 Bacteria 4725
453 Ga0207678_10040603 3300026067 Bacteria 4035
454 Ga0207678_10199812 3300026067 Bacteria 1709
455 Ga0207702_10017948 3300026078 Bacteria 5854
456 Ga0207702_10046527 3300026078 Bacteria 3653
457 Ga0207641_10001575 3300026088 Bacteria 22289
458 Ga0207641_10015410 3300026088 Bacteria 6263
459 Ga0207641_10020525 3300026088 Bacteria 5426
460 Ga0207641_10060009 3300026088 Bacteria 3241
461 Ga0207641_10081465 3300026088 Bacteria 2810
462 Ga0207641_10217942 3300026088 Bacteria 1768
463 Ga0207641_10233242 3300026088 Unclassified 1711
464 Ga0207641_10291759 3300026088 Bacteria 1538
465 Ga0207648_10000859 3300026089 Bacteria 34269
466 Ga0207648_10004612 3300026089 Bacteria 14129
467 Ga0207648_10178653 3300026089 Bacteria 1878
468 Ga0207676_10003872 3300026095 Bacteria 10569
469 Ga0207676_10004359 3300026095 Bacteria 10007
470 Ga0207676_10050986 3300026095 Bacteria 3229
471 Ga0207676_10056098 3300026095 Bacteria 3096
472 Ga0207676_10092485 3300026095 Bacteria 2487
473 Ga0207674_10004768 3300026116 Bacteria 16266
474 Ga0207674_10005649 3300026116 Bacteria 14828
475 Ga0207674_10012401 3300026116 Bacteria 9528
476 Ga0207674_10035470 3300026116 Bacteria 5205
477 Ga0207674_10039416 3300026116 Bacteria 4896
478 Ga0207674_10103470 3300026116 Bacteria 2826
479 Ga0207674_10343312 3300026116 Bacteria 1444
480 Ga0207675_100015343 3300026118 Bacteria 7148
481 Ga0207675_100024209 3300026118 Bacteria 5645
482 Ga0207675_100156184 3300026118 Bacteria 2174
483 Ga0207683_10003167 3300026121 Bacteria 14364
484 Ga0207698_10001440 3300026142 Bacteria 13830
485 Ga0207698_10012341 3300026142 Bacteria 5588
486 Ga0207698_10038974 3300026142 Bacteria 3516
487 Ga0207698_10109053 3300026142 Bacteria 2315
488 Ga0207698_10158078 3300026142 Bacteria 1978
489 Ga0207698_10213373 3300026142 Bacteria 1738
490 Ga0209974_10021328 3300027876 Bacteria 2145
491 Ga0268266_10005668 3300028379 Bacteria 11581
492 Ga0268266_10121973 3300028379 Unclassified 2320
493 Ga0268265_10009589 3300028380 Bacteria 6538
494 Ga0268265_10016444 3300028380 Bacteria 5082
495 Ga0268265_10027801 3300028380 Bacteria 4041
496 Ga0268265_10062866 3300028380 Bacteria 2854
497 Ga0268265_10081562 3300028380 Unclassified 2554
498 Ga0268265_10185828 3300028380 Bacteria 1790
499 Ga0268264_10006093 3300028381 Bacteria 10188
500 Ga0268264_10027798 3300028381 Bacteria 4624
501 Ga0268264_10051485 3300028381 Bacteria 3431
502 Ga0268264_10271271 3300028381 Bacteria 1585
503 Ga0316182_1176152 3300030745 Unclassified 2961
504 Ga0307408_100088277 3300031548 Bacteria 2335
505 Ga0307408_100113498 3300031548 Bacteria 2086
506 Ga0307408_100160792 3300031548 Bacteria 1784
507 Ga0307408_100219030 3300031548 Bacteria 1552
508 Ga0307408_100518084 3300031548 Unclassified 1047
509 Ga0307405_10018433 3300031731 Bacteria 3851
510 Ga0307405_10119065 3300031731 Bacteria 1804
511 Ga0307405_10141851 3300031731 Bacteria 1677
512 Ga0307405_10242602 3300031731 Bacteria 1336
513 Ga0307410_10005352 3300031852 Bacteria 6785
514 Ga0307410_10009857 3300031852 Bacteria 5381
515 Ga0307410_10025314 3300031852 Bacteria 3721
516 Ga0307410_10166478 3300031852 Bacteria 1657
517 Ga0307410_10243740 3300031852 Bacteria 1394
518 Ga0307406_10061497 3300031901 Bacteria 2425
519 Ga0307406_10071587 3300031901 Bacteria 2273
520 Ga0307406_10247553 3300031901 Bacteria 1341
521 Ga0307406_10332936 3300031901 Bacteria 1179
