F474397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 674 | 374 | 599 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0000022|Ga0501034_0000022_253051_253647 |
| Length | 198 |
| Sequence | MAFPRPPASRTIFLLHLTDEVSLNMRRLLSVTLTGMATVPFAGPVLAADLNVKVEIPRLNVAEYHKPYVAMWVERADQGPVQTLAVWYDGKLKENEGTKWLKDMRQWWRKAGRDLNMPADGISGATRAPGEHTVSFRDGKNPLGKLPAGDYQLVVEAAREVGGRELVRVPFTWPPQSAQTARARGDHELGGVTVDLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 4 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 5 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 6 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 7 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 8 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 9 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 10 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 11 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 12 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 13 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 14 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 15 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 16 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 17 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 18 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 19 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 20 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 21 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 22 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 23 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 24 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 25 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 26 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 27 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 28 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 29 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 30 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 31 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 32 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 33 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 34 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 35 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 36 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 37 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 38 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 39 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 40 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 41 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 42 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 43 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 44 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 45 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 46 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 47 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 48 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 49 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 50 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 51 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 52 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 53 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 54 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 55 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 56 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 57 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 58 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 59 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 60 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 61 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 62 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 63 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 64 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 65 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 66 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 67 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 68 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 69 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 70 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 71 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 72 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 73 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 74 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 75 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 76 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 77 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 78 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 79 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 80 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 81 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 82 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 94 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 95 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 111 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 120 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 121 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 127 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 128 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 129 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 233 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 234 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 236 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 237 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 240 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 241 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 242 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 243 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 244 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 245 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 246 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 247 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 248 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 249 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 354 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 355 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 357 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 363 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 369 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 370 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 371 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 372 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 373 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 374 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.87 |
| Metatranscriptomes | 0 |
| Isolates | 11.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.29 |
| Nodule | 2.97 |
| Rhizoplane | 1.63 |
| Rhizosphere | 57.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002736 | 3300001904 | Bacteria | 3085 |
| 2 | JGI24740J21852_10009636 | 3300001979 | Bacteria | 3769 |
| 3 | JGI24735J21928_10033649 | 3300002067 | Bacteria | 1513 |
| 4 | JGI25156J39149_1000112 | 3300002705 | Bacteria | 59192 |
| 5 | JGI25156J39149_1000128 | 3300002705 | Bacteria | 56012 |
| 6 | JGI25156J39149_1002904 | 3300002705 | Bacteria | 5855 |
| 7 | JGI25162J39368_1004893 | 3300002737 | Bacteria | 2871 |
| 8 | JGI25154J39366_1000125 | 3300002738 | Bacteria | 61587 |
| 9 | JGI25154J39366_1000143 | 3300002738 | Bacteria | 56016 |
| 10 | JGI25154J39366_1000228 | 3300002738 | Bacteria | 37567 |
| 11 | JGI25157J39369_1000134 | 3300002741 | Bacteria | 61613 |
| 12 | JGI25157J39369_1020182 | 3300002741 | Bacteria | 797 |
| 13 | JGI25151J46595_10003380 | 3300003187 | Bacteria | 8833 |
| 14 | JGI25151J46595_10021364 | 3300003187 | Bacteria | 2710 |
| 15 | JGI25151J46595_10075606 | 3300003187 | Bacteria | 998 |
| 16 | rootH2_10006506 | 3300003320 | Bacteria | 13860 |
| 17 | rootH2_10225852 | 3300003320 | Bacteria | 1130 |
| 18 | rootL2_10000651 | 3300003322 | Bacteria | 23314 |
| 19 | rootH1_10078092 | 3300003323 | Bacteria | 1889 |
| 20 | rootH1_10194283 | 3300003323 | Bacteria | 1452 |
| 21 | Ga0055533_1006056 | 3300003756 | Bacteria | 1841 |
| 22 | Ga0055532_1000101 | 3300003758 | Bacteria | 92881 |
| 23 | Ga0055535_1006661 | 3300003761 | Bacteria | 2307 |
| 24 | Ga0055526_1000535 | 3300003771 | Bacteria | 30070 |
| 25 | Ga0055526_1004129 | 3300003771 | Bacteria | 8858 |
| 26 | Ga0055526_1004782 | 3300003771 | Bacteria | 8019 |
| 27 | Ga0055526_1039208 | 3300003771 | Bacteria | 1209 |
| 28 | Ga0055537_1002025 | 3300003773 | Bacteria | 7205 |
| 29 | Ga0055524_1000007 | 3300003775 | Bacteria | 298766 |
| 30 | Ga0055524_1016574 | 3300003775 | Bacteria | 2636 |
| 31 | Ga0055524_1031489 | 3300003775 | Bacteria | 1524 |
| 32 | Ga0055536_1000078 | 3300003781 | Bacteria | 83510 |
| 33 | Ga0055534_1000733 | 3300003784 | Bacteria | 15839 |
| 34 | Ga0055534_1002174 | 3300003784 | Bacteria | 7000 |
| 35 | Ga0055530_10001592 | 3300003791 | Bacteria | 16245 |
| 36 | Ga0055540_1000042 | 3300003792 | Bacteria | 156410 |
| 37 | Ga0055531_10001613 | 3300003794 | Bacteria | 16357 |
| 38 | Ga0055531_10001667 | 3300003794 | Bacteria | 16000 |
| 39 | Ga0055543_1003956 | 3300004625 | Bacteria | 4177 |
| 40 | Ga0055543_1006647 | 3300004625 | Bacteria | 2762 |
| 41 | Ga0065165_1000079 | 3300005262 | Bacteria | 162095 |
| 42 | Ga0065165_1000405 | 3300005262 | Bacteria | 69154 |
| 43 | Ga0065165_1000482 | 3300005262 | Bacteria | 61748 |
| 44 | Ga0065165_1016998 | 3300005262 | Bacteria | 2699 |
| 45 | Ga0065714_10254944 | 3300005288 | Bacteria | 758 |
| 46 | Ga0065704_10080515 | 3300005289 | Bacteria | 3933 |
| 47 | Ga0065704_10099871 | 3300005289 | Bacteria | 2294 |
| 48 | Ga0070670_100146194 | 3300005331 | Bacteria | 2045 |
| 49 | Ga0070666_10000018 | 3300005335 | Bacteria | 187218 |
| 50 | Ga0070674_100371103 | 3300005356 | Bacteria | 1161 |
| 51 | Ga0070674_100624546 | 3300005356 | Bacteria | 913 |
| 52 | Ga0070667_100168040 | 3300005367 | Bacteria | 1935 |
| 53 | Ga0070694_100430287 | 3300005444 | Bacteria | 1038 |
| 54 | Ga0070678_100532907 | 3300005456 | Bacteria | 1040 |
| 55 | Ga0070662_100086628 | 3300005457 | Bacteria | 2343 |
| 56 | Ga0068853_101029177 | 3300005539 | Bacteria | 793 |
| 57 | Ga0070665_100031056 | 3300005548 | Bacteria | 5376 |
| 58 | Ga0068855_100119522 | 3300005563 | Bacteria | 3017 |
| 59 | Ga0068855_100470313 | 3300005563 | Bacteria | 1370 |
| 60 | Ga0068857_100146157 | 3300005577 | Bacteria | 2139 |
| 61 | Ga0068854_101093607 | 3300005578 | Bacteria | 710 |
| 62 | Ga0068856_100637915 | 3300005614 | Bacteria | 1086 |
| 63 | Ga0068852_100043837 | 3300005616 | Bacteria | 3796 |
| 64 | Ga0068861_100022802 | 3300005719 | Bacteria | 4513 |
| 65 | Ga0068851_10685095 | 3300005834 | Bacteria | 630 |
| 66 | Ga0068870_10638682 | 3300005840 | Bacteria | 728 |
| 67 | Ga0068863_101393182 | 3300005841 | Bacteria | 709 |
| 68 | Ga0068858_100179544 | 3300005842 | Bacteria | 1998 |
| 69 | Ga0068858_100247571 | 3300005842 | Bacteria | 1693 |
| 70 | Ga0068860_100232117 | 3300005843 | Bacteria | 1793 |
| 71 | Ga0068860_100945086 | 3300005843 | Bacteria | 879 |
| 72 | Ga0068862_100267778 | 3300005844 | Bacteria | 1562 |
| 73 | Ga0068862_100619448 | 3300005844 | Bacteria | 1041 |
| 74 | Ga0075365_10002161 | 3300006038 | Bacteria | 9457 |
| 75 | Ga0075368_10085527 | 3300006042 | Bacteria | 1286 |
| 76 | Ga0075368_10237850 | 3300006042 | Bacteria | 776 |
| 77 | Ga0075363_100022892 | 3300006048 | Bacteria | 3162 |
| 78 | Ga0075363_100333590 | 3300006048 | Bacteria | 884 |
| 79 | Ga0075363_100408099 | 3300006048 | Bacteria | 799 |
| 80 | Ga0075364_10099340 | 3300006051 | Bacteria | 1937 |
| 81 | Ga0075367_10011481 | 3300006178 | Bacteria | 4690 |
| 82 | Ga0075367_10075075 | 3300006178 | Bacteria | 2039 |
| 83 | Ga0075367_10370936 | 3300006178 | Bacteria | 904 |
| 84 | Ga0075366_10068254 | 3300006195 | Bacteria | 2115 |
| 85 | Ga0075366_10139572 | 3300006195 | Bacteria | 1465 |
| 86 | Ga0075366_10139853 | 3300006195 | Bacteria | 1463 |
| 87 | Ga0075366_10331776 | 3300006195 | Bacteria | 932 |
| 88 | Ga0075370_10005249 | 3300006353 | Bacteria | 6413 |
| 89 | Ga0075370_10005703 | 3300006353 | Bacteria | 6212 |
| 90 | Ga0075370_10021246 | 3300006353 | Bacteria | 3556 |
| 91 | Ga0075430_100216334 | 3300006846 | Bacteria | 1590 |
| 92 | Ga0075430_100280271 | 3300006846 | Bacteria | 1379 |
| 93 | Ga0099824_1031132 | 3300006942 | Bacteria | 2059 |
| 94 | Ga0099823_1000002 | 3300006944 | Bacteria | 212272 |
| 95 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 96 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 97 | Ga0099826_10000009 | 3300006948 | Bacteria | 336081 |
| 98 | Ga0099826_10000052 | 3300006948 | Bacteria | 73156 |
| 99 | Ga0105251_10010122 | 3300009011 | Bacteria | 5500 |
| 100 | Ga0105251_10399583 | 3300009011 | Bacteria | 632 |
| 101 | Ga0105244_10106922 | 3300009036 | Bacteria | 1364 |
| 102 | Ga0105244_10183947 | 3300009036 | Bacteria | 990 |
| 103 | Ga0105244_10275385 | 3300009036 | Bacteria | 781 |
| 104 | Ga0105240_10001934 | 3300009093 | Bacteria | 34352 |
| 105 | Ga0105240_10168317 | 3300009093 | Bacteria | 2597 |
| 106 | Ga0105247_10128799 | 3300009101 | Bacteria | 1648 |
| 107 | Ga0105243_10005055 | 3300009148 | Bacteria | 10350 |
| 108 | Ga0105242_10280134 | 3300009176 | Bacteria | 1514 |
| 109 | Ga0105248_10038811 | 3300009177 | Bacteria | 5331 |
| 110 | Ga0105237_10000797 | 3300009545 | Bacteria | 43129 |
| 111 | Ga0105238_10000319 | 3300009551 | Bacteria | 52428 |
| 112 | Ga0105238_10004630 | 3300009551 | Bacteria | 13621 |
| 113 | Ga0105238_10017899 | 3300009551 | Bacteria | 7204 |
| 114 | Ga0105249_10020688 | 3300009553 | Bacteria | 5884 |
| 115 | Ga0105239_10087577 | 3300010375 | Bacteria | 3433 |
| 116 | Ga0105239_10515226 | 3300010375 | Bacteria | 1360 |
| 117 | Ga0157319_1000007 | 3300012497 | Bacteria | 318528 |
| 118 | Ga0157373_10153065 | 3300013100 | Bacteria | 1622 |
| 119 | Ga0157370_10005446 | 3300013104 | Bacteria | 14278 |
| 120 | Ga0157369_10000580 | 3300013105 | Bacteria | 47824 |
| 121 | Ga0163162_10030575 | 3300013306 | Bacteria | 5336 |
| 122 | Ga0163162_10033887 | 3300013306 | Bacteria | 5078 |
| 123 | Ga0157375_10442276 | 3300013308 | Bacteria | 1466 |
| 124 | Ga0157380_10090734 | 3300014326 | Bacteria | 2521 |
| 125 | Ga0182008_10002417 | 3300014497 | Bacteria | 11719 |
| 126 | Ga0182008_10008058 | 3300014497 | Bacteria | 5773 |
| 127 | Ga0157379_10754203 | 3300014968 | Bacteria | 916 |
| 128 | Ga0157376_10461978 | 3300014969 | Bacteria | 1240 |
| 129 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 130 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 131 | Ga0182006_1000847 | 3300015261 | Bacteria | 20577 |
| 132 | Ga0182006_1001950 | 3300015261 | Bacteria | 11702 |
| 133 | Ga0182006_1071161 | 3300015261 | Bacteria | 1289 |
| 134 | Ga0182007_10001827 | 3300015262 | Bacteria | 11105 |
| 135 | Ga0182007_10002777 | 3300015262 | Bacteria | 8548 |
| 136 | Ga0182007_10020516 | 3300015262 | Bacteria | 2361 |
| 137 | Ga0182007_10029289 | 3300015262 | Bacteria | 1886 |
| 138 | Ga0182007_10055108 | 3300015262 | Bacteria | 1307 |
| 139 | Ga0182005_1000029 | 3300015265 | Bacteria | 214132 |
| 140 | Ga0182005_1000352 | 3300015265 | Bacteria | 26091 |
| 141 | Ga0182005_1000434 | 3300015265 | Bacteria | 22191 |
| 142 | Ga0163161_10004612 | 3300017792 | Bacteria | 9591 |
| 143 | Ga0163161_10637301 | 3300017792 | Bacteria | 882 |
| 144 | Ga0163161_10647303 | 3300017792 | Bacteria | 875 |
| 145 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 146 | Ga0209435_100101 | 3300025206 | Bacteria | 35039 |
| 147 | Ga0209674_101336 | 3300025226 | Bacteria | 6759 |
| 148 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 149 | Ga0209147_103555 | 3300025229 | Bacteria | 2967 |
| 150 | Ga0209437_100166 | 3300025233 | Bacteria | 144787 |
| 151 | Ga0209258_100345 | 3300025242 | Bacteria | 67870 |
| 152 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 153 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 154 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 155 | Ga0209026_1000870 | 3300025250 | Bacteria | 15779 |
| 156 | Ga0209148_1008635 | 3300025254 | Bacteria | 2037 |
| 157 | Ga0209759_1000227 | 3300025256 | Bacteria | 84278 |
| 158 | Ga0209759_1000346 | 3300025256 | Bacteria | 60977 |
| 159 | Ga0209565_1000094 | 3300025263 | Bacteria | 134853 |
| 160 | Ga0209565_1004914 | 3300025263 | Bacteria | 3983 |
| 161 | Ga0209455_1010811 | 3300025272 | Bacteria | 2293 |
| 162 | Ga0209673_1006810 | 3300025273 | Bacteria | 5426 |
| 163 | Ga0209673_1023583 | 3300025273 | Bacteria | 2090 |
| 164 | Ga0209675_1000087 | 3300025291 | Bacteria | 147632 |
| 165 | Ga0209675_1001508 | 3300025291 | Bacteria | 13319 |
| 166 | Ga0209675_1004217 | 3300025291 | Bacteria | 6491 |
| 167 | Ga0209675_1013469 | 3300025291 | Bacteria | 2552 |
| 168 | Ga0209675_1028130 | 3300025291 | Bacteria | 1371 |
| 169 | Ga0209676_1000176 | 3300025292 | Bacteria | 152347 |
| 170 | Ga0209025_1000046 | 3300025294 | Bacteria | 348962 |
| 171 | Ga0209025_1000123 | 3300025294 | Bacteria | 204125 |
| 172 | Ga0209025_1000764 | 3300025294 | Bacteria | 53509 |
| 173 | Ga0209025_1008843 | 3300025294 | Bacteria | 7147 |
| 174 | Ga0209025_1057007 | 3300025294 | Bacteria | 1497 |
| 175 | Ga0209564_1000030 | 3300025295 | Bacteria | 503296 |
| 176 | Ga0209564_1000166 | 3300025295 | Bacteria | 160208 |
| 177 | Ga0209564_1001192 | 3300025295 | Bacteria | 29807 |
| 178 | Ga0209564_1001289 | 3300025295 | Bacteria | 27413 |
| 179 | Ga0209758_1014801 | 3300025297 | Bacteria | 4109 |
| 180 | Ga0209050_1001487 | 3300025298 | Bacteria | 24916 |
| 181 | Ga0209050_1002014 | 3300025298 | Bacteria | 18937 |
| 182 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 183 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 184 | Ga0209256_1000432 | 3300025299 | Bacteria | 65073 |
| 185 | Ga0209256_1000960 | 3300025299 | Bacteria | 34857 |
| 186 | Ga0209256_1001426 | 3300025299 | Bacteria | 24827 |
| 187 | Ga0209256_1002066 | 3300025299 | Bacteria | 17690 |
| 188 | Ga0209256_1034134 | 3300025299 | Bacteria | 1359 |
| 189 | Ga0207426_1024982 | 3300025302 | Bacteria | 2019 |
| 190 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 191 | Ga0209051_1001383 | 3300025303 | Bacteria | 20933 |
| 192 | Ga0209051_1009602 | 3300025303 | Bacteria | 4968 |
| 193 | Ga0209051_1027983 | 3300025303 | Bacteria | 2236 |
| 194 | Ga0209051_1035742 | 3300025303 | Bacteria | 1844 |
| 195 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 196 | Ga0209257_1002063 | 3300025304 | Bacteria | 21217 |
| 197 | Ga0209257_1002789 | 3300025304 | Bacteria | 16469 |
| 198 | Ga0207713_1017282 | 3300025735 | Bacteria | 3625 |
| 199 | Ga0207642_10065029 | 3300025899 | Bacteria | 1712 |
| 200 | Ga0207710_10002899 | 3300025900 | Bacteria | 7799 |
| 201 | Ga0207710_10350156 | 3300025900 | Bacteria | 752 |
| 202 | Ga0207688_10075061 | 3300025901 | Bacteria | 1924 |
| 203 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 204 | Ga0207647_10000008 | 3300025904 | Bacteria | 192602 |
| 205 | Ga0207645_10652017 | 3300025907 | Bacteria | 715 |
| 206 | Ga0207705_10007929 | 3300025909 | Bacteria | 7794 |
| 207 | Ga0207695_10001378 | 3300025913 | Bacteria | 41129 |
| 208 | Ga0207695_10002689 | 3300025913 | Bacteria | 25925 |
| 209 | Ga0207695_10018810 | 3300025913 | Bacteria | 7971 |
| 210 | Ga0207671_10008460 | 3300025914 | Bacteria | 8723 |
| 211 | Ga0207649_10085238 | 3300025920 | Bacteria | 2056 |
| 212 | Ga0207649_10124763 | 3300025920 | Bacteria | 1741 |
| 213 | Ga0207694_10000388 | 3300025924 | Bacteria | 40972 |
| 214 | Ga0207694_10002955 | 3300025924 | Bacteria | 13648 |
| 215 | Ga0207650_10086097 | 3300025925 | Bacteria | 2392 |
| 216 | Ga0207706_10331995 | 3300025933 | Bacteria | 1323 |
| 217 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 218 | Ga0207669_10349706 | 3300025937 | Bacteria | 1141 |
| 219 | Ga0207711_10016483 | 3300025941 | Bacteria | 6139 |
| 220 | Ga0207667_10056339 | 3300025949 | Bacteria | 4129 |
| 221 | Ga0207667_10131976 | 3300025949 | Bacteria | 2573 |
| 222 | Ga0207667_10691320 | 3300025949 | Bacteria | 1023 |
| 223 | Ga0207712_10258726 | 3300025961 | Bacteria | 1410 |
| 224 | Ga0207668_10005187 | 3300025972 | Bacteria | 7663 |
| 225 | Ga0207640_10004825 | 3300025981 | Bacteria | 7325 |
| 226 | Ga0207658_10627118 | 3300025986 | Bacteria | 967 |
| 227 | Ga0207703_10259667 | 3300026035 | Bacteria | 1570 |
| 228 | Ga0207678_10297556 | 3300026067 | Bacteria | 1386 |
| 229 | Ga0207674_10274526 | 3300026116 | Bacteria | 1633 |
| 230 | Ga0207674_10300170 | 3300026116 | Bacteria | 1555 |
| 231 | Ga0207675_100035947 | 3300026118 | Bacteria | 4621 |
| 232 | Ga0207675_101297181 | 3300026118 | Bacteria | 749 |
| 233 | Ga0207683_10523963 | 3300026121 | Bacteria | 1095 |
| 234 | Ga0207698_10003707 | 3300026142 | Bacteria | 9237 |
| 235 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 236 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 237 | Ga0209389_1002519 | 3300027296 | Bacteria | 14139 |
| 238 | Ga0209371_1030596 | 3300027312 | Bacteria | 1178 |
| 239 | Ga0209970_1008497 | 3300027614 | Bacteria | 1682 |
| 240 | Ga0209983_1005646 | 3300027665 | Bacteria | 2580 |
| 241 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 242 | Ga0209282_1000017 | 3300027666 | Bacteria | 191482 |
| 243 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 244 | Ga0268266_10240152 | 3300028379 | Bacteria | 1672 |
| 245 | Ga0268265_10669325 | 3300028380 | Bacteria | 1000 |
| 246 | Ga0268264_10207611 | 3300028381 | Bacteria | 1796 |
| 247 | Ga0268264_10918440 | 3300028381 | Bacteria | 879 |
| 248 | Ga0307517_10206855 | 3300028786 | Bacteria | 1216 |
| 249 | Ga0307515_10000567 | 3300028794 | Bacteria | 87086 |
| 250 | Ga0307515_10001764 | 3300028794 | Bacteria | 48206 |
| 251 | Ga0307515_10006103 | 3300028794 | Bacteria | 24230 |
| 252 | Ga0307515_10032674 | 3300028794 | Bacteria | 8606 |
| 253 | Ga0268256_1009564 | 3300030500 | Bacteria | 3201 |
| 254 | Ga0307512_10021151 | 3300030522 | Bacteria | 5870 |
| 255 | Ga0265332_10000010 | 3300031238 | Bacteria | 289041 |
| 256 | Ga0307513_10002614 | 3300031456 | Bacteria | 24859 |
| 257 | Ga0307513_10023800 | 3300031456 | Bacteria | 7146 |
| 258 | Ga0307513_10359277 | 3300031456 | Bacteria | 1202 |
| 259 | Ga0307509_10022947 | 3300031507 | Bacteria | 7018 |
| 260 | Ga0307408_100015990 | 3300031548 | Bacteria | 5003 |
| 261 | Ga0307408_100029014 | 3300031548 | Bacteria | 3829 |
| 262 | Ga0307408_100943449 | 3300031548 | Bacteria | 792 |
| 263 | Ga0307508_10000133 | 3300031616 | Bacteria | 87867 |
| 264 | Ga0307508_10079502 | 3300031616 | Bacteria | 2860 |
| 265 | Ga0307514_10004805 | 3300031649 | Bacteria | 12315 |