522 Ga0307407_10019421 3300031903 Bacteria 3460
523 Ga0307407_10071879 3300031903 Bacteria 2061
524 Ga0307407_10086039 3300031903 Bacteria 1914
525 Ga0307412_10103009 3300031911 Bacteria 2022
526 Ga0307412_10226295 3300031911 Bacteria 1437
527 Ga0307409_100005595 3300031995 Bacteria 7267
528 Ga0307409_100009375 3300031995 Bacteria 6010
529 Ga0307409_100053617 3300031995 Bacteria 3100
530 Ga0307409_100076151 3300031995 Unclassified 2689
531 Ga0307409_100119833 3300031995 Bacteria 2226
532 Ga0307409_100163973 3300031995 Bacteria 1947
533 Ga0307409_100304213 3300031995 Unclassified 1485
534 Ga0307409_100351614 3300031995 Bacteria 1391
535 Ga0307409_100716611 3300031995 Bacteria 1001
536 Ga0307416_100006819 3300032002 Bacteria 7186
537 Ga0307416_100203563 3300032002 Bacteria 1881
538 Ga0307416_100208123 3300032002 Bacteria 1863
539 Ga0307416_100315187 3300032002 Bacteria 1563
540 Ga0307414_10017873 3300032004 Bacteria 4350
541 Ga0307414_10024650 3300032004 Bacteria 3840
542 Ga0307414_10075222 3300032004 Bacteria 2450
543 Ga0307414_10149934 3300032004 Bacteria 1838
544 Ga0307414_10158447 3300032004 Bacteria 1795
545 Ga0307414_10233683 3300032004 Bacteria 1517
546 Ga0307414_10296430 3300032004 Bacteria 1366
547 Ga0307411_10001842 3300032005 Bacteria 9002
548 Ga0307411_10006954 3300032005 Bacteria 5710
549 Ga0307411_10027963 3300032005 Bacteria 3421
550 Ga0307411_10092083 3300032005 Bacteria 2119
551 Ga0307411_10293894 3300032005 Bacteria 1299
552 Ga0307415_100002064 3300032126 Bacteria 9927
553 Ga0307415_100010365 3300032126 Bacteria 5276
554 Ga0307415_100383483 3300032126 Bacteria 1194
555 Ga0395899_0001256 3300037312 Bacteria 22053
556 Ga0395899_0010395 3300037312 Bacteria 7131
557 Ga0395899_0020000 3300037312 Bacteria 5079
558 Ga0395899_0021341 3300037312 Bacteria 4912
559 Ga0395899_0093113 3300037312 Bacteria 2181
560 Ga0395899_0119689 3300037312 Unclassified 1887
561 Ga0395899_0150162 3300037312 Unclassified 1652
562 Ga0395900_0000368 3300037418 Bacteria 64936
563 Ga0395900_0002077 3300037418 Bacteria 22469
564 Ga0395900_0007022 3300037418 Bacteria 11662
565 Ga0395900_0010230 3300037418 Bacteria 9595
566 Ga0395900_0011623 3300037418 Bacteria 9008
567 Ga0395900_0012516 3300037418 Bacteria 8678
568 Ga0395900_0023800 3300037418 Bacteria 6266
569 Ga0395900_0029297 3300037418 Bacteria 5648
570 Ga0395900_0030279 3300037418 Bacteria 5556
571 Ga0395900_0039301 3300037418 Bacteria 4874
572 Ga0395900_0043130 3300037418 Bacteria 4648
573 Ga0395900_0054846 3300037418 Bacteria 4104
574 Ga0395900_0156287 3300037418 Bacteria 2329
575 Ga0395900_0196156 3300037418 Bacteria 2045
576 Ga0395900_0379954 3300037418 Bacteria 1381
577 Ga0395900_0610497 3300037418 Bacteria 1030
578 Ga0395898_0003317 3300037466 Bacteria 18077
579 Ga0395898_0007944 3300037466 Bacteria 11254
580 Ga0395898_0012679 3300037466 Bacteria 8710
581 Ga0395898_0015933 3300037466 Bacteria 7703
582 Ga0395898_0044500 3300037466 Bacteria 4369
583 Ga0395898_0055664 3300037466 Bacteria 3858
584 Ga0395898_0059334 3300037466 Bacteria 3722
585 Ga0395898_0083485 3300037466 Bacteria 3079
586 Ga0395898_0100325 3300037466 Unclassified 2780
587 Ga0395898_0189295 3300037466 Bacteria 1966
588 Ga0395898_0663051 3300037466 Bacteria 985
589 Ga0395905_0004441 3300037471 Bacteria 14579
590 Ga0395905_0005770 3300037471 Bacteria 12582
591 Ga0395905_0006170 3300037471 Bacteria 12098