| 266 | Ga0307516_10000253 | 3300031730 | Bacteria | 68852 |
| 267 | Ga0307516_10013972 | 3300031730 | Bacteria | 8521 |
| 268 | Ga0307412_10000608 | 3300031911 | Bacteria | 21074 |
| 269 | Ga0307412_10768968 | 3300031911 | Bacteria | 833 |
| 270 | Ga0307416_101788959 | 3300032002 | Bacteria | 718 |
| 271 | Ga0307414_10009304 | 3300032004 | Bacteria | 5635 |
| 272 | Ga0307411_10107837 | 3300032005 | Bacteria | 1986 |
| 273 | Ga0307507_10029260 | 3300033179 | Bacteria | 5846 |
| 274 | Ga0307510_10001599 | 3300033180 | Bacteria | 25051 |
| 275 | Ga0395905_0219689 | 3300037471 | Bacteria | 1778 |
| 276 | Ga0400483_135774 | 3300039062 | Bacteria | 2260 |
| 277 | Ga0400483_241741 | 3300039062 | Bacteria | 8426 |
| 278 | Ga0439436_0000022 | 3300041404 | Bacteria | 60408 |
| 279 | Ga0451795_0071722 | 3300041456 | Bacteria | 802 |
| 280 | Ga0451835_0702106 | 3300041492 | Bacteria | 1312 |
| 281 | Ga0451845_0298471 | 3300041501 | Bacteria | 675 |
| 282 | Ga0451843_1377075 | 3300041509 | Bacteria | 879 |
| 283 | Ga0451853_1603597 | 3300041512 | Bacteria | 1472 |
| 284 | Ga0439445_0004322 | 3300042004 | Bacteria | 3215 |
| 285 | Ga0450890_002465 | 3300042127 | Bacteria | 2546 |
| 286 | Ga0450892_000837 | 3300042130 | Bacteria | 3378 |
| 287 | Ga0450889_000111 | 3300042144 | Bacteria | 8052 |
| 288 | Ga0450906_041829 | 3300042145 | Bacteria | 809 |
| 289 | Ga0450908_000261 | 3300042184 | Bacteria | 10417 |
| 290 | Ga0439459_0000041 | 3300042438 | Bacteria | 10569 |
| 291 | Ga0450916_000906 | 3300042530 | Bacteria | 2825 |
| 292 | Ga0450893_0044706 | 3300042532 | Bacteria | 818 |
| 293 | Ga0439440_0035434 | 3300042993 | Bacteria | 1197 |
| 294 | Ga0466982_0000049 | 3300044672 | Bacteria | 36295 |
| 295 | Ga0466963_0006616 | 3300044694 | Bacteria | 6875 |
| 296 | Ga0466968_0013434 | 3300044735 | Bacteria | 3221 |
| 297 | Ga0466968_0119663 | 3300044735 | Bacteria | 1190 |
| 298 | Ga0466957_0013309 | 3300044842 | Bacteria | 4772 |
| 299 | Ga0466957_0026700 | 3300044842 | Bacteria | 3427 |
| 300 | Ga0466967_0451957 | 3300045976 | Bacteria | 1256 |
| 301 | Ga0495617_000120 | 3300046452 | Bacteria | 52244 |
| 302 | Ga0495617_000348 | 3300046452 | Bacteria | 25506 |
| 303 | Ga0495590_0107430 | 3300046457 | Bacteria | 994 |
| 304 | Ga0495638_0000564 | 3300046460 | Bacteria | 42120 |
| 305 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 306 | Ga0495650_0000637 | 3300046471 | Bacteria | 46877 |
| 307 | Ga0495650_0004416 | 3300046471 | Bacteria | 9650 |
| 308 | Ga0495650_0005076 | 3300046471 | Bacteria | 8711 |
| 309 | Ga0495650_0013995 | 3300046471 | Bacteria | 4207 |
| 310 | Ga0495605_0028815 | 3300046474 | Bacteria | 2863 |
| 311 | Ga0495584_0000688 | 3300046491 | Bacteria | 22464 |
| 312 | Ga0495584_0006451 | 3300046491 | Bacteria | 6139 |
| 313 | Ga0495585_0006964 | 3300046492 | Bacteria | 6961 |
| 314 | Ga0495596_0000070 | 3300046500 | Bacteria | 75962 |
| 315 | Ga0495607_0000090 | 3300046501 | Bacteria | 94252 |
| 316 | Ga0495607_0000244 | 3300046501 | Bacteria | 58158 |
| 317 | Ga0495607_0058090 | 3300046501 | Bacteria | 2214 |
| 318 | Ga0495583_0014440 | 3300046506 | Bacteria | 4357 |
| 319 | Ga0495606_0000218 | 3300046507 | Bacteria | 101645 |
| 320 | Ga0495606_0001182 | 3300046507 | Bacteria | 36798 |
| 321 | Ga0495606_0004271 | 3300046507 | Bacteria | 14422 |
| 322 | Ga0495606_0052282 | 3300046507 | Bacteria | 2658 |
| 323 | Ga0495606_0070176 | 3300046507 | Bacteria | 2210 |
| 324 | Ga0495606_0141397 | 3300046507 | Bacteria | 1421 |
| 325 | Ga0495610_0000277 | 3300046512 | Bacteria | 53626 |
| 326 | Ga0495610_0001156 | 3300046512 | Bacteria | 24006 |
| 327 | Ga0495610_0035249 | 3300046512 | Bacteria | 2571 |
| 328 | Ga0495610_0142818 | 3300046512 | Bacteria | 1028 |
| 329 | Ga0495616_0000006 | 3300046513 | Bacteria | 234766 |
| 330 | Ga0495616_0001909 | 3300046513 | Bacteria | 14059 |
| 331 | Ga0495616_0041065 | 3300046513 | Bacteria | 2361 |
| 332 | Ga0495616_0065467 | 3300046513 | Bacteria | 1770 |
| 333 | Ga0495620_0000806 | 3300046515 | Bacteria | 19267 |
| 334 | Ga0495620_0009092 | 3300046515 | Bacteria | 5301 |
| 335 | Ga0495631_0000820 | 3300046518 | Bacteria | 19864 |
| 336 | Ga0495631_0014388 | 3300046518 | Bacteria | 3819 |
| 337 | Ga0495632_0010885 | 3300046519 | Bacteria | 5347 |
| 338 | Ga0495632_0025389 | 3300046519 | Bacteria | 3134 |
| 339 | Ga0495637_0008754 | 3300046520 | Bacteria | 4959 |
| 340 | Ga0495637_0104759 | 3300046520 | Bacteria | 1102 |
| 341 | Ga0495643_0079344 | 3300046522 | Bacteria | 1711 |
| 342 | Ga0495648_0000334 | 3300046524 | Bacteria | 51958 |
| 343 | Ga0495648_0002324 | 3300046524 | Bacteria | 17692 |
| 344 | Ga0495609_0008576 | 3300046538 | Bacteria | 4995 |
| 345 | Ga0495609_0013246 | 3300046538 | Bacteria | 3899 |
| 346 | Ga0495633_0000305 | 3300046558 | Bacteria | 55923 |
| 347 | Ga0495633_0060118 | 3300046558 | Bacteria | 1781 |
| 348 | Ga0495656_0025926 | 3300046615 | Bacteria | 2329 |
| 349 | Ga0495668_0002024 | 3300046616 | Bacteria | 17702 |
| 350 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 351 | Ga0495611_0000126 | 3300046648 | Bacteria | 53596 |
| 352 | Ga0495625_0000200 | 3300046660 | Bacteria | 95445 |
| 353 | Ga0495625_0000452 | 3300046660 | Bacteria | 61641 |
| 354 | Ga0495625_0001333 | 3300046660 | Bacteria | 30655 |
| 355 | Ga0495625_0004350 | 3300046660 | Bacteria | 13456 |
| 356 | Ga0495625_0050598 | 3300046660 | Bacteria | 2981 |
| 357 | Ga0495625_0184572 | 3300046660 | Bacteria | 1385 |
| 358 | Ga0495625_0398243 | 3300046660 | Bacteria | 861 |
| 359 | Ga0495661_0040309 | 3300046665 | Bacteria | 2897 |
| 360 | Ga0495670_0000526 | 3300046691 | Bacteria | 18161 |
| 361 | Ga0495670_0013489 | 3300046691 | Bacteria | 4020 |
| 362 | Ga0495670_0028409 | 3300046691 | Bacteria | 2773 |
| 363 | Ga0495670_0029855 | 3300046691 | Bacteria | 2708 |
| 364 | Ga0495670_0142427 | 3300046691 | Bacteria | 1254 |
| 365 | Ga0495671_0000457 | 3300046692 | Bacteria | 32058 |
| 366 | Ga0495671_0001886 | 3300046692 | Bacteria | 13464 |
| 367 | Ga0495649_0077961 | 3300046694 | Bacteria | 1773 |
| 368 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 369 | Ga0495589_0188993 | 3300046794 | Bacteria | 975 |
| 370 | Ga0495660_0000129 | 3300046810 | Bacteria | 83044 |
| 371 | Ga0495660_0046730 | 3300046810 | Bacteria | 2373 |
| 372 | Ga0495672_0010016 | 3300047320 | Bacteria | 6794 |
| 373 | Ga0495672_0169397 | 3300047320 | Bacteria | 1115 |
| 374 | Ga0495683_0004255 | 3300047323 | Bacteria | 8171 |
| 375 | Ga0495683_0038508 | 3300047323 | Bacteria | 2421 |
| 376 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 377 | Ga0495685_130051 | 3300047447 | Bacteria | 823 |
| 378 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 379 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 380 | Ga0495673_0002539 | 3300047469 | Bacteria | 12740 |
| 381 | Ga0495673_0002704 | 3300047469 | Bacteria | 12187 |
| 382 | Ga0495673_0017017 | 3300047469 | Bacteria | 3703 |
| 383 | Ga0495686_0000108 | 3300047472 | Bacteria | 173579 |
| 384 | Ga0495686_0001764 | 3300047472 | Bacteria | 22143 |
| 385 | Ga0495686_0001911 | 3300047472 | Bacteria | 20803 |
| 386 | Ga0495686_0003220 | 3300047472 | Bacteria | 14363 |
| 387 | Ga0495686_0008150 | 3300047472 | Bacteria | 7742 |
| 388 | Ga0495686_0008342 | 3300047472 | Bacteria | 7614 |
| 389 | Ga0495686_0099252 | 3300047472 | Bacteria | 1758 |
| 390 | Ga0496100_0026786 | 3300048903 | Bacteria | 3538 |
| 391 | Ga0496101_0000399 | 3300048904 | Bacteria | 28414 |
| 392 | Ga0496103_0262270 | 3300048906 | Bacteria | 1112 |
| 393 | Ga0496104_0071049 | 3300048907 | Bacteria | 3310 |
| 394 | Ga0496106_0000716 | 3300048909 | Bacteria | 23870 |
| 395 | Ga0496106_0017532 | 3300048909 | Bacteria | 5300 |
| 396 | Ga0496106_0256073 | 3300048909 | Bacteria | 1400 |
| 397 | Ga0496108_0623598 | 3300048911 | Bacteria | 939 |
| 398 | Ga0496109_0726429 | 3300048912 | Bacteria | 931 |
| 399 | Ga0496116_0002058 | 3300048919 | Bacteria | 21537 |
| 400 | Ga0496116_0008775 | 3300048919 | Bacteria | 8720 |
| 401 | Ga0496116_0025209 | 3300048919 | Bacteria | 4376 |
| 402 | Ga0496117_0181931 | 3300048920 | Bacteria | 1207 |
| 403 | Ga0496118_0002248 | 3300048921 | Bacteria | 26506 |
| 404 | Ga0496118_0005121 | 3300048921 | Bacteria | 15059 |
| 405 | Ga0496118_0107005 | 3300048921 | Bacteria | 1869 |
| 406 | Ga0496121_0001451 | 3300048924 | Bacteria | 40023 |
| 407 | Ga0496121_0001490 | 3300048924 | Bacteria | 39440 |
| 408 | Ga0496121_0001516 | 3300048924 | Bacteria | 38982 |
| 409 | Ga0496121_0003074 | 3300048924 | Bacteria | 24167 |
| 410 | Ga0496121_0003543 | 3300048924 | Bacteria | 22104 |
| 411 | Ga0496121_0003558 | 3300048924 | Bacteria | 22042 |
| 412 | Ga0496121_0006246 | 3300048924 | Bacteria | 14921 |
| 413 | Ga0496121_0007024 | 3300048924 | Bacteria | 13676 |
| 414 | Ga0496121_0041800 | 3300048924 | Bacteria | 4000 |
| 415 | Ga0496121_0187554 | 3300048924 | Bacteria | 1486 |
| 416 | Ga0496121_0373194 | 3300048924 | Bacteria | 943 |
| 417 | Ga0496121_0479508 | 3300048924 | Bacteria | 795 |
| 418 | Ga0496121_0491153 | 3300048924 | Bacteria | 782 |
| 419 | Ga0496122_0000457 | 3300048925 | Bacteria | 84895 |
| 420 | Ga0496122_0003366 | 3300048925 | Bacteria | 21050 |
| 421 | Ga0496122_0024752 | 3300048925 | Bacteria | 5243 |
| 422 | Ga0496122_0081987 | 3300048925 | Bacteria | 2242 |
| 423 | Ga0496123_0000208 | 3300048926 | Bacteria | 119807 |
| 424 | Ga0496123_0000321 | 3300048926 | Bacteria | 91682 |
| 425 | Ga0496123_0009893 | 3300048926 | Bacteria | 8510 |
| 426 | Ga0496123_0018167 | 3300048926 | Bacteria | 5611 |
| 427 | Ga0496124_0061266 | 3300048927 | Bacteria | 3154 |
| 428 | Ga0496124_0497181 | 3300048927 | Bacteria | 819 |
| 429 | Ga0496125_0000383 | 3300048928 | Bacteria | 82288 |
| 430 | Ga0496125_0000464 | 3300048928 | Bacteria | 72660 |
| 431 | Ga0496125_0000895 | 3300048928 | Bacteria | 47230 |
| 432 | Ga0496125_0022596 | 3300048928 | Bacteria | 5835 |
| 433 | Ga0496125_0026144 | 3300048928 | Bacteria | 5330 |
| 434 | Ga0496125_0070787 | 3300048928 | Bacteria | 2728 |
| 435 | Ga0496125_0122306 | 3300048928 | Bacteria | 1853 |
| 436 | Ga0496126_0041831 | 3300048929 | Bacteria | 4237 |
| 437 | Ga0496126_0078991 | 3300048929 | Bacteria | 2914 |
| 438 | Ga0496126_0124680 | 3300048929 | Bacteria | 2231 |
| 439 | Ga0495678_000158 | 3300049459 | Bacteria | 81058 |
| 440 | Ga0495678_002113 | 3300049459 | Bacteria | 14106 |
| 441 | Ga0495682_0099187 | 3300049460 | Bacteria | 1045 |
| 442 | Ga0501031_0017131 | 3300049568 | Bacteria | 4707 |
| 443 | Ga0501031_0183257 | 3300049568 | Bacteria | 1367 |
| 444 | Ga0501032_0004311 | 3300049569 | Bacteria | 10743 |
| 445 | Ga0501032_0010978 | 3300049569 | Bacteria | 6512 |
| 446 | Ga0501032_0049118 | 3300049569 | Bacteria | 2847 |
| 447 | Ga0501032_0052223 | 3300049569 | Bacteria | 2754 |
| 448 | Ga0501032_0103190 | 3300049569 | Bacteria | 1889 |
| 449 | Ga0501032_0116257 | 3300049569 | Bacteria | 1768 |
| 450 | Ga0501032_0373060 | 3300049569 | Bacteria | 918 |
| 451 | Ga0501032_0472475 | 3300049569 | Bacteria | 802 |
| 452 | Ga0501033_0002865 | 3300049570 | Bacteria | 14457 |
| 453 | Ga0501033_0019681 | 3300049570 | Bacteria | 5101 |
| 454 | Ga0501033_0143108 | 3300049570 | Bacteria | 1728 |
| 455 | Ga0501033_0301935 | 3300049570 | Bacteria | 1127 |
| 456 | Ga0501034_0000022 | 3300049571 | Bacteria | 264441 |
| 457 | Ga0501034_0018904 | 3300049571 | Bacteria | 7058 |