592 Ga0395905_0007532 3300037471 Bacteria 10825
593 Ga0395905_0020460 3300037471 Bacteria 6270
594 Ga0395905_0022666 3300037471 Bacteria 5937
595 Ga0395905_0022869 3300037471 Bacteria 5910
596 Ga0395905_0029561 3300037471 Bacteria 5163
597 Ga0395905_0064243 3300037471 Bacteria 3434
598 Ga0395905_0072683 3300037471 Bacteria 3224
599 Ga0395905_0093850 3300037471 Bacteria 2814
600 Ga0395905_0162642 3300037471 Bacteria 2097
601 Ga0395905_0223707 3300037471 Bacteria 1761
602 Ga0395905_0241577 3300037471 Bacteria 1687
603 Ga0395905_0252841 3300037471 Bacteria 1646
604 Ga0395905_0260921 3300037471 Bacteria 1618
605 Ga0395905_0447668 3300037471 Unclassified 1189
606 Ga0395905_0486376 3300037471 Unclassified 1134
607 Ga0436364_0316431 3300037853 Bacteria 18776
608 Ga0395901_0000041 3300038443 Bacteria 202314
609 Ga0395901_0000064 3300038443 Bacteria 147477
610 Ga0395901_0002872 3300038443 Bacteria 17392
611 Ga0395901_0020194 3300038443 Bacteria 6819
612 Ga0395901_0038715 3300038443 Bacteria 4932
613 Ga0395901_0062211 3300038443 Bacteria 3885
614 Ga0395901_0073309 3300038443 Bacteria 3570
615 Ga0395901_0079274 3300038443 Bacteria 3429
616 Ga0395901_0091365 3300038443 Bacteria 3187
617 Ga0395901_0172605 3300038443 Bacteria 2268
618 Ga0395901_0176826 3300038443 Unclassified 2238
619 Ga0395901_0195022 3300038443 Unclassified 2124
620 Ga0395901_0213156 3300038443 Unclassified 2021
621 Ga0395901_0279514 3300038443 Bacteria 1734
622 Ga0395901_0287914 3300038443 Bacteria 1705
623 Ga0395901_0366927 3300038443 Bacteria 1484
624 Ga0395901_0451002 3300038443 Bacteria 1315
625 Ga0395901_0469716 3300038443 Unclassified 1284
626 Ga0395901_0642361 3300038443 Bacteria 1065
627 Ga0439455_0023771 3300042012 Bacteria 1478
628 Ga0439458_0000215 3300042157 Bacteria 13572
629 Ga0439464_0028413 3300042439 Bacteria 1559
630 Ga0466969_0075087 3300044656 Bacteria 1621
631 Ga0466966_0000282 3300044684 Bacteria 33331
632 Ga0466966_0024285 3300044684 Bacteria 3965
633 Ga0466966_0038827 3300044684 Bacteria 3066
634 Ga0466961_0023357 3300044693 Bacteria 3978
635 Ga0466961_0114216 3300044693 Bacteria 1697
636 Ga0466963_0082094 3300044694 Bacteria 2184
637 Ga0466963_0119319 3300044694 Bacteria 1814
638 Ga0466963_0124512 3300044694 Bacteria 1776
639 Ga0466963_0352828 3300044694 Bacteria 1036
640 Ga0466964_0035971 3300044706 Bacteria 1983
641 Ga0466971_0067954 3300044719 Bacteria 1616
642 Ga0466968_0016015 3300044735 Bacteria 2979
643 Ga0466970_0016012 3300044765 Bacteria 3861
644 Ga0466970_0218087 3300044765 Bacteria 1064
645 Ga0466957_0049019 3300044842 Bacteria 2567
646 Ga0466957_0079157 3300044842 Bacteria 2045
647 Ga0466957_0118480 3300044842 Bacteria 1686
648 Ga0466959_0181910 3300045049 Bacteria 1470
649 Ga0466958_0039138 3300045836 Bacteria 2847
650 Ga0466967_0021889 3300045976 Bacteria 5203
651 Ga0466967_0040274 3300045976 Bacteria 4022
652 Ga0466967_0059229 3300045976 Bacteria 3389
653 Ga0466967_0185347 3300045976 Unclassified 1965
654 Ga0466967_0423070 3300045976 Bacteria 1298
655 Ga0495668_0047406 3300046616 Bacteria 2386
656 Ga0495669_0040901 3300046684 Bacteria 2057
657 Ga0495669_0097672 3300046684 Bacteria 1362
658 Ga0495687_095672 3300047443 Unclassified 1126
659 Ga0496102_0120614 3300048905 Bacteria 2449
660 Ga0496103_0098030 3300048906 Bacteria 1853
661 Ga0496107_0080291 3300048910 Unclassified 2378
662 Ga0496107_0226761 3300048910 Bacteria 1390
663 Ga0496107_0261883 3300048910 Bacteria 1287
664 Ga0496108_0310839 3300048911 Bacteria 1373
665 Ga0496109_0198615 3300048912 Bacteria 1885
666 Ga0496110_0411237 3300048913 Bacteria 1233
667 Ga0496111_0010678 3300048914 Bacteria 6176
668 Ga0496111_0207513 3300048914 Bacteria 1456
669 Ga0496112_0012269 3300048915 Bacteria 7869
670 Ga0496112_0051609 3300048915 Bacteria 4034
671 nmdc:mga06r32_3333_c2 3300050510 Bacteria 7853
672 nmdc:mga0rr50_157054_c1 3300050513 Bacteria 1843
673 nmdc:mga0a205_13953_c1 3300050515 Bacteria 7492
674 Ga0500658_0000072 3300053134 Bacteria 46284
675 Ga0466962_0064935 3300061719 Bacteria 1742
676 Ga0070660_100018682
677 JGI24736J21556_1001638
678 JGI24747J21853_1003056
679 JGI24739J22299_10001181
680 JGI24739J22299_10023688
681 JGI24737J22298_10005984
682 JGI24737J22298_10012166
683 JGI24735J21928_10002331
684 JGI24738J21930_10001170
685 JGI24738J21930_10019942
686 JGI24744J21845_10000023
687 Ga0070658_10083311
688 Ga0070658_10177544
689 Ga0070658_10204795
690 Ga0070658_10220668
691 Ga0070658_10295667
692 Ga0070676_10013601
693 Ga0070676_10033735
694 Ga0070676_10038736
695 Ga0070676_10045224
696 Ga0070676_10076821
697 Ga0070676_10133467
698 Ga0070683_100247905
699 Ga0070683_100322684
700 Ga0070670_100015213
701 Ga0070670_100029293
702 Ga0070670_100276796
703 Ga0070670_100496892
704 Ga0070677_10086869
705 Ga0070677_10137766
706 Ga0068869_100000611
707 Ga0068869_100011274
708 Ga0068869_100106791
709 Ga0068869_100210293
710 Ga0070680_100059271
711 Ga0070682_100166037
712 Ga0068868_100001045
713 Ga0068868_100002511
714 Ga0068868_100014559
715 Ga0068868_100064165
716 Ga0070660_100005465
717 Ga0070660_100007968
718 Ga0070660_100036759
719 Ga0070660_100045319
720 Ga0070660_100101534
721 Ga0070689_100050684
722 Ga0070689_100213639
723 Ga0070661_100014125
724 Ga0070661_100031802
725 Ga0070661_100139025
726 Ga0070661_100250944
727 Ga0070692_10117802
728 Ga0070692_10128529
729 Ga0070668_100000431
730 Ga0070668_100010308
731 Ga0070668_100042329
732 Ga0070669_100001196
733 Ga0070669_100056196
734 Ga0070669_100235028
735 Ga0070675_100097483
736 Ga0070671_100045787
737 Ga0070671_100060530
738 Ga0070671_100089569
739 Ga0070671_100212262
740 Ga0070671_100442450
741 Ga0070674_100025535
742 Ga0070674_100067876
743 Ga0070674_100374976
744 Ga0070673_100000262
745 Ga0070673_100013977
746 Ga0070673_100197558
747 Ga0070673_100262589
748 Ga0070673_100311487
749 Ga0070673_100367862
750 Ga0070659_100000972
751 Ga0070659_100002128
752 Ga0070659_100008755
753 Ga0070659_100009122
754 Ga0070659_100032202
755 Ga0070659_100033781
756 Ga0070659_100093888
757 Ga0070659_100115727
758 Ga0070659_100134186
759 Ga0070659_100248830
760 Ga0070659_100447234
761 Ga0070667_100006111
762 Ga0070667_100008789
763 Ga0070667_100019050
764 Ga0070667_100060123
765 Ga0070667_100090560
766 Ga0070694_100004297
767 Ga0070663_100013719
768 Ga0070663_100052988
769 Ga0070663_100166578
770 Ga0070663_100176084
771 Ga0070663_100252801
772 Ga0070663_100378991
773 Ga0070678_100044133
774 Ga0070678_100183457
775 Ga0070662_100000323
776 Ga0070662_100014533
777 Ga0070662_100015525
778 Ga0070662_100017903
779 Ga0070662_100027411
780 Ga0070662_100060539
781 Ga0070662_100077205
782 Ga0070681_10014899
783 Ga0070681_10206149
784 Ga0070681_10212930
785 Ga0068867_100013784
786 Ga0068867_100021913