| 458 | Ga0501034_0119174 | 3300049571 | Bacteria | 2626 |
| 459 | Ga0501034_0157958 | 3300049571 | Bacteria | 2240 |
| 460 | Ga0501034_0176224 | 3300049571 | Bacteria | 2104 |
| 461 | Ga0501034_0252758 | 3300049571 | Bacteria | 1707 |
| 462 | Ga0501034_0613893 | 3300049571 | Bacteria | 992 |
| 463 | Ga0501037_0036881 | 3300049573 | Bacteria | 3603 |
| 464 | Ga0501037_0075571 | 3300049573 | Bacteria | 2446 |
| 465 | Ga0501037_0084107 | 3300049573 | Bacteria | 2304 |
| 466 | Ga0501037_0174191 | 3300049573 | Bacteria | 1528 |
| 467 | Ga0501037_0468634 | 3300049573 | Bacteria | 857 |
| 468 | Ga0501037_0575971 | 3300049573 | Bacteria | 758 |
| 469 | Ga0501038_0002561 | 3300049574 | Bacteria | 16947 |
| 470 | Ga0501038_0018512 | 3300049574 | Bacteria | 6289 |
| 471 | Ga0501038_0089050 | 3300049574 | Bacteria | 2589 |
| 472 | Ga0501038_0238408 | 3300049574 | Bacteria | 1445 |
| 473 | Ga0501038_0341273 | 3300049574 | Bacteria | 1168 |
| 474 | Ga0501038_0548399 | 3300049574 | Bacteria | 879 |
| 475 | Ga0501039_0084323 | 3300049575 | Bacteria | 2474 |
| 476 | Ga0501039_0679554 | 3300049575 | Bacteria | 805 |
| 477 | Ga0501041_0093338 | 3300049577 | Bacteria | 1859 |
| 478 | Ga0501041_0518490 | 3300049577 | Bacteria | 759 |
| 479 | Ga0501042_0094635 | 3300049578 | Bacteria | 2145 |
| 480 | Ga0501042_0270722 | 3300049578 | Bacteria | 1226 |
| 481 | Ga0501042_0345132 | 3300049578 | Bacteria | 1076 |
| 482 | Ga0501043_0004021 | 3300049579 | Bacteria | 12023 |
| 483 | Ga0501043_0006326 | 3300049579 | Bacteria | 9511 |
| 484 | Ga0501043_0008232 | 3300049579 | Bacteria | 8217 |
| 485 | Ga0501043_0058129 | 3300049579 | Bacteria | 3036 |
| 486 | Ga0501043_0447856 | 3300049579 | Bacteria | 970 |
| 487 | Ga0501046_0004507 | 3300049580 | Bacteria | 12624 |
| 488 | Ga0501046_0024950 | 3300049580 | Bacteria | 4898 |
| 489 | Ga0501046_0131335 | 3300049580 | Bacteria | 1899 |
| 490 | Ga0501047_0015107 | 3300049581 | Bacteria | 7350 |
| 491 | Ga0501047_0138822 | 3300049581 | Bacteria | 2309 |
| 492 | Ga0501047_0252343 | 3300049581 | Bacteria | 1612 |
| 493 | Ga0501047_0496691 | 3300049581 | Bacteria | 1047 |
| 494 | Ga0501048_0000242 | 3300049582 | Bacteria | 36361 |
| 495 | Ga0501048_0002764 | 3300049582 | Bacteria | 13390 |
| 496 | Ga0501048_0018626 | 3300049582 | Bacteria | 5104 |
| 497 | Ga0501048_0133662 | 3300049582 | Bacteria | 1753 |
| 498 | Ga0501048_0328349 | 3300049582 | Bacteria | 1090 |
| 499 | Ga0501067_0017043 | 3300049583 | Bacteria | 4014 |
| 500 | Ga0501068_0012032 | 3300049584 | Bacteria | 4895 |
| 501 | Ga0501068_0081837 | 3300049584 | Bacteria | 1982 |
| 502 | Ga0501069_0002591 | 3300049585 | Bacteria | 9222 |
| 503 | Ga0501069_0010383 | 3300049585 | Bacteria | 4926 |
| 504 | Ga0501070_0072382 | 3300049586 | Bacteria | 2853 |
| 505 | Ga0501070_0118692 | 3300049586 | Bacteria | 2186 |
| 506 | Ga0501070_0172217 | 3300049586 | Bacteria | 1783 |
| 507 | Ga0501070_0340859 | 3300049586 | Bacteria | 1217 |
| 508 | Ga0501071_0017627 | 3300049587 | Bacteria | 4929 |
| 509 | Ga0501071_0084923 | 3300049587 | Bacteria | 2321 |
| 510 | Ga0501071_0137270 | 3300049587 | Bacteria | 1820 |
| 511 | Ga0501071_0209604 | 3300049587 | Bacteria | 1465 |
| 512 | Ga0501072_0137161 | 3300049588 | Bacteria | 1950 |
| 513 | Ga0501072_0270162 | 3300049588 | Bacteria | 1353 |
| 514 | Ga0501072_0305176 | 3300049588 | Bacteria | 1265 |
| 515 | Ga0501072_1097386 | 3300049588 | Unclassified | 619 |
| 516 | Ga0501072_1229879 | 3300049588 | Bacteria | 581 |
| 517 | Ga0501073_0005616 | 3300049589 | Bacteria | 9386 |
| 518 | Ga0501073_0100195 | 3300049589 | Bacteria | 2011 |
| 519 | Ga0501073_0579753 | 3300049589 | Bacteria | 775 |
| 520 | Ga0501074_0014464 | 3300049590 | Bacteria | 5741 |
| 521 | Ga0501074_0081907 | 3300049590 | Bacteria | 2314 |
| 522 | Ga0501076_0037628 | 3300049592 | Bacteria | 3796 |
| 523 | Ga0501076_0111145 | 3300049592 | Bacteria | 2215 |
| 524 | Ga0501076_0220220 | 3300049592 | Unclassified | 1551 |
| 525 | Ga0501076_0566841 | 3300049592 | Bacteria | 936 |
| 526 | Ga0501077_0052620 | 3300049593 | Bacteria | 2586 |
| 527 | Ga0501077_0285170 | 3300049593 | Bacteria | 1051 |
| 528 | Ga0501077_0519480 | 3300049593 | Unclassified | 764 |
| 529 | Ga0501222_026102 | 3300049662 | Bacteria | 793 |
| 530 | Ga0501252_001571 | 3300049682 | Bacteria | 2133 |
| 531 | Ga0501079_0023113 | 3300049741 | Bacteria | 4773 |
| 532 | Ga0501079_0069026 | 3300049741 | Bacteria | 2728 |
| 533 | Ga0501079_0158069 | 3300049741 | Bacteria | 1767 |
| 534 | Ga0501080_0010116 | 3300049742 | Bacteria | 8626 |
| 535 | Ga0501081_0212576 | 3300049743 | Bacteria | 1405 |
| 536 | Ga0501081_0230736 | 3300049743 | Unclassified | 1348 |
| 537 | Ga0501083_0010676 | 3300049744 | Bacteria | 6461 |
| 538 | Ga0501083_0025162 | 3300049744 | Bacteria | 4121 |
| 539 | Ga0501035_0006400 | 3300049822 | Bacteria | 11071 |
| 540 | Ga0501035_0049703 | 3300049822 | Bacteria | 3757 |
| 541 | Ga0501035_0204001 | 3300049822 | Bacteria | 1694 |
| 542 | Ga0501035_0204488 | 3300049822 | Bacteria | 1692 |
| 543 | Ga0501035_0513142 | 3300049822 | Bacteria | 985 |
| 544 | Ga0501044_0017194 | 3300049823 | Bacteria | 7760 |
| 545 | Ga0501044_0035158 | 3300049823 | Bacteria | 5248 |
| 546 | Ga0501044_0217989 | 3300049823 | Bacteria | 1860 |
| 547 | Ga0501044_0265141 | 3300049823 | Bacteria | 1655 |
| 548 | Ga0501044_0688543 | 3300049823 | Bacteria | 908 |
| 549 | Ga0501044_0730636 | 3300049823 | Bacteria | 873 |
| 550 | Ga0501044_1291197 | 3300049823 | Bacteria | 596 |
| 551 | Ga0501045_0006386 | 3300049824 | Bacteria | 8162 |
| 552 | Ga0501045_0275481 | 3300049824 | Bacteria | 1252 |
| 553 | Ga0501045_0560148 | 3300049824 | Bacteria | 847 |
| 554 | nmdc:mga03n38_2045_c1 | 3300050490 | Bacteria | 6085 |
| 555 | nmdc:mga00v17_79234_c1 | 3300050491 | Bacteria | 2048 |
| 556 | nmdc:mga0yw44_22853_c1 | 3300050492 | Bacteria | 3514 |
| 557 | nmdc:mga0k408_132915_c1 | 3300050493 | Bacteria | 1477 |
| 558 | nmdc:mga0k408_55401_c1 | 3300050493 | Bacteria | 2299 |
| 559 | nmdc:mga0k408_555277_c1 | 3300050493 | Bacteria | 679 |
| 560 | nmdc:mga06z11_31637_c1 | 3300050494 | Bacteria | 2573 |
| 561 | nmdc:mga06z11_667789_c1 | 3300050494 | Bacteria | 633 |
| 562 | nmdc:mga07m45_13111_c1 | 3300050496 | Bacteria | 4389 |
| 563 | nmdc:mga07m45_158420_c1 | 3300050496 | Bacteria | 1314 |
| 564 | nmdc:mga07m45_3159_c1 | 3300050496 | Bacteria | 7903 |
| 565 | nmdc:mga0qj67_207741_c1 | 3300050509 | Bacteria | 1590 |
| 566 | nmdc:mga0sz30_5297_c1 | 3300050516 | Bacteria | 4725 |
| 567 | Ga0500578_0098036 | 3300053086 | Bacteria | 1857 |
| 568 | Ga0500643_000140 | 3300053087 | Bacteria | 72592 |
| 569 | Ga0500643_021222 | 3300053087 | Bacteria | 2108 |
| 570 | Ga0500641_0011118 | 3300053096 | Bacteria | 3263 |
| 571 | Ga0500555_000327 | 3300053103 | Bacteria | 20441 |
| 572 | Ga0500555_001522 | 3300053103 | Bacteria | 7017 |
| 573 | Ga0500562_000540 | 3300053108 | Bacteria | 9171 |
| 574 | Ga0500562_002502 | 3300053108 | Bacteria | 4589 |
| 575 | Ga0500562_016650 | 3300053108 | Bacteria | 1891 |
| 576 | Ga0500595_032373 | 3300053119 | Bacteria | 1746 |
| 577 | Ga0500618_058314 | 3300053125 | Bacteria | 869 |
| 578 | Ga0500652_237911 | 3300053131 | Bacteria | 726 |
| 579 | Ga0500658_0034983 | 3300053134 | Bacteria | 1986 |
| 580 | Ga0500564_000419 | 3300053138 | Bacteria | 12247 |
| 581 | Ga0500568_0026007 | 3300053139 | Bacteria | 2461 |
| 582 | Ga0500568_0210067 | 3300053139 | Bacteria | 712 |
| 583 | Ga0500577_0000146 | 3300053142 | Bacteria | 17264 |
| 584 | Ga0500616_0000401 | 3300053153 | Bacteria | 59226 |
| 585 | Ga0500616_0024213 | 3300053153 | Bacteria | 3376 |
| 586 | Ga0500616_0105441 | 3300053153 | Bacteria | 1370 |
| 587 | Ga0500622_0001772 | 3300053156 | Bacteria | 16534 |
| 588 | Ga0500622_0002557 | 3300053156 | Bacteria | 13029 |
| 589 | Ga0500622_0175562 | 3300053156 | Bacteria | 994 |
| 590 | Ga0500633_0003370 | 3300053160 | Bacteria | 3476 |
| 591 | Ga0500645_001108 | 3300053730 | Bacteria | 14718 |
| 592 | Ga0500645_001192 | 3300053730 | Bacteria | 13818 |
| 593 | Ga0500645_002572 | 3300053730 | Bacteria | 7982 |
| 594 | Ga0500587_000148 | 3300053739 | Bacteria | 6734 |
| 595 | Ga0501084_0073006 | 3300054114 | Bacteria | 2873 |
| 596 | Ga0501082_0029927 | 3300060353 | Bacteria | 4691 |
| 597 | Ga0501082_0275186 | 3300060353 | Bacteria | 1465 |
| 598 | Ga0466962_0434926 | 3300061719 | Bacteria | 660 |
| 599 | Ga0530510_0123119 | 3300061734 | Bacteria | 1905 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10194283 | rootH1_101942832 | 150 |
| 2 | 3300005614 | Ga0068856_100637915 | Ga0068856_1006379152 | 150 |
| 3 | 3300009036 | Ga0105244_10106922 | Ga0105244_101069222 | 150 |
| 4 | 3300009093 | Ga0105240_10168317 | Ga0105240_101683173 | 150 |
| 5 | 3300009545 | Ga0105237_10000797 | Ga0105237_1000079738 | 150 |
| 6 | 3300009551 | Ga0105238_10004630 | Ga0105238_1000463011 | 150 |
| 7 | 3300010375 | Ga0105239_10087577 | Ga0105239_100875774 | 150 |
| 8 | 3300015261 | Ga0182006_1000847 | Ga0182006_10008477 | 150 |
| 9 | 3300025913 | Ga0207695_10001378 | Ga0207695_1000137818 | 150 |
| 10 | 3300025914 | Ga0207671_10008460 | Ga0207671_100084605 | 150 |
| 11 | 3300025924 | Ga0207694_10002955 | Ga0207694_100029553 | 150 |
| 12 | 3300025981 | Ga0207640_10004825 | Ga0207640_100048258 | 150 |
| 13 | 3300015262 | Ga0182007_10020516 | Ga0182007_100205162 | 151 |
| 14 | 3300041501 | Ga0451845_0298471 | Ga0451845_0298471_52_582 | 155 |
| 15 | iso_pu_bacteria | 644736347 | 644752226 | 155 |
| 16 | iso_pu_bacteria | 2643221598 | 2644000454 | 156 |
| 17 | 3300042127 | Ga0450890_002465 | Ga0450890_002465_416_946 | 157 |
| 18 | 3300042130 | Ga0450892_000837 | Ga0450892_000837_362_892 | 157 |
| 19 | 3300042144 | Ga0450889_000111 | Ga0450889_000111_735_1265 | 157 |
| 20 | 3300042530 | Ga0450916_000906 | Ga0450916_000906_333_863 | 157 |
| 21 | 3300042993 | Ga0439440_0035434 | Ga0439440_0035434_352_882 | 157 |
| 22 | 3300049570 | Ga0501033_0301935 | Ga0501033_0301935_471_992 | 157 |
| 23 | 3300049587 | Ga0501071_0209604 | Ga0501071_0209604_385_864 | 158 |
| 24 | 3300049588 | Ga0501072_0137161 | Ga0501072_0137161_856_1335 | 158 |
| 25 | 3300049593 | Ga0501077_0052620 | Ga0501077_0052620_1908_2387 | 158 |
| 26 | iso_pu_bacteria | 640427133 | 640486957 | 159 |
| 27 | 3300015262 | Ga0182007_10055108 | Ga0182007_100551082 | 160 |
| 28 | 3300031911 | Ga0307412_10768968 | Ga0307412_107689681 | 160 |
| 29 | 3300032005 | Ga0307411_10107837 | Ga0307411_101078372 | 160 |
| 30 | 3300039062 | Ga0400483_135774 | Ga0400483_135774_119_634 | 160 |
| 31 | 3300039062 | Ga0400483_241741 | Ga0400483_241741_6396_6899 | 160 |
| 32 | 3300042532 | Ga0450893_0044706 | Ga0450893_0044706_286_807 | 160 |
| 33 | iso_pu_bacteria | 2585428062 | 2587757815 | 160 |
| 34 | 3300003320 | rootH2_10225852 | rootH2_102258522 | 161 |
| 35 | 3300003771 | Ga0055526_1000535 | Ga0055526_10005356 | 161 |
| 36 | 3300009011 | Ga0105251_10010122 | Ga0105251_100101224 | 161 |
| 37 | 3300025295 | Ga0209564_1000030 | Ga0209564_1000030128 | 161 |
| 38 | 3300046474 | Ga0495605_0028815 | Ga0495605_0028815_1247_1744 | 161 |
| 39 | 3300046491 | Ga0495584_0006451 | Ga0495584_0006451_4320_4817 | 161 |
| 40 | 3300046500 | Ga0495596_0000070 | Ga0495596_0000070_43392_43889 | 161 |
| 41 | 3300046507 | Ga0495606_0052282 | Ga0495606_0052282_1578_2075 | 161 |
| 42 | 3300046512 | Ga0495610_0000277 | Ga0495610_0000277_17139_17636 | 161 |