787 Ga0068867_100073559
788 Ga0068867_100148213
789 Ga0068867_100159468
790 Ga0068867_100227906
791 Ga0070679_100181783
792 Ga0070679_100187403
793 Ga0070684_100241427
794 Ga0070684_100418948
795 Ga0068853_100004654
796 Ga0068853_100083910
797 Ga0068853_100105927
798 Ga0068853_100189813
799 Ga0068853_100199837
800 Ga0068853_100290703
801 Ga0068853_100349835
802 Ga0068853_100534097
803 Ga0070672_100000647
804 Ga0070695_100112074
805 Ga0070693_100047650
806 Ga0070693_100071321
807 Ga0070665_100002737
808 Ga0070665_100006889
809 Ga0070665_100175898
810 Ga0070665_100356167
811 Ga0070704_100073928
812 Ga0068855_100016601
813 Ga0068855_100035286
814 Ga0068855_100095054
815 Ga0068855_100121645
816 Ga0068855_100411833
817 Ga0068855_100478433
818 Ga0070664_100030968
819 Ga0070664_100048343
820 Ga0070664_100063255
821 Ga0070664_100063276
822 Ga0070664_100109423
823 Ga0070664_100131281
824 Ga0070664_100229990
825 Ga0070664_100231248
826 Ga0070664_100250702
827 Ga0068857_100002656
828 Ga0068857_100002954
829 Ga0068857_100015018
830 Ga0068857_100082082
831 Ga0068857_100082692
832 Ga0068857_100306101
833 Ga0068854_100001315
834 Ga0068854_100013360
835 Ga0068854_100023211
836 Ga0068854_100032965
837 Ga0068854_100146387
838 Ga0068854_100204091
839 Ga0068854_100220811
840 Ga0068854_100248599
841 Ga0068854_100346097
842 Ga0068856_100026026
843 Ga0068856_100061331
844 Ga0070702_100161950
845 Ga0068852_100002402
846 Ga0068852_100003288
847 Ga0068852_100007580
848 Ga0068852_100045769
849 Ga0068852_100098819
850 Ga0068852_100105913
851 Ga0068852_100270352
852 Ga0068859_100000978
853 Ga0068859_100066043
854 Ga0068859_100078438
855 Ga0068859_100098597
856 Ga0068859_100287196
857 Ga0068859_100291365
858 Ga0068859_100303911
859 Ga0068864_100000222
860 Ga0068864_100006950
861 Ga0068864_100039661
862 Ga0068864_100098612
863 Ga0068864_100139980
864 Ga0068864_100235502
865 Ga0068861_100028076
866 Ga0068851_10004351
867 Ga0068851_10018334
868 Ga0068851_10054653
869 Ga0068870_10017762
870 Ga0068863_100003001
871 Ga0068863_100008351
872 Ga0068863_100044627
873 Ga0068863_100144790
874 Ga0068863_100377686
875 Ga0068858_100147033
876 Ga0068858_100441155
877 Ga0068860_100004347
878 Ga0068860_100005308
879 Ga0068860_100022263
880 Ga0068860_100089549
881 Ga0068860_100209975
882 Ga0068862_100005318
883 Ga0068862_100065957
884 Ga0068862_100100891
885 Ga0068862_100102803
886 Ga0081539_10007926
887 Ga0081539_10015138
888 Ga0070717_10083127
889 Ga0075366_10207894
890 Ga0097621_100058624
891 Ga0097621_100141523
892 Ga0068871_100081797
893 Ga0068871_100180261
894 Ga0075431_100000885
895 Ga0075434_100105515
896 Ga0068865_100006977
897 Ga0068865_100199495
898 Ga0097620_100000978
899 Ga0097620_100066046
900 Ga0097620_100078435
901 Ga0097620_100098599
902 Ga0097620_100287220
903 Ga0097620_100291347
904 Ga0097620_100303927
905 Ga0105251_10046703
906 Ga0105250_10079823
907 Ga0105240_10007907
908 Ga0105240_10244398
909 Ga0105240_10316406
910 Ga0105245_10001658
911 Ga0105245_10037688
912 Ga0105245_10038946
913 Ga0105245_10074409
914 Ga0105247_10116956
915 Ga0105243_10006957
916 Ga0105243_10109364
917 Ga0105243_10146879
918 Ga0105241_10138577
919 Ga0105241_10255075
920 Ga0105242_10182099
921 Ga0105248_10001119
922 Ga0105248_10007549
923 Ga0105248_10021445
924 Ga0105248_10090223
925 Ga0105248_10092601
926 Ga0105248_10137212
927 Ga0105248_10165576
928 Ga0105238_10008769
929 Ga0105238_10011654
930 Ga0105238_10040891
931 Ga0105249_10027871
932 Ga0105249_10360551
933 Ga0105239_10054510
934 Ga0105239_10179067
935 Ga0105239_10320191
936 Ga0105246_10070190
937 Ga0105246_10138102
938 Ga0157373_10011058
939 Ga0157373_10014984
940 Ga0157373_10033733
941 Ga0157373_10064514
942 Ga0157373_10067993
943 Ga0157373_10072132
944 Ga0157373_10229238
945 Ga0157371_10004984
946 Ga0157371_10103416
947 Ga0157371_10105831
948 Ga0157371_10126849
949 Ga0157370_10009555
950 Ga0157370_10099113
951 Ga0157369_10002143
952 Ga0157369_10004627
953 Ga0157369_10133073
954 Ga0157369_10243323
955 Ga0157374_10062082
956 Ga0157374_10184616
957 Ga0157374_10216286
958 Ga0163162_10087499
959 Ga0163162_10094810
960 Ga0157372_10096003
961 Ga0157372_10257515
962 Ga0157372_10266996
963 Ga0157372_10373384
964 Ga0157375_10208900
965 Ga0157375_10251211
966 Ga0163163_10200310
967 Ga0163163_10410291
968 Ga0163163_10665433
969 Ga0157379_10094217
970 Ga0157379_10115587
971 Ga0157379_10273288
972 Ga0207697_10000228
973 Ga0207656_10032012
974 Ga0207682_10007246
975 Ga0207682_10021679
976 Ga0207642_10021601
977 Ga0207688_10000145
978 Ga0207688_10000767
979 Ga0207688_10027386
980 Ga0207688_10154198
981 Ga0207680_10012158
982 Ga0207680_10123411
983 Ga0207647_10000114
984 Ga0207647_10001417
985 Ga0207647_10011940
986 Ga0207647_10039803
987 Ga0207647_10056951
988 Ga0207647_10181346
989 Ga0207645_10001405
990 Ga0207645_10008531
991 Ga0207645_10017904
992 Ga0207645_10021378
993 Ga0207645_10044955
994 Ga0207645_10065681
995 Ga0207645_10084007
996 Ga0207705_10000059
997 Ga0207705_10015898
998 Ga0207705_10057848
999 Ga0207705_10080074
1000 Ga0207705_10096032
1001 Ga0207705_10131559
1002 Ga0207705_10158202
1003 Ga0207705_10162250
1004 Ga0207695_10005397
1005 Ga0207695_10030964
1006 Ga0207660_10255691
1007 Ga0207657_10001957
1008 Ga0207657_10004884
1009 Ga0207657_10006537
1010 Ga0207657_10009689
1011 Ga0207657_10013496
1012 Ga0207657_10031287
1013 Ga0207657_10044470
1014 Ga0207657_10057765
1015 Ga0207657_10101975
1016 Ga0207657_10188588
1017 Ga0207657_10221124
1018 Ga0207657_10336441
1019 Ga0207649_10000995
1020 Ga0207649_10005727
1021 Ga0207649_10102869
1022 Ga0207652_10126197
1023 Ga0207652_10145899
1024 Ga0207652_10205832
1025 Ga0207681_10134595
1026 Ga0207694_10000403
1027 Ga0207694_10007248
1028 Ga0207694_10056011
1029 Ga0207694_10240080
1030 Ga0207650_10029607
1031 Ga0207650_10116611
1032 Ga0207650_10189740
1033 Ga0207659_10099290
1034 Ga0207659_10107239
1035 Ga0207687_10006295
1036 Ga0207687_10021375
1037 Ga0207687_10033290
1038 Ga0207687_10166985
1039 Ga0207644_10010285
1040 Ga0207644_10147483
1041 Ga0207644_10200762
1042 Ga0207690_10002871
1043 Ga0207690_10003131
1044 Ga0207690_10004084
1045 Ga0207690_10005550
1046 Ga0207690_10067822
1047 Ga0207690_10126823
1048 Ga0207690_10148764
1049 Ga0207690_10237732
1050 Ga0207706_10001825
1051 Ga0207706_10003606
1052 Ga0207706_10003799
1053 Ga0207706_10005754
1054 Ga0207706_10008383
1055 Ga0207706_10024216
1056 Ga0207706_10087713
1057 Ga0207706_10262946
1058 Ga0207709_10028789
1059 Ga0207670_10048386
1060 Ga0207670_10360424
1061 Ga0207669_10188329
1062 Ga0207704_10018921
1063 Ga0207704_10183349
1064 Ga0207691_10022429
1065 Ga0207691_10025350
1066 Ga0207711_10003521
1067 Ga0207711_10005167
1068 Ga0207711_10011225
1069 Ga0207711_10073462
1070 Ga0207711_10124213