| 43 | 3300046513 | Ga0495616_0041065 | Ga0495616_0041065_1449_1946 | 161 |
| 44 | 3300046518 | Ga0495631_0014388 | Ga0495631_0014388_1409_1951 | 161 |
| 45 | 3300046520 | Ga0495637_0104759 | Ga0495637_0104759_251_793 | 161 |
| 46 | 3300046538 | Ga0495609_0013246 | Ga0495609_0013246_664_1161 | 161 |
| 47 | 3300046615 | Ga0495656_0025926 | Ga0495656_0025926_833_1330 | 161 |
| 48 | 3300046660 | Ga0495625_0184572 | Ga0495625_0184572_745_1242 | 161 |
| 49 | 3300046691 | Ga0495670_0142427 | Ga0495670_0142427_212_709 | 161 |
| 50 | 3300046692 | Ga0495671_0001886 | Ga0495671_0001886_3439_3936 | 161 |
| 51 | 3300046694 | Ga0495649_0077961 | Ga0495649_0077961_496_993 | 161 |
| 52 | 3300046794 | Ga0495589_0188993 | Ga0495589_0188993_355_852 | 161 |
| 53 | 3300046810 | Ga0495660_0046730 | Ga0495660_0046730_1471_1968 | 161 |
| 54 | 3300047320 | Ga0495672_0010016 | Ga0495672_0010016_2285_2782 | 161 |
| 55 | 3300047447 | Ga0495685_130051 | Ga0495685_130051_33_530 | 161 |
| 56 | 3300048912 | Ga0496109_0726429 | Ga0496109_0726429_66_611 | 161 |
| 57 | 3300048919 | Ga0496116_0008775 | Ga0496116_0008775_1982_2479 | 161 |
| 58 | 3300048924 | Ga0496121_0006246 | Ga0496121_0006246_12997_13494 | 161 |
| 59 | 3300048925 | Ga0496122_0003366 | Ga0496122_0003366_13293_13790 | 161 |
| 60 | 3300048926 | Ga0496123_0000208 | Ga0496123_0000208_35649_36146 | 161 |
| 61 | iso_pu_bacteria | 2600255292 | 2601667208 | 161 |
| 62 | iso_pu_bacteria | 2643221614 | 2644084771 | 161 |
| 63 | iso_pu_bacteria | 2643221661 | 2644342323 | 161 |
| 64 | iso_pu_bacteria | 2643221666 | 2644365623 | 161 |
| 65 | iso_pu_bacteria | 2857547612 | 2857552601 | 161 |
| 66 | iso_pu_bacteria | 2885080285 | 2885081535 | 161 |
| 67 | iso_pu_bacteria | 2932410948 | 2932414916 | 161 |
| 68 | iso_pu_bacteria | 2932416698 | 2932419602 | 161 |
| 69 | 3300048929 | Ga0496126_0078991 | Ga0496126_0078991_170_691 | 162 |
| 70 | 3300049662 | Ga0501222_026102 | Ga0501222_026102_149_718 | 162 |
| 71 | iso_pu_bacteria | 2849560528 | 2849565528 | 162 |
| 72 | iso_pu_bacteria | 2851153111 | 2851153242 | 162 |
| 73 | iso_pu_bacteria | 2883577096 | 2883578329 | 162 |
| 74 | 3300003323 | rootH1_10078092 | rootH1_100780922 | 163 |
| 75 | 3300046471 | Ga0495650_0000011 | Ga0495650_0000011_465076_465591 | 163 |
| 76 | 3300046471 | Ga0495650_0004416 | Ga0495650_0004416_8428_8943 | 163 |
| 77 | 3300046513 | Ga0495616_0001909 | Ga0495616_0001909_10649_11161 | 163 |
| 78 | 3300046691 | Ga0495670_0028409 | Ga0495670_0028409_1285_1830 | 163 |
| 79 | 3300047323 | Ga0495683_0038508 | Ga0495683_0038508_214_729 | 163 |
| 80 | 3300049459 | Ga0495678_002113 | Ga0495678_002113_1031_1546 | 163 |
| 81 | 3300053156 | Ga0500622_0001772 | Ga0500622_0001772_1023_1568 | 163 |
| 82 | 3300053730 | Ga0500645_001192 | Ga0500645_001192_12193_12687 | 163 |
| 83 | iso_pu_bacteria | 2582581279 | 2585147631 | 163 |
| 84 | iso_pu_bacteria | 3000865235 | 3000865907 | 163 |
| 85 | 3300001979 | JGI24740J21852_10009636 | JGI24740J21852_100096365 | 164 |
| 86 | 3300006048 | Ga0075363_100333590 | Ga0075363_1003335902 | 164 |
| 87 | 3300006178 | Ga0075367_10075075 | Ga0075367_100750753 | 164 |
| 88 | 3300006195 | Ga0075366_10139853 | Ga0075366_101398531 | 164 |
| 89 | 3300006195 | Ga0075366_10331776 | Ga0075366_103317761 | 164 |
| 90 | 3300014969 | Ga0157376_10461978 | Ga0157376_104619782 | 164 |
| 91 | 3300025949 | Ga0207667_10131976 | Ga0207667_101319763 | 164 |
| 92 | 3300028794 | Ga0307515_10000567 | Ga0307515_100005674 | 164 |
| 93 | 3300028794 | Ga0307515_10001764 | Ga0307515_1000176444 | 164 |
| 94 | 3300028794 | Ga0307515_10032674 | Ga0307515_100326746 | 164 |
| 95 | 3300030522 | Ga0307512_10021151 | Ga0307512_100211514 | 164 |
| 96 | 3300031456 | Ga0307513_10002614 | Ga0307513_100026144 | 164 |
| 97 | 3300031456 | Ga0307513_10023800 | Ga0307513_100238003 | 164 |
| 98 | 3300031507 | Ga0307509_10022947 | Ga0307509_100229472 | 164 |
| 99 | 3300031616 | Ga0307508_10000133 | Ga0307508_1000013314 | 164 |
| 100 | 3300031616 | Ga0307508_10079502 | Ga0307508_100795022 | 164 |
| 101 | 3300031649 | Ga0307514_10004805 | Ga0307514_100048056 | 164 |
| 102 | 3300031730 | Ga0307516_10013972 | Ga0307516_100139723 | 164 |
| 103 | 3300033179 | Ga0307507_10029260 | Ga0307507_100292603 | 164 |
| 104 | 3300041456 | Ga0451795_0071722 | Ga0451795_0071722_48_554 | 164 |
| 105 | 3300041492 | Ga0451835_0702106 | Ga0451835_0702106_506_1012 | 164 |
| 106 | 3300041509 | Ga0451843_1377075 | Ga0451843_1377075_211_717 | 164 |
| 107 | 3300041512 | Ga0451853_1603597 | Ga0451853_1603597_647_1153 | 164 |
| 108 | 3300042145 | Ga0450906_041829 | Ga0450906_041829_249_764 | 164 |
| 109 | 3300046512 | Ga0495610_0035249 | Ga0495610_0035249_848_1354 | 164 |
| 110 | 3300046522 | Ga0495643_0079344 | Ga0495643_0079344_558_1064 | 164 |
| 111 | 3300046660 | Ga0495625_0000452 | Ga0495625_0000452_59880_60386 | 164 |
| 112 | 3300047472 | Ga0495686_0099252 | Ga0495686_0099252_233_739 | 164 |
| 113 | 3300049569 | Ga0501032_0010978 | Ga0501032_0010978_3198_3710 | 164 |
| 114 | 3300049570 | Ga0501033_0019681 | Ga0501033_0019681_345_857 | 164 |
| 115 | 3300049571 | Ga0501034_0176224 | Ga0501034_0176224_1580_2092 | 164 |
| 116 | 3300049574 | Ga0501038_0548399 | Ga0501038_0548399_169_681 | 164 |
| 117 | 3300049579 | Ga0501043_0006326 | Ga0501043_0006326_114_626 | 164 |
| 118 | 3300049581 | Ga0501047_0252343 | Ga0501047_0252343_351_863 | 164 |
| 119 | 3300049582 | Ga0501048_0328349 | Ga0501048_0328349_100_612 | 164 |
| 120 | 3300049586 | Ga0501070_0118692 | Ga0501070_0118692_1107_1619 | 164 |
| 121 | 3300049822 | Ga0501035_0513142 | Ga0501035_0513142_366_878 | 164 |
| 122 | 3300049823 | Ga0501044_0035158 | Ga0501044_0035158_527_1039 | 164 |
| 123 | 3300050493 | nmdc:mga0k408_555277_c1 | nmdc:mga0k408_555277_c1_113_619 | 164 |
| 124 | 3300053134 | Ga0500658_0034983 | Ga0500658_0034983_531_1037 | 164 |
| 125 | 3300053739 | Ga0500587_000148 | Ga0500587_000148_5604_6110 | 164 |
| 126 | iso_pu_bacteria | 2574179768 | 2574429434 | 164 |
| 127 | iso_pu_bacteria | 2818991440 | 2819566482 | 164 |
| 128 | iso_pu_bacteria | 2891633521 | 2891637311 | 164 |
| 129 | iso_pu_bacteria | 2904463128 | 2904467139 | 164 |
| 130 | iso_pu_bacteria | 2990196909 | 2990198559 | 164 |
| 131 | iso_pu_bacteria | 643348564 | 643598823 | 164 |
| 132 | iso_pu_bacteria | 651053060 | 651174832 | 164 |
| 133 | 3300003775 | Ga0055524_1000007 | Ga0055524_100000750 | 165 |
| 134 | 3300005288 | Ga0065714_10254944 | Ga0065714_102549442 | 165 |
| 135 | 3300006846 | Ga0075430_100216334 | Ga0075430_1002163342 | 165 |
| 136 | 3300006948 | Ga0099826_10000052 | Ga0099826_100000526 | 165 |
| 137 | 3300009036 | Ga0105244_10275385 | Ga0105244_102753851 | 165 |
| 138 | 3300014497 | Ga0182008_10002417 | Ga0182008_100024178 | 165 |
| 139 | 3300015261 | Ga0182006_1000002 | Ga0182006_1000002134 | 165 |
| 140 | 3300015262 | Ga0182007_10001827 | Ga0182007_1000182711 | 165 |
| 141 | 3300015265 | Ga0182005_1000029 | Ga0182005_100002942 | 165 |
| 142 | 3300025291 | Ga0209675_1028130 | Ga0209675_10281302 | 165 |
| 143 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005442 | 165 |
| 144 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000012299 | 165 |
| 145 | 3300047472 | Ga0495686_0008342 | Ga0495686_0008342_2582_3100 | 165 |
| 146 | 3300048919 | Ga0496116_0025209 | Ga0496116_0025209_3282_3797 | 165 |
| 147 | 3300048924 | Ga0496121_0003074 | Ga0496121_0003074_17061_17639 | 165 |
| 148 | 3300048924 | Ga0496121_0003558 | Ga0496121_0003558_12606_13184 | 165 |
| 149 | 3300048928 | Ga0496125_0070787 | Ga0496125_0070787_1959_2474 | 165 |
| 150 | 3300050509 | nmdc:mga0qj67_207741_c1 | nmdc:mga0qj67_207741_c1_574_1089 | 165 |
| 151 | iso_pu_bacteria | 2501025502 | 2501085369 | 165 |
| 152 | iso_pu_bacteria | 2510917013 | 2511090791 | 165 |
| 153 | iso_pu_bacteria | 2513237150 | 2513954676 | 165 |
| 154 | iso_pu_bacteria | 2513237165 | 2514043561 | 165 |
| 155 | iso_pu_bacteria | 2524023250 | 2524612385 | 165 |
| 156 | iso_pu_bacteria | 2593339238 | 2595447148 | 165 |
| 157 | iso_pu_bacteria | 2643221660 | 2644339421 | 165 |
| 158 | iso_pu_bacteria | 2718218334 | 2721026190 | 165 |
| 159 | iso_pu_bacteria | 2734482264 | 2735833839 | 165 |
| 160 | iso_pu_bacteria | 2738543009 | 2739228827 | 165 |
| 161 | iso_pu_bacteria | 2834641062 | 2834645966 | 165 |
| 162 | iso_pu_bacteria | 2842918807 | 2842920205 | 165 |
| 163 | iso_pu_bacteria | 2884338543 | 2884341816 | 165 |
| 164 | iso_pu_bacteria | 2919085039 | 2919087424 | 165 |
| 165 | iso_pu_bacteria | 2941471342 | 2941475414 | 165 |
| 166 | iso_pu_bacteria | 2953994433 | 2953995499 | 165 |
| 167 | iso_pu_bacteria | 8003400568 | 8003402737 | 165 |
| 168 | 3300003320 | rootH2_10006506 | rootH2_100065062 | 166 |
| 169 | 3300003322 | rootL2_10000651 | rootL2_100006515 | 166 |
| 170 | 3300003775 | Ga0055524_1031489 | Ga0055524_10314893 | 166 |
| 171 | 3300003794 | Ga0055531_10001613 | Ga0055531_1000161312 | 166 |
| 172 | 3300003794 | Ga0055531_10001667 | Ga0055531_1000166711 | 166 |
| 173 | 3300004625 | Ga0055543_1006647 | Ga0055543_10066472 | 166 |
| 174 | 3300005262 | Ga0065165_1000482 | Ga0065165_100048214 | 166 |
| 175 | 3300006195 | Ga0075366_10139572 | Ga0075366_101395723 | 166 |
| 176 | 3300006353 | Ga0075370_10005249 | Ga0075370_100052498 | 166 |
| 177 | 3300006353 | Ga0075370_10005703 | Ga0075370_100057034 | 166 |
| 178 | 3300006353 | Ga0075370_10021246 | Ga0075370_100212464 | 166 |
| 179 | 3300006942 | Ga0099824_1031132 | Ga0099824_10311323 | 166 |
| 180 | 3300006944 | Ga0099823_1000002 | Ga0099823_100000295 | 166 |
| 181 | 3300012497 | Ga0157319_1000007 | Ga0157319_1000007108 | 166 |
| 182 | 3300013105 | Ga0157369_10000580 | Ga0157369_1000058026 | 166 |
| 183 | 3300025273 | Ga0209673_1006810 | Ga0209673_10068103 | 166 |
| 184 | 3300025298 | Ga0209050_1002014 | Ga0209050_100201413 | 166 |
| 185 | 3300025299 | Ga0209256_1001426 | Ga0209256_10014264 | 166 |
| 186 | 3300025299 | Ga0209256_1002066 | Ga0209256_10020664 | 166 |
| 187 | 3300025299 | Ga0209256_1034134 | Ga0209256_10341342 | 166 |
| 188 | 3300025303 | Ga0209051_1001383 | Ga0209051_100138312 | 166 |
| 189 | 3300025304 | Ga0209257_1002063 | Ga0209257_10020634 | 166 |
| 190 | 3300025304 | Ga0209257_1002789 | Ga0209257_10027895 | 166 |
| 191 | 3300027296 | Ga0209389_1002519 | Ga0209389_10025192 | 166 |
| 192 | 3300027312 | Ga0209371_1030596 | Ga0209371_10305962 | 166 |
| 193 | 3300030500 | Ga0268256_1009564 | Ga0268256_10095642 | 166 |
| 194 | 3300031548 | Ga0307408_100029014 | Ga0307408_1000290144 | 166 |
| 195 | 3300032002 | Ga0307416_101788959 | Ga0307416_1017889592 | 166 |
| 196 | 3300032004 | Ga0307414_10009304 | Ga0307414_100093043 | 166 |
| 197 | 3300042438 | Ga0439459_0000041 | Ga0439459_0000041_9845_10381 | 166 |
| 198 | 3300044694 | Ga0466963_0006616 | Ga0466963_0006616_1287_1823 | 166 |
| 199 | 3300050493 | nmdc:mga0k408_132915_c1 | nmdc:mga0k408_132915_c1_443_979 | 166 |
| 200 | 3300050493 | nmdc:mga0k408_55401_c1 | nmdc:mga0k408_55401_c1_78_614 | 166 |
| 201 | 3300050496 | nmdc:mga07m45_13111_c1 | nmdc:mga07m45_13111_c1_412_948 | 166 |
| 202 | 3300050496 | nmdc:mga07m45_158420_c1 | nmdc:mga07m45_158420_c1_165_689 | 166 |
| 203 | 3300050496 | nmdc:mga07m45_3159_c1 | nmdc:mga07m45_3159_c1_3619_4155 | 166 |
| 204 | iso_pu_bacteria | 2831864461 | 2831865407 | 166 |
| 205 | iso_pu_bacteria | 2839094727 | 2839096877 | 166 |
| 206 | iso_pu_bacteria | 2886848708 | 2886849552 | 166 |
| 207 | 3300004625 | Ga0055543_1003956 | Ga0055543_10039561 | 167 |