1071 Ga0207711_10131525
1072 Ga0207711_10470173
1073 Ga0207689_10000017
1074 Ga0207689_10001652
1075 Ga0207689_10006882
1076 Ga0207689_10120570
1077 Ga0207661_10135049
1078 Ga0207661_10279547
1079 Ga0207679_10041651
1080 Ga0207679_10068614
1081 Ga0207679_10131196
1082 Ga0207679_10273777
1083 Ga0207679_10376486
1084 Ga0207667_10027300
1085 Ga0207667_10045014
1086 Ga0207667_10053039
1087 Ga0207667_10086209
1088 Ga0207667_10312786
1089 Ga0207667_10747368
1090 Ga0207651_10000558
1091 Ga0207651_10057636
1092 Ga0207651_10153142
1093 Ga0207712_10000721
1094 Ga0207668_10000254
1095 Ga0207668_10089919
1096 Ga0207668_10174347
1097 Ga0207668_10244995
1098 Ga0207640_10000758
1099 Ga0207640_10001757
1100 Ga0207640_10020072
1101 Ga0207640_10037795
1102 Ga0207640_10204053
1103 Ga0207640_10212715
1104 Ga0207640_10392018
1105 Ga0207658_10014606
1106 Ga0207658_10021078
1107 Ga0207658_10058726
1108 Ga0207658_10149235
1109 Ga0207658_10254545
1110 Ga0207677_10001771
1111 Ga0207677_10006840
1112 Ga0207677_10043244
1113 Ga0207677_10376392
1114 Ga0207703_10017878
1115 Ga0207703_10248120
1116 Ga0207703_10385961
1117 Ga0207639_10000121
1118 Ga0207639_10016718
1119 Ga0207639_10047384
1120 Ga0207639_10091883
1121 Ga0207639_10215388
1122 Ga0207639_10265251
1123 Ga0207678_10001124
1124 Ga0207678_10005638
1125 Ga0207678_10008928
1126 Ga0207678_10016721
1127 Ga0207678_10030285
1128 Ga0207678_10040603
1129 Ga0207678_10199812
1130 Ga0207702_10017948
1131 Ga0207702_10046527
1132 Ga0207641_10001575
1133 Ga0207641_10015410
1134 Ga0207641_10020525
1135 Ga0207641_10060009
1136 Ga0207641_10081465
1137 Ga0207641_10217942
1138 Ga0207641_10233242
1139 Ga0207641_10291759
1140 Ga0207648_10000859
1141 Ga0207648_10004612
1142 Ga0207648_10178653
1143 Ga0207676_10003872
1144 Ga0207676_10004359
1145 Ga0207676_10050986
1146 Ga0207676_10056098
1147 Ga0207676_10092485
1148 Ga0207674_10004768
1149 Ga0207674_10005649
1150 Ga0207674_10012401
1151 Ga0207674_10035470
1152 Ga0207674_10039416
1153 Ga0207674_10103470
1154 Ga0207674_10343312
1155 Ga0207675_100015343
1156 Ga0207675_100024209
1157 Ga0207675_100156184
1158 Ga0207683_10003167
1159 Ga0207698_10001440
1160 Ga0207698_10012341
1161 Ga0207698_10038974
1162 Ga0207698_10109053
1163 Ga0207698_10158078
1164 Ga0207698_10213373
1165 Ga0209974_10021328
1166 Ga0268266_10005668
1167 Ga0268266_10121973
1168 Ga0268265_10009589
1169 Ga0268265_10016444
1170 Ga0268265_10027801
1171 Ga0268265_10062866
1172 Ga0268265_10081562
1173 Ga0268265_10185828
1174 Ga0268264_10006093
1175 Ga0268264_10027798
1176 Ga0268264_10051485
1177 Ga0268264_10271271
1178 Ga0316182_1176152
1179 Ga0307408_100088277
1180 Ga0307408_100113498
1181 Ga0307408_100160792
1182 Ga0307408_100219030
1183 Ga0307408_100518084
1184 Ga0307405_10018433
1185 Ga0307405_10119065
1186 Ga0307405_10141851
1187 Ga0307405_10242602
1188 Ga0307410_10005352
1189 Ga0307410_10009857
1190 Ga0307410_10025314
1191 Ga0307410_10166478
1192 Ga0307410_10243740
1193 Ga0307406_10061497
1194 Ga0307406_10071587
1195 Ga0307406_10247553
1196 Ga0307406_10332936
1197 Ga0307407_10019421
1198 Ga0307407_10071879
1199 Ga0307407_10086039
1200 Ga0307412_10103009
1201 Ga0307412_10226295
1202 Ga0307409_100005595
1203 Ga0307409_100009375
1204 Ga0307409_100053617
1205 Ga0307409_100076151
1206 Ga0307409_100119833
1207 Ga0307409_100163973
1208 Ga0307409_100304213
1209 Ga0307409_100351614
1210 Ga0307409_100716611
1211 Ga0307416_100006819
1212 Ga0307416_100203563
1213 Ga0307416_100208123
1214 Ga0307416_100315187
1215 Ga0307414_10017873
1216 Ga0307414_10024650
1217 Ga0307414_10075222
1218 Ga0307414_10149934
1219 Ga0307414_10158447
1220 Ga0307414_10233683
1221 Ga0307414_10296430
1222 Ga0307411_10001842
1223 Ga0307411_10006954
1224 Ga0307411_10027963
1225 Ga0307411_10092083
1226 Ga0307411_10293894
1227 Ga0307415_100002064
1228 Ga0307415_100010365
1229 Ga0307415_100383483
1230 Ga0395899_0001256
1231 Ga0395899_0010395
1232 Ga0395899_0020000
1233 Ga0395899_0021341
1234 Ga0395899_0093113
1235 Ga0395899_0119689
1236 Ga0395899_0150162
1237 Ga0395900_0000368
1238 Ga0395900_0002077
1239 Ga0395900_0007022
1240 Ga0395900_0010230
1241 Ga0395900_0011623
1242 Ga0395900_0012516
1243 Ga0395900_0023800
1244 Ga0395900_0029297
1245 Ga0395900_0030279
1246 Ga0395900_0039301
1247 Ga0395900_0043130
1248 Ga0395900_0054846
1249 Ga0395900_0156287
1250 Ga0395900_0196156
1251 Ga0395900_0379954
1252 Ga0395900_0610497
1253 Ga0395898_0003317
1254 Ga0395898_0007944
1255 Ga0395898_0012679
1256 Ga0395898_0015933
1257 Ga0395898_0044500
1258 Ga0395898_0055664
1259 Ga0395898_0059334
1260 Ga0395898_0083485
1261 Ga0395898_0100325
1262 Ga0395898_0189295
1263 Ga0395898_0663051
1264 Ga0395905_0004441
1265 Ga0395905_0005770
1266 Ga0395905_0006170
1267 Ga0395905_0007532
1268 Ga0395905_0020460
1269 Ga0395905_0022666
1270 Ga0395905_0022869
1271 Ga0395905_0029561
1272 Ga0395905_0064243
1273 Ga0395905_0072683
1274 Ga0395905_0093850
1275 Ga0395905_0162642
1276 Ga0395905_0223707
1277 Ga0395905_0241577
1278 Ga0395905_0252841
1279 Ga0395905_0260921
1280 Ga0395905_0447668
1281 Ga0395905_0486376
1282 Ga0436364_0316431
1283 Ga0395901_0000041
1284 Ga0395901_0000064
1285 Ga0395901_0002872
1286 Ga0395901_0020194
1287 Ga0395901_0038715
1288 Ga0395901_0062211
1289 Ga0395901_0073309
1290 Ga0395901_0079274
1291 Ga0395901_0091365
1292 Ga0395901_0172605
1293 Ga0395901_0176826
1294 Ga0395901_0195022
1295 Ga0395901_0213156
1296 Ga0395901_0279514
1297 Ga0395901_0287914
1298 Ga0395901_0366927
1299 Ga0395901_0451002
1300 Ga0395901_0469716
1301 Ga0395901_0642361
1302 Ga0439455_0023771
1303 Ga0439458_0000215
1304 Ga0439464_0028413
1305 Ga0466969_0075087
1306 Ga0466966_0000282
1307 Ga0466966_0024285
1308 Ga0466966_0038827
1309 Ga0466961_0023357
1310 Ga0466961_0114216
1311 Ga0466963_0082094
1312 Ga0466963_0119319
1313 Ga0466963_0124512
1314 Ga0466963_0352828
1315 Ga0466964_0035971
1316 Ga0466971_0067954
1317 Ga0466968_0016015
1318 Ga0466970_0016012
1319 Ga0466970_0218087
1320 Ga0466957_0049019
1321 Ga0466957_0079157
1322 Ga0466957_0118480
1323 Ga0466959_0181910
1324 Ga0466958_0039138
1325 Ga0466967_0021889
1326 Ga0466967_0040274
1327 Ga0466967_0059229
1328 Ga0466967_0185347
1329 Ga0466967_0423070
1330 Ga0495668_0047406
1331 Ga0495669_0040901
1332 Ga0495669_0097672
1333 Ga0495687_095672
1334 Ga0496102_0120614
1335 Ga0496103_0098030
1336 Ga0496107_0080291
1337 Ga0496107_0226761
1338 Ga0496107_0261883
1339 Ga0496108_0310839
1340 Ga0496109_0198615
1341 Ga0496110_0411237
1342 Ga0496111_0010678
1343 Ga0496111_0207513
1344 Ga0496112_0012269
1345 Ga0496112_0051609
1346 nmdc:mga06r32_3333_c2
1347 nmdc:mga0rr50_157054_c1
1348 nmdc:mga0a205_13953_c1
1349 Ga0500658_0000072
1350 Ga0466962_0064935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

113

216

0.93

Map