| 208 | 3300005262 | Ga0065165_1000079 | Ga0065165_100007948 | 167 |
| 209 | 3300005262 | Ga0065165_1016998 | Ga0065165_10169983 | 167 |
| 210 | 3300005844 | Ga0068862_100619448 | Ga0068862_1006194482 | 167 |
| 211 | 3300046524 | Ga0495648_0000334 | Ga0495648_0000334_45842_46375 | 167 |
| 212 | 3300046660 | Ga0495625_0398243 | Ga0495625_0398243_71_598 | 167 |
| 213 | 3300047469 | Ga0495673_0002704 | Ga0495673_0002704_5863_6396 | 167 |
| 214 | 3300047472 | Ga0495686_0001764 | Ga0495686_0001764_9339_9881 | 167 |
| 215 | 3300049460 | Ga0495682_0099187 | Ga0495682_0099187_79_585 | 167 |
| 216 | 3300049682 | Ga0501252_001571 | Ga0501252_001571_759_1268 | 167 |
| 217 | 3300053108 | Ga0500562_000540 | Ga0500562_000540_5034_5555 | 167 |
| 218 | 3300053108 | Ga0500562_002502 | Ga0500562_002502_450_971 | 167 |
| 219 | 3300053138 | Ga0500564_000419 | Ga0500564_000419_8035_8568 | 167 |
| 220 | 3300053153 | Ga0500616_0024213 | Ga0500616_0024213_1175_1681 | 167 |
| 221 | 3300053156 | Ga0500622_0002557 | Ga0500622_0002557_3231_3773 | 167 |
| 222 | 3300053730 | Ga0500645_001108 | Ga0500645_001108_5787_6314 | 167 |
| 223 | 3300006846 | Ga0075430_100280271 | Ga0075430_1002802712 | 168 |
| 224 | 3300028794 | Ga0307515_10006103 | Ga0307515_100061039 | 168 |
| 225 | 3300031730 | Ga0307516_10000253 | Ga0307516_1000025343 | 168 |
| 226 | 3300037471 | Ga0395905_0219689 | Ga0395905_0219689_569_1093 | 168 |
| 227 | 3300044735 | Ga0466968_0119663 | Ga0466968_0119663_239_757 | 168 |
| 228 | 3300046452 | Ga0495617_000348 | Ga0495617_000348_9327_9836 | 168 |
| 229 | 3300046457 | Ga0495590_0107430 | Ga0495590_0107430_224_733 | 168 |
| 230 | 3300046460 | Ga0495638_0000564 | Ga0495638_0000564_40427_40936 | 168 |
| 231 | 3300046520 | Ga0495637_0008754 | Ga0495637_0008754_2564_3073 | 168 |
| 232 | 3300046538 | Ga0495609_0008576 | Ga0495609_0008576_803_1312 | 168 |
| 233 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2539674_2540183 | 168 |
| 234 | 3300046660 | Ga0495625_0000200 | Ga0495625_0000200_6698_7207 | 168 |
| 235 | 3300046691 | Ga0495670_0029855 | Ga0495670_0029855_841_1350 | 168 |
| 236 | 3300046692 | Ga0495671_0000457 | Ga0495671_0000457_29125_29634 | 168 |
| 237 | 3300046794 | Ga0495589_0000008 | Ga0495589_0000008_88129_88638 | 168 |
| 238 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_659363_659872 | 168 |
| 239 | 3300047469 | Ga0495673_0002539 | Ga0495673_0002539_4413_4922 | 168 |
| 240 | 3300049577 | Ga0501041_0093338 | Ga0501041_0093338_556_1065 | 168 |
| 241 | 3300049578 | Ga0501042_0270722 | Ga0501042_0270722_612_1121 | 168 |
| 242 | 3300049582 | Ga0501048_0133662 | Ga0501048_0133662_507_1016 | 168 |
| 243 | 3300049587 | Ga0501071_0084923 | Ga0501071_0084923_952_1461 | 168 |
| 244 | 3300049588 | Ga0501072_1097386 | Ga0501072_1097386_55_564 | 168 |
| 245 | 3300049592 | Ga0501076_0111145 | Ga0501076_0111145_857_1366 | 168 |
| 246 | 3300049593 | Ga0501077_0519480 | Ga0501077_0519480_220_729 | 168 |
| 247 | 3300053125 | Ga0500618_058314 | Ga0500618_058314_216_737 | 168 |
| 248 | 3300053131 | Ga0500652_237911 | Ga0500652_237911_162_671 | 168 |
| 249 | 3300061734 | Ga0530510_0123119 | Ga0530510_0123119_583_1092 | 168 |
| 250 | iso_pu_bacteria | 2739367655 | 2739610108 | 168 |
| 251 | iso_pu_bacteria | 2887375801 | 2887380726 | 168 |
| 252 | iso_pu_bacteria | 2894023352 | 2894025510 | 168 |
| 253 | 3300001904 | JGI24736J21556_1002736 | JGI24736J21556_10027363 | 169 |
| 254 | 3300002067 | JGI24735J21928_10033649 | JGI24735J21928_100336491 | 169 |
| 255 | 3300002705 | JGI25156J39149_1000112 | JGI25156J39149_100011228 | 169 |
| 256 | 3300002705 | JGI25156J39149_1000128 | JGI25156J39149_100012834 | 169 |
| 257 | 3300002705 | JGI25156J39149_1002904 | JGI25156J39149_10029044 | 169 |
| 258 | 3300002737 | JGI25162J39368_1004893 | JGI25162J39368_10048933 | 169 |
| 259 | 3300002738 | JGI25154J39366_1000125 | JGI25154J39366_100012534 | 169 |
| 260 | 3300002738 | JGI25154J39366_1000143 | JGI25154J39366_100014334 | 169 |
| 261 | 3300002738 | JGI25154J39366_1000228 | JGI25154J39366_10002284 | 169 |
| 262 | 3300002741 | JGI25157J39369_1000134 | JGI25157J39369_100013434 | 169 |
| 263 | 3300002741 | JGI25157J39369_1020182 | JGI25157J39369_10201822 | 169 |
| 264 | 3300003187 | JGI25151J46595_10003380 | JGI25151J46595_100033804 | 169 |
| 265 | 3300003187 | JGI25151J46595_10021364 | JGI25151J46595_100213642 | 169 |
| 266 | 3300003187 | JGI25151J46595_10075606 | JGI25151J46595_100756061 | 169 |
| 267 | 3300003756 | Ga0055533_1006056 | Ga0055533_10060562 | 169 |
| 268 | 3300003758 | Ga0055532_1000101 | Ga0055532_100010163 | 169 |
| 269 | 3300003761 | Ga0055535_1006661 | Ga0055535_10066612 | 169 |
| 270 | 3300003771 | Ga0055526_1004129 | Ga0055526_10041292 | 169 |
| 271 | 3300003771 | Ga0055526_1004782 | Ga0055526_10047826 | 169 |
| 272 | 3300003771 | Ga0055526_1039208 | Ga0055526_10392082 | 169 |
| 273 | 3300003773 | Ga0055537_1002025 | Ga0055537_10020257 | 169 |
| 274 | 3300003775 | Ga0055524_1016574 | Ga0055524_10165744 | 169 |
| 275 | 3300003781 | Ga0055536_1000078 | Ga0055536_10000789 | 169 |
| 276 | 3300003784 | Ga0055534_1000733 | Ga0055534_10007339 | 169 |
| 277 | 3300003784 | Ga0055534_1002174 | Ga0055534_10021744 | 169 |
| 278 | 3300003791 | Ga0055530_10001592 | Ga0055530_100015925 | 169 |
| 279 | 3300003792 | Ga0055540_1000042 | Ga0055540_100004298 | 169 |
| 280 | 3300005262 | Ga0065165_1000405 | Ga0065165_100040522 | 169 |
| 281 | 3300005289 | Ga0065704_10080515 | Ga0065704_100805154 | 169 |
| 282 | 3300005289 | Ga0065704_10099871 | Ga0065704_100998712 | 169 |
| 283 | 3300005331 | Ga0070670_100146194 | Ga0070670_1001461943 | 169 |
| 284 | 3300005335 | Ga0070666_10000018 | Ga0070666_10000018114 | 169 |
| 285 | 3300005356 | Ga0070674_100371103 | Ga0070674_1003711032 | 169 |
| 286 | 3300005356 | Ga0070674_100624546 | Ga0070674_1006245462 | 169 |
| 287 | 3300005367 | Ga0070667_100168040 | Ga0070667_1001680402 | 169 |
| 288 | 3300005444 | Ga0070694_100430287 | Ga0070694_1004302871 | 169 |
| 289 | 3300005456 | Ga0070678_100532907 | Ga0070678_1005329072 | 169 |
| 290 | 3300005457 | Ga0070662_100086628 | Ga0070662_1000866283 | 169 |
| 291 | 3300005539 | Ga0068853_101029177 | Ga0068853_1010291771 | 169 |
| 292 | 3300005548 | Ga0070665_100031056 | Ga0070665_1000310564 | 169 |
| 293 | 3300005563 | Ga0068855_100119522 | Ga0068855_1001195223 | 169 |
| 294 | 3300005563 | Ga0068855_100470313 | Ga0068855_1004703132 | 169 |
| 295 | 3300005577 | Ga0068857_100146157 | Ga0068857_1001461573 | 169 |
| 296 | 3300005578 | Ga0068854_101093607 | Ga0068854_1010936072 | 169 |
| 297 | 3300005616 | Ga0068852_100043837 | Ga0068852_1000438374 | 169 |
| 298 | 3300005719 | Ga0068861_100022802 | Ga0068861_1000228023 | 169 |
| 299 | 3300005834 | Ga0068851_10685095 | Ga0068851_106850951 | 169 |
| 300 | 3300005840 | Ga0068870_10638682 | Ga0068870_106386821 | 169 |
| 301 | 3300005841 | Ga0068863_101393182 | Ga0068863_1013931821 | 169 |
| 302 | 3300005842 | Ga0068858_100179544 | Ga0068858_1001795443 | 169 |
| 303 | 3300005842 | Ga0068858_100247571 | Ga0068858_1002475712 | 169 |
| 304 | 3300005843 | Ga0068860_100232117 | Ga0068860_1002321172 | 169 |
| 305 | 3300005843 | Ga0068860_100945086 | Ga0068860_1009450862 | 169 |
| 306 | 3300005844 | Ga0068862_100267778 | Ga0068862_1002677783 | 169 |
| 307 | 3300006038 | Ga0075365_10002161 | Ga0075365_100021616 | 169 |
| 308 | 3300006042 | Ga0075368_10085527 | Ga0075368_100855272 | 169 |
| 309 | 3300006042 | Ga0075368_10237850 | Ga0075368_102378501 | 169 |
| 310 | 3300006048 | Ga0075363_100022892 | Ga0075363_1000228924 | 169 |
| 311 | 3300006048 | Ga0075363_100408099 | Ga0075363_1004080991 | 169 |
| 312 | 3300006051 | Ga0075364_10099340 | Ga0075364_100993402 | 169 |
| 313 | 3300006178 | Ga0075367_10011481 | Ga0075367_100114813 | 169 |
| 314 | 3300006178 | Ga0075367_10370936 | Ga0075367_103709362 | 169 |
| 315 | 3300006195 | Ga0075366_10068254 | Ga0075366_100682542 | 169 |
| 316 | 3300006946 | Ga0079104_1000002 | Ga0079104_1000002109 | 169 |
| 317 | 3300006946 | Ga0079104_1000012 | Ga0079104_1000012117 | 169 |
| 318 | 3300006948 | Ga0099826_10000009 | Ga0099826_10000009169 | 169 |
| 319 | 3300009011 | Ga0105251_10399583 | Ga0105251_103995831 | 169 |
| 320 | 3300009036 | Ga0105244_10183947 | Ga0105244_101839472 | 169 |
| 321 | 3300009093 | Ga0105240_10001934 | Ga0105240_100019344 | 169 |
| 322 | 3300009101 | Ga0105247_10128799 | Ga0105247_101287992 | 169 |
| 323 | 3300009148 | Ga0105243_10005055 | Ga0105243_100050554 | 169 |
| 324 | 3300009176 | Ga0105242_10280134 | Ga0105242_102801342 | 169 |
| 325 | 3300009177 | Ga0105248_10038811 | Ga0105248_100388116 | 169 |
| 326 | 3300009551 | Ga0105238_10000319 | Ga0105238_1000031932 | 169 |
| 327 | 3300009551 | Ga0105238_10017899 | Ga0105238_100178994 | 169 |
| 328 | 3300009553 | Ga0105249_10020688 | Ga0105249_100206882 | 169 |
| 329 | 3300010375 | Ga0105239_10515226 | Ga0105239_105152262 | 169 |
| 330 | 3300013100 | Ga0157373_10153065 | Ga0157373_101530652 | 169 |
| 331 | 3300013104 | Ga0157370_10005446 | Ga0157370_1000544611 | 169 |
| 332 | 3300013306 | Ga0163162_10030575 | Ga0163162_100305751 | 169 |
| 333 | 3300013306 | Ga0163162_10033887 | Ga0163162_100338875 | 169 |
| 334 | 3300013308 | Ga0157375_10442276 | Ga0157375_104422762 | 169 |
| 335 | 3300014326 | Ga0157380_10090734 | Ga0157380_100907342 | 169 |
| 336 | 3300014497 | Ga0182008_10008058 | Ga0182008_100080584 | 169 |
| 337 | 3300014968 | Ga0157379_10754203 | Ga0157379_107542032 | 169 |
| 338 | 3300015261 | Ga0182006_1000031 | Ga0182006_1000031195 | 169 |
| 339 | 3300015261 | Ga0182006_1001950 | Ga0182006_100195010 | 169 |
| 340 | 3300015261 | Ga0182006_1071161 | Ga0182006_10711612 | 169 |
| 341 | 3300015262 | Ga0182007_10002777 | Ga0182007_100027779 | 169 |
| 342 | 3300015262 | Ga0182007_10029289 | Ga0182007_100292891 | 169 |
| 343 | 3300015265 | Ga0182005_1000352 | Ga0182005_100035210 | 169 |
| 344 | 3300015265 | Ga0182005_1000434 | Ga0182005_100043423 | 169 |
| 345 | 3300017792 | Ga0163161_10004612 | Ga0163161_100046123 | 169 |
| 346 | 3300017792 | Ga0163161_10637301 | Ga0163161_106373012 | 169 |
| 347 | 3300017792 | Ga0163161_10647303 | Ga0163161_106473032 | 169 |
| 348 | 3300025206 | Ga0209435_100016 | Ga0209435_100016274 | 169 |
| 349 | 3300025206 | Ga0209435_100101 | Ga0209435_10010124 | 169 |
| 350 | 3300025226 | Ga0209674_101336 | Ga0209674_1013366 | 169 |
| 351 | 3300025229 | Ga0209147_100023 | Ga0209147_10002353 | 169 |
| 352 | 3300025229 | Ga0209147_103555 | Ga0209147_1035552 | 169 |
| 353 | 3300025233 | Ga0209437_100166 | Ga0209437_100166139 | 169 |
| 354 | 3300025242 | Ga0209258_100345 | Ga0209258_10034569 | 169 |
| 355 | 3300025246 | Ga0209646_1000033 | Ga0209646_100003334 | 169 |
| 356 | 3300025246 | Ga0209646_1000093 | Ga0209646_1000093164 | 169 |
| 357 | 3300025250 | Ga0209026_1000031 | Ga0209026_100003153 | 169 |
| 358 | 3300025250 | Ga0209026_1000870 | Ga0209026_10008702 | 169 |
| 359 | 3300025254 | Ga0209148_1008635 | Ga0209148_10086352 | 169 |
| 360 | 3300025256 | Ga0209759_1000227 | Ga0209759_100022733 | 169 |
| 361 | 3300025256 | Ga0209759_1000346 | Ga0209759_100034645 | 169 |
| 362 | 3300025263 | Ga0209565_1000094 | Ga0209565_1000094129 | 169 |
| 363 | 3300025263 | Ga0209565_1004914 | Ga0209565_10049142 | 169 |
| 364 | 3300025272 | Ga0209455_1010811 | Ga0209455_10108112 | 169 |
| 365 | 3300025273 | Ga0209673_1023583 | Ga0209673_10235833 | 169 |
| 366 | 3300025291 | Ga0209675_1000087 | Ga0209675_100008710 | 169 |
| 367 | 3300025291 | Ga0209675_1001508 | Ga0209675_10015084 | 169 |
| 368 | 3300025291 | Ga0209675_1004217 | Ga0209675_10042175 | 169 |
| 369 | 3300025291 | Ga0209675_1013469 | Ga0209675_10134692 | 169 |
| 370 | 3300025292 | Ga0209676_1000176 | Ga0209676_100017674 | 169 |
| 371 | 3300025294 | Ga0209025_1000046 | Ga0209025_100004697 | 169 |
| 372 | 3300025294 | Ga0209025_1000123 | Ga0209025_1000123180 | 169 |
| 373 | 3300025294 | Ga0209025_1000764 | Ga0209025_100076423 | 169 |
| 374 | 3300025294 | Ga0209025_1008843 | Ga0209025_10088433 | 169 |
| 375 | 3300025294 | Ga0209025_1057007 | Ga0209025_10570073 | 169 |
| 376 | 3300025295 | Ga0209564_1000166 | Ga0209564_1000166131 | 169 |
| 377 | 3300025295 | Ga0209564_1001192 | Ga0209564_100119210 | 169 |
| 378 | 3300025295 | Ga0209564_1001289 | Ga0209564_100128914 | 169 |
| 379 | 3300025297 | Ga0209758_1014801 | Ga0209758_10148014 | 169 |
| 380 | 3300025298 | Ga0209050_1001487 | Ga0209050_100148710 | 169 |
| 381 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030270 | 169 |
| 382 | 3300025299 | Ga0209256_1000432 | Ga0209256_100043239 | 169 |
| 383 | 3300025299 | Ga0209256_1000960 | Ga0209256_100096029 | 169 |
| 384 | 3300025302 | Ga0207426_1024982 | Ga0207426_10249822 | 169 |
| 385 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004690 | 169 |
| 386 | 3300025303 | Ga0209051_1009602 | Ga0209051_10096024 | 169 |
| 387 | 3300025303 | Ga0209051_1027983 | Ga0209051_10279833 | 169 |
| 388 | 3300025303 | Ga0209051_1035742 | Ga0209051_10357422 | 169 |
| 389 | 3300025304 | Ga0209257_1000063 | Ga0209257_1000063176 | 169 |
| 390 | 3300025735 | Ga0207713_1017282 | Ga0207713_10172824 | 169 |
| 391 | 3300025899 | Ga0207642_10065029 | Ga0207642_100650293 | 169 |
| 392 | 3300025900 | Ga0207710_10002899 | Ga0207710_100028996 | 169 |
| 393 | 3300025900 | Ga0207710_10350156 | Ga0207710_103501561 | 169 |
| 394 | 3300025901 | Ga0207688_10075061 | Ga0207688_100750612 | 169 |
| 395 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002500 | 169 |
| 396 | 3300025904 | Ga0207647_10000008 | Ga0207647_10000008153 | 169 |
| 397 | 3300025907 | Ga0207645_10652017 | Ga0207645_106520171 | 169 |
| 398 | 3300025909 | Ga0207705_10007929 | Ga0207705_100079295 | 169 |
| 399 | 3300025913 | Ga0207695_10002689 | Ga0207695_1000268919 | 169 |
| 400 | 3300025913 | Ga0207695_10018810 | Ga0207695_100188104 | 169 |
| 401 | 3300025920 | Ga0207649_10085238 | Ga0207649_100852383 | 169 |
| 402 | 3300025920 | Ga0207649_10124763 | Ga0207649_101247632 | 169 |
| 403 | 3300025924 | Ga0207694_10000388 | Ga0207694_1000038832 | 169 |
| 404 | 3300025925 | Ga0207650_10086097 | Ga0207650_100860972 | 169 |
| 405 | 3300025933 | Ga0207706_10331995 | Ga0207706_103319952 | 169 |
| 406 | 3300025935 | Ga0207709_10000015 | Ga0207709_10000015107 | 169 |
| 407 | 3300025937 | Ga0207669_10349706 | Ga0207669_103497062 | 169 |
| 408 | 3300025941 | Ga0207711_10016483 | Ga0207711_100164833 | 169 |
| 409 | 3300025949 | Ga0207667_10056339 | Ga0207667_100563393 | 169 |
| 410 | 3300025949 | Ga0207667_10691320 | Ga0207667_106913202 | 169 |
| 411 | 3300025961 | Ga0207712_10258726 | Ga0207712_102587262 | 169 |
| 412 | 3300025972 | Ga0207668_10005187 | Ga0207668_1000518711 | 169 |
| 413 | 3300025986 | Ga0207658_10627118 | Ga0207658_106271182 | 169 |
| 414 | 3300026035 | Ga0207703_10259667 | Ga0207703_102596672 | 169 |
| 415 | 3300026067 | Ga0207678_10297556 | Ga0207678_102975562 | 169 |
| 416 | 3300026116 | Ga0207674_10274526 | Ga0207674_102745261 | 169 |
| 417 | 3300026116 | Ga0207674_10300170 | Ga0207674_103001702 | 169 |
| 418 | 3300026118 | Ga0207675_100035947 | Ga0207675_1000359473 | 169 |
| 419 | 3300026118 | Ga0207675_101297181 | Ga0207675_1012971811 | 169 |
| 420 | 3300026121 | Ga0207683_10523963 | Ga0207683_105239632 | 169 |
| 421 | 3300026142 | Ga0207698_10003707 | Ga0207698_100037078 | 169 |
| 422 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007327 | 169 |
| 423 | 3300027111 | Ga0209281_1000039 | Ga0209281_1000039209 | 169 |
| 424 | 3300027614 | Ga0209970_1008497 | Ga0209970_10084972 | 169 |
| 425 | 3300027665 | Ga0209983_1005646 | Ga0209983_10056462 | 169 |
| 426 | 3300027666 | Ga0209282_1000017 | Ga0209282_100001775 | 169 |
| 427 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004496 | 169 |
| 428 | 3300028379 | Ga0268266_10240152 | Ga0268266_102401521 | 169 |
| 429 | 3300028380 | Ga0268265_10669325 | Ga0268265_106693252 | 169 |
| 430 | 3300028381 | Ga0268264_10207611 | Ga0268264_102076112 | 169 |
| 431 | 3300028381 | Ga0268264_10918440 | Ga0268264_109184402 | 169 |
| 432 | 3300028786 | Ga0307517_10206855 | Ga0307517_102068552 | 169 |
| 433 | 3300031238 | Ga0265332_10000010 | Ga0265332_10000010158 | 169 |
| 434 | 3300031456 | Ga0307513_10359277 | Ga0307513_103592772 | 169 |
| 435 | 3300031548 | Ga0307408_100015990 | Ga0307408_1000159905 | 169 |
| 436 | 3300031548 | Ga0307408_100943449 | Ga0307408_1009434492 | 169 |
| 437 | 3300031911 | Ga0307412_10000608 | Ga0307412_100006081 | 169 |
| 438 | 3300033180 | Ga0307510_10001599 | Ga0307510_1000159926 | 169 |
| 439 | 3300041404 | Ga0439436_0000022 | Ga0439436_0000022_53344_53856 | 169 |
| 440 | 3300042004 | Ga0439445_0004322 | Ga0439445_0004322_175_687 | 169 |
| 441 | 3300042184 | Ga0450908_000261 | Ga0450908_000261_8437_8949 | 169 |
| 442 | 3300044672 | Ga0466982_0000049 | Ga0466982_0000049_29095_29607 | 169 |
| 443 | 3300044735 | Ga0466968_0013434 | Ga0466968_0013434_1213_1722 | 169 |
| 444 | 3300044842 | Ga0466957_0013309 | Ga0466957_0013309_1045_1557 | 169 |
| 445 | 3300044842 | Ga0466957_0026700 | Ga0466957_0026700_1945_2457 | 169 |
| 446 | 3300045976 | Ga0466967_0451957 | Ga0466967_0451957_304_816 | 169 |
| 447 | 3300046452 | Ga0495617_000120 | Ga0495617_000120_48014_48526 | 169 |
| 448 | 3300046471 | Ga0495650_0000637 | Ga0495650_0000637_20194_20706 | 169 |
| 449 | 3300046471 | Ga0495650_0005076 | Ga0495650_0005076_5368_5880 | 169 |
| 450 | 3300046471 | Ga0495650_0013995 | Ga0495650_0013995_3060_3572 | 169 |
| 451 | 3300046491 | Ga0495584_0000688 | Ga0495584_0000688_2002_2514 | 169 |
| 452 | 3300046492 | Ga0495585_0006964 | Ga0495585_0006964_11_523 | 169 |
| 453 | 3300046501 | Ga0495607_0000090 | Ga0495607_0000090_61999_62511 | 169 |
| 454 | 3300046501 | Ga0495607_0000244 | Ga0495607_0000244_34090_34602 | 169 |
| 455 | 3300046501 | Ga0495607_0058090 | Ga0495607_0058090_982_1494 | 169 |
| 456 | 3300046506 | Ga0495583_0014440 | Ga0495583_0014440_420_932 | 169 |
| 457 | 3300046507 | Ga0495606_0000218 | Ga0495606_0000218_75846_76358 | 169 |
| 458 | 3300046507 | Ga0495606_0001182 | Ga0495606_0001182_22763_23275 | 169 |
| 459 | 3300046507 | Ga0495606_0004271 | Ga0495606_0004271_6503_7015 | 169 |
| 460 | 3300046507 | Ga0495606_0070176 | Ga0495606_0070176_1026_1538 | 169 |
| 461 | 3300046507 | Ga0495606_0141397 | Ga0495606_0141397_541_1053 | 169 |
| 462 | 3300046512 | Ga0495610_0001156 | Ga0495610_0001156_14200_14712 | 169 |
| 463 | 3300046512 | Ga0495610_0142818 | Ga0495610_0142818_164_676 | 169 |
| 464 | 3300046513 | Ga0495616_0000006 | Ga0495616_0000006_210785_211297 | 169 |
| 465 | 3300046513 | Ga0495616_0065467 | Ga0495616_0065467_1139_1651 | 169 |
| 466 | 3300046515 | Ga0495620_0000806 | Ga0495620_0000806_15007_15519 | 169 |
| 467 | 3300046515 | Ga0495620_0009092 | Ga0495620_0009092_4253_4765 | 169 |
| 468 | 3300046518 | Ga0495631_0000820 | Ga0495631_0000820_6680_7192 | 169 |
| 469 | 3300046519 | Ga0495632_0010885 | Ga0495632_0010885_1886_2398 | 169 |
| 470 | 3300046519 | Ga0495632_0025389 | Ga0495632_0025389_1743_2255 | 169 |
| 471 | 3300046524 | Ga0495648_0002324 | Ga0495648_0002324_6021_6533 | 169 |
| 472 | 3300046558 | Ga0495633_0000305 | Ga0495633_0000305_35310_35831 | 169 |
| 473 | 3300046558 | Ga0495633_0060118 | Ga0495633_0060118_397_909 | 169 |
| 474 | 3300046616 | Ga0495668_0002024 | Ga0495668_0002024_11154_11666 | 169 |
| 475 | 3300046648 | Ga0495611_0000126 | Ga0495611_0000126_6661_7173 | 169 |
| 476 | 3300046660 | Ga0495625_0001333 | Ga0495625_0001333_21864_22400 | 169 |
| 477 | 3300046660 | Ga0495625_0004350 | Ga0495625_0004350_1539_2051 | 169 |
| 478 | 3300046660 | Ga0495625_0050598 | Ga0495625_0050598_1038_1550 | 169 |
| 479 | 3300046665 | Ga0495661_0040309 | Ga0495661_0040309_1211_1723 | 169 |
| 480 | 3300046691 | Ga0495670_0000526 | Ga0495670_0000526_11331_11843 | 169 |
| 481 | 3300046691 | Ga0495670_0013489 | Ga0495670_0013489_2964_3476 | 169 |
| 482 | 3300046810 | Ga0495660_0000129 | Ga0495660_0000129_75973_76485 | 169 |
| 483 | 3300047320 | Ga0495672_0169397 | Ga0495672_0169397_413_925 | 169 |
| 484 | 3300047323 | Ga0495683_0004255 | Ga0495683_0004255_6498_7010 | 169 |
| 485 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_474406_474918 | 169 |
| 486 | 3300047469 | Ga0495673_0000041 | Ga0495673_0000041_89605_90117 | 169 |
| 487 | 3300047469 | Ga0495673_0017017 | Ga0495673_0017017_1556_2068 | 169 |
| 488 | 3300047472 | Ga0495686_0000108 | Ga0495686_0000108_53806_54315 | 169 |
| 489 | 3300047472 | Ga0495686_0001911 | Ga0495686_0001911_13493_14005 | 169 |
| 490 | 3300047472 | Ga0495686_0003220 | Ga0495686_0003220_328_840 | 169 |
| 491 | 3300047472 | Ga0495686_0008150 | Ga0495686_0008150_634_1146 | 169 |
| 492 | 3300048903 | Ga0496100_0026786 | Ga0496100_0026786_1007_1519 | 169 |
| 493 | 3300048904 | Ga0496101_0000399 | Ga0496101_0000399_16350_16862 | 169 |
| 494 | 3300048906 | Ga0496103_0262270 | Ga0496103_0262270_169_693 | 169 |
| 495 | 3300048907 | Ga0496104_0071049 | Ga0496104_0071049_139_663 | 169 |
| 496 | 3300048909 | Ga0496106_0000716 | Ga0496106_0000716_22512_23024 | 169 |
| 497 | 3300048909 | Ga0496106_0017532 | Ga0496106_0017532_745_1266 | 169 |
| 498 | 3300048909 | Ga0496106_0256073 | Ga0496106_0256073_512_1021 | 169 |
| 499 | 3300048911 | Ga0496108_0623598 | Ga0496108_0623598_36_548 | 169 |
| 500 | 3300048919 | Ga0496116_0002058 | Ga0496116_0002058_17659_18189 | 169 |
| 501 | 3300048920 | Ga0496117_0181931 | Ga0496117_0181931_285_797 | 169 |
| 502 | 3300048921 | Ga0496118_0002248 | Ga0496118_0002248_5281_5790 | 169 |
| 503 | 3300048921 | Ga0496118_0005121 | Ga0496118_0005121_14155_14664 | 169 |
| 504 | 3300048921 | Ga0496118_0107005 | Ga0496118_0107005_353_865 | 169 |
| 505 | 3300048924 | Ga0496121_0001451 | Ga0496121_0001451_38816_39328 | 169 |
| 506 | 3300048924 | Ga0496121_0001490 | Ga0496121_0001490_5815_6324 | 169 |
| 507 | 3300048924 | Ga0496121_0001516 | Ga0496121_0001516_13521_14033 | 169 |
| 508 | 3300048924 | Ga0496121_0003543 | Ga0496121_0003543_6565_7077 | 169 |
| 509 | 3300048924 | Ga0496121_0007024 | Ga0496121_0007024_2339_2851 | 169 |
| 510 | 3300048924 | Ga0496121_0041800 | Ga0496121_0041800_534_1046 | 169 |
| 511 | 3300048924 | Ga0496121_0187554 | Ga0496121_0187554_531_1043 | 169 |
| 512 | 3300048924 | Ga0496121_0373194 | Ga0496121_0373194_290_820 | 169 |
| 513 | 3300048924 | Ga0496121_0479508 | Ga0496121_0479508_72_584 | 169 |
| 514 | 3300048924 | Ga0496121_0491153 | Ga0496121_0491153_235_756 | 169 |
| 515 | 3300048925 | Ga0496122_0000457 | Ga0496122_0000457_2331_2861 | 169 |
| 516 | 3300048925 | Ga0496122_0024752 | Ga0496122_0024752_3342_3851 | 169 |
| 517 | 3300048925 | Ga0496122_0081987 | Ga0496122_0081987_252_773 | 169 |
| 518 | 3300048926 | Ga0496123_0000321 | Ga0496123_0000321_75080_75610 | 169 |
| 519 | 3300048926 | Ga0496123_0009893 | Ga0496123_0009893_7287_7808 | 169 |
| 520 | 3300048926 | Ga0496123_0018167 | Ga0496123_0018167_3692_4201 | 169 |
| 521 | 3300048927 | Ga0496124_0061266 | Ga0496124_0061266_2576_3088 | 169 |
| 522 | 3300048927 | Ga0496124_0497181 | Ga0496124_0497181_100_630 | 169 |
| 523 | 3300048928 | Ga0496125_0000383 | Ga0496125_0000383_46194_46715 | 169 |
| 524 | 3300048928 | Ga0496125_0000464 | Ga0496125_0000464_12563_13075 | 169 |
| 525 | 3300048928 | Ga0496125_0000895 | Ga0496125_0000895_22394_22930 | 169 |
| 526 | 3300048928 | Ga0496125_0022596 | Ga0496125_0022596_3905_4417 | 169 |
| 527 | 3300048928 | Ga0496125_0026144 | Ga0496125_0026144_776_1285 | 169 |
| 528 | 3300048928 | Ga0496125_0122306 | Ga0496125_0122306_329_850 | 169 |
| 529 | 3300048929 | Ga0496126_0041831 | Ga0496126_0041831_274_786 | 169 |
| 530 | 3300048929 | Ga0496126_0124680 | Ga0496126_0124680_43_555 | 169 |
| 531 | 3300049459 | Ga0495678_000158 | Ga0495678_000158_51824_52336 | 169 |
| 532 | 3300049568 | Ga0501031_0017131 | Ga0501031_0017131_3904_4416 | 169 |
| 533 | 3300049568 | Ga0501031_0183257 | Ga0501031_0183257_538_1050 | 169 |
| 534 | 3300049569 | Ga0501032_0004311 | Ga0501032_0004311_1777_2289 | 169 |
| 535 | 3300049569 | Ga0501032_0049118 | Ga0501032_0049118_646_1158 | 169 |
| 536 | 3300049569 | Ga0501032_0052223 | Ga0501032_0052223_891_1403 | 169 |
| 537 | 3300049569 | Ga0501032_0103190 | Ga0501032_0103190_849_1361 | 169 |
| 538 | 3300049569 | Ga0501032_0116257 | Ga0501032_0116257_33_545 | 169 |
| 539 | 3300049569 | Ga0501032_0373060 | Ga0501032_0373060_360_872 | 169 |
| 540 | 3300049569 | Ga0501032_0472475 | Ga0501032_0472475_94_606 | 169 |
| 541 | 3300049570 | Ga0501033_0002865 | Ga0501033_0002865_6477_6989 | 169 |
| 542 | 3300049570 | Ga0501033_0143108 | Ga0501033_0143108_1057_1569 | 169 |
| 543 | 3300049571 | Ga0501034_0000022 | Ga0501034_0000022_253051_253647 | 169 |
| 544 | 3300049571 | Ga0501034_0018904 | Ga0501034_0018904_217_729 | 169 |
| 545 | 3300049571 | Ga0501034_0119174 | Ga0501034_0119174_1474_1986 | 169 |
| 546 | 3300049571 | Ga0501034_0157958 | Ga0501034_0157958_217_729 | 169 |
| 547 | 3300049571 | Ga0501034_0252758 | Ga0501034_0252758_1154_1666 | 169 |
| 548 | 3300049571 | Ga0501034_0613893 | Ga0501034_0613893_112_630 | 169 |
| 549 | 3300049573 | Ga0501037_0036881 | Ga0501037_0036881_1104_1625 | 169 |
| 550 | 3300049573 | Ga0501037_0075571 | Ga0501037_0075571_1902_2414 | 169 |
| 551 | 3300049573 | Ga0501037_0084107 | Ga0501037_0084107_478_990 | 169 |
| 552 | 3300049573 | Ga0501037_0174191 | Ga0501037_0174191_163_675 | 169 |
| 553 | 3300049573 | Ga0501037_0468634 | Ga0501037_0468634_312_824 | 169 |
| 554 | 3300049573 | Ga0501037_0575971 | Ga0501037_0575971_133_645 | 169 |
| 555 | 3300049574 | Ga0501038_0002561 | Ga0501038_0002561_16384_16896 | 169 |
| 556 | 3300049574 | Ga0501038_0018512 | Ga0501038_0018512_4463_4975 | 169 |
| 557 | 3300049574 | Ga0501038_0089050 | Ga0501038_0089050_1861_2373 | 169 |
| 558 | 3300049574 | Ga0501038_0238408 | Ga0501038_0238408_262_774 | 169 |
| 559 | 3300049574 | Ga0501038_0341273 | Ga0501038_0341273_460_972 | 169 |
| 560 | 3300049575 | Ga0501039_0084323 | Ga0501039_0084323_803_1315 | 169 |
| 561 | 3300049575 | Ga0501039_0679554 | Ga0501039_0679554_280_792 | 169 |
| 562 | 3300049577 | Ga0501041_0518490 | Ga0501041_0518490_127_639 | 169 |
| 563 | 3300049578 | Ga0501042_0094635 | Ga0501042_0094635_162_674 | 169 |
| 564 | 3300049578 | Ga0501042_0345132 | Ga0501042_0345132_334_846 | 169 |
| 565 | 3300049579 | Ga0501043_0004021 | Ga0501043_0004021_6845_7357 | 169 |
| 566 | 3300049579 | Ga0501043_0008232 | Ga0501043_0008232_85_597 | 169 |
| 567 | 3300049579 | Ga0501043_0058129 | Ga0501043_0058129_2027_2539 | 169 |
| 568 | 3300049579 | Ga0501043_0447856 | Ga0501043_0447856_429_941 | 169 |
| 569 | 3300049580 | Ga0501046_0004507 | Ga0501046_0004507_7405_7917 | 169 |
| 570 | 3300049580 | Ga0501046_0024950 | Ga0501046_0024950_163_675 | 169 |
| 571 | 3300049580 | Ga0501046_0131335 | Ga0501046_0131335_108_620 | 169 |
| 572 | 3300049581 | Ga0501047_0015107 | Ga0501047_0015107_89_601 | 169 |
| 573 | 3300049581 | Ga0501047_0138822 | Ga0501047_0138822_574_1086 | 169 |
| 574 | 3300049581 | Ga0501047_0496691 | Ga0501047_0496691_352_864 | 169 |
| 575 | 3300049582 | Ga0501048_0000242 | Ga0501048_0000242_2174_2692 | 169 |
| 576 | 3300049582 | Ga0501048_0002764 | Ga0501048_0002764_4501_5013 | 169 |
| 577 | 3300049582 | Ga0501048_0018626 | Ga0501048_0018626_1975_2487 | 169 |
| 578 | 3300049583 | Ga0501067_0017043 | Ga0501067_0017043_3460_3972 | 169 |
| 579 | 3300049584 | Ga0501068_0012032 | Ga0501068_0012032_347_859 | 169 |
| 580 | 3300049584 | Ga0501068_0081837 | Ga0501068_0081837_500_1012 | 169 |
| 581 | 3300049585 | Ga0501069_0002591 | Ga0501069_0002591_2245_2757 | 169 |
| 582 | 3300049585 | Ga0501069_0010383 | Ga0501069_0010383_2256_2768 | 169 |
| 583 | 3300049586 | Ga0501070_0072382 | Ga0501070_0072382_1779_2291 | 169 |
| 584 | 3300049586 | Ga0501070_0172217 | Ga0501070_0172217_550_1062 | 169 |
| 585 | 3300049586 | Ga0501070_0340859 | Ga0501070_0340859_318_830 | 169 |
| 586 | 3300049587 | Ga0501071_0017627 | Ga0501071_0017627_1713_2225 | 169 |
| 587 | 3300049587 | Ga0501071_0137270 | Ga0501071_0137270_434_946 | 169 |
| 588 | 3300049588 | Ga0501072_0270162 | Ga0501072_0270162_822_1334 | 169 |
| 589 | 3300049588 | Ga0501072_0305176 | Ga0501072_0305176_623_1135 | 169 |
| 590 | 3300049588 | Ga0501072_1229879 | Ga0501072_1229879_51_563 | 169 |
| 591 | 3300049589 | Ga0501073_0005616 | Ga0501073_0005616_8677_9189 | 169 |
| 592 | 3300049589 | Ga0501073_0100195 | Ga0501073_0100195_1182_1694 | 169 |
| 593 | 3300049589 | Ga0501073_0579753 | Ga0501073_0579753_106_618 | 169 |
| 594 | 3300049590 | Ga0501074_0014464 | Ga0501074_0014464_3264_3776 | 169 |
| 595 | 3300049590 | Ga0501074_0081907 | Ga0501074_0081907_25_537 | 169 |
| 596 | 3300049592 | Ga0501076_0037628 | Ga0501076_0037628_1413_1925 | 169 |
| 597 | 3300049592 | Ga0501076_0220220 | Ga0501076_0220220_53_565 | 169 |
| 598 | 3300049592 | Ga0501076_0566841 | Ga0501076_0566841_411_923 | 169 |
| 599 | 3300049593 | Ga0501077_0285170 | Ga0501077_0285170_509_1021 | 169 |
| 600 | 3300049741 | Ga0501079_0023113 | Ga0501079_0023113_1619_2131 | 169 |
| 601 | 3300049741 | Ga0501079_0069026 | Ga0501079_0069026_363_875 | 169 |
| 602 | 3300049741 | Ga0501079_0158069 | Ga0501079_0158069_978_1490 | 169 |
| 603 | 3300049742 | Ga0501080_0010116 | Ga0501080_0010116_993_1505 | 169 |
| 604 | 3300049743 | Ga0501081_0212576 | Ga0501081_0212576_284_796 | 169 |
| 605 | 3300049743 | Ga0501081_0230736 | Ga0501081_0230736_44_556 | 169 |
| 606 | 3300049744 | Ga0501083_0010676 | Ga0501083_0010676_13_525 | 169 |
| 607 | 3300049744 | Ga0501083_0025162 | Ga0501083_0025162_3510_4022 | 169 |
| 608 | 3300049822 | Ga0501035_0006400 | Ga0501035_0006400_4829_5341 | 169 |
| 609 | 3300049822 | Ga0501035_0049703 | Ga0501035_0049703_3003_3515 | 169 |
| 610 | 3300049822 | Ga0501035_0204001 | Ga0501035_0204001_387_899 | 169 |
| 611 | 3300049822 | Ga0501035_0204488 | Ga0501035_0204488_678_1190 | 169 |
| 612 | 3300049823 | Ga0501044_0017194 | Ga0501044_0017194_5421_5933 | 169 |
| 613 | 3300049823 | Ga0501044_0217989 | Ga0501044_0217989_404_916 | 169 |
| 614 | 3300049823 | Ga0501044_0265141 | Ga0501044_0265141_925_1446 | 169 |
| 615 | 3300049823 | Ga0501044_0688543 | Ga0501044_0688543_77_589 | 169 |
| 616 | 3300049823 | Ga0501044_0730636 | Ga0501044_0730636_327_839 | 169 |
| 617 | 3300049823 | Ga0501044_1291197 | Ga0501044_1291197_33_545 | 169 |
| 618 | 3300049824 | Ga0501045_0006386 | Ga0501045_0006386_6589_7101 | 169 |
| 619 | 3300049824 | Ga0501045_0275481 | Ga0501045_0275481_78_590 | 169 |
| 620 | 3300049824 | Ga0501045_0560148 | Ga0501045_0560148_50_571 | 169 |
| 621 | 3300050490 | nmdc:mga03n38_2045_c1 | nmdc:mga03n38_2045_c1_2793_3305 | 169 |
| 622 | 3300050491 | nmdc:mga00v17_79234_c1 | nmdc:mga00v17_79234_c1_1225_1749 | 169 |
| 623 | 3300050492 | nmdc:mga0yw44_22853_c1 | nmdc:mga0yw44_22853_c1_212_724 | 169 |
| 624 | 3300050494 | nmdc:mga06z11_31637_c1 | nmdc:mga06z11_31637_c1_88_600 | 169 |
| 625 | 3300050494 | nmdc:mga06z11_667789_c1 | nmdc:mga06z11_667789_c1_61_573 | 169 |
| 626 | 3300050516 | nmdc:mga0sz30_5297_c1 | nmdc:mga0sz30_5297_c1_2247_2759 | 169 |
| 627 | 3300053086 | Ga0500578_0098036 | Ga0500578_0098036_12_533 | 169 |
| 628 | 3300053087 | Ga0500643_000140 | Ga0500643_000140_38134_38646 | 169 |
| 629 | 3300053087 | Ga0500643_021222 | Ga0500643_021222_768_1298 | 169 |
| 630 | 3300053096 | Ga0500641_0011118 | Ga0500641_0011118_1410_1922 | 169 |
| 631 | 3300053103 | Ga0500555_000327 | Ga0500555_000327_10408_10920 | 169 |
| 632 | 3300053103 | Ga0500555_001522 | Ga0500555_001522_3159_3671 | 169 |
| 633 | 3300053108 | Ga0500562_016650 | Ga0500562_016650_1250_1777 | 169 |
| 634 | 3300053119 | Ga0500595_032373 | Ga0500595_032373_1056_1568 | 169 |
| 635 | 3300053139 | Ga0500568_0026007 | Ga0500568_0026007_1449_1961 | 169 |
| 636 | 3300053139 | Ga0500568_0210067 | Ga0500568_0210067_43_555 | 169 |
| 637 | 3300053142 | Ga0500577_0000146 | Ga0500577_0000146_75_587 | 169 |
| 638 | 3300053153 | Ga0500616_0000401 | Ga0500616_0000401_21678_22190 | 169 |
| 639 | 3300053153 | Ga0500616_0105441 | Ga0500616_0105441_697_1209 | 169 |
| 640 | 3300053156 | Ga0500622_0175562 | Ga0500622_0175562_117_629 | 169 |
| 641 | 3300053160 | Ga0500633_0003370 | Ga0500633_0003370_2096_2608 | 169 |
| 642 | 3300053730 | Ga0500645_002572 | Ga0500645_002572_1219_1740 | 169 |
| 643 | 3300054114 | Ga0501084_0073006 | Ga0501084_0073006_2146_2658 | 169 |
| 644 | 3300060353 | Ga0501082_0029927 | Ga0501082_0029927_336_848 | 169 |
| 645 | 3300060353 | Ga0501082_0275186 | Ga0501082_0275186_520_1032 | 169 |
| 646 | 3300061719 | Ga0466962_0434926 | Ga0466962_0434926_65_577 | 169 |
| 647 | iso_pu_bacteria | 2511231003 | 2511251075 | 169 |
| 648 | iso_pu_bacteria | 2511231026 | 2511385381 | 169 |
| 649 | iso_pu_bacteria | 2521172590 | 2521557650 | 169 |
| 650 | iso_pu_bacteria | 2547132512 | 2548846432 | 169 |
| 651 | iso_pu_bacteria | 2548876994 | 2550692528 | 169 |
| 652 | iso_pu_bacteria | 2551306416 | 2553002767 | 169 |
| 653 | iso_pu_bacteria | 2643221611 | 2644074410 | 169 |
| 654 | iso_pu_bacteria | 2721755523 | 2722882435 | 169 |
| 655 | iso_pu_bacteria | 2738543012 | 2739241504 | 169 |
| 656 | iso_pu_bacteria | 2765235838 | 2765570181 | 169 |
| 657 | iso_pu_bacteria | 2816332133 | 2816473668 | 169 |
| 658 | iso_pu_bacteria | 2818991445 | 2819591508 | 169 |
| 659 | iso_pu_bacteria | 2818991449 | 2819615208 | 169 |
| 660 | iso_pu_bacteria | 2839138175 | 2839140799 | 169 |
| 661 | iso_pu_bacteria | 2842718218 | 2842721137 | 169 |
| 662 | iso_pu_bacteria | 2884811622 | 2884816600 | 169 |
| 663 | iso_pu_bacteria | 2884836552 | 2884837317 | 169 |
| 664 | iso_pu_bacteria | 2884852848 | 2884853608 | 169 |
| 665 | iso_pu_bacteria | 2896154374 | 2896155275 | 169 |
| 666 | iso_pu_bacteria | 2904439833 | 2904441611 | 169 |
| 667 | iso_pu_bacteria | 2904530477 | 2904531467 | 169 |
| 668 | iso_pu_bacteria | 2904584206 | 2904586894 | 169 |
| 669 | iso_pu_bacteria | 2904589729 | 2904593073 | 169 |
| 670 | iso_pu_bacteria | 2904601388 | 2904603089 | 169 |
| 671 | iso_pu_bacteria | 2919046199 | 2919050915 | 169 |
| 672 | iso_pu_bacteria | 2919079590 | 2919083898 | 169 |
| 673 | iso_pu_bacteria | 2923510766 | 2923510847 | 169 |
| 674 | iso_pu_bacteria | 2974320154 | 2974324036 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qpx-assembly1.cif.gz_B | crystal structures of self-capping papd chaperone homodimers | 0.6198 | 17 | 144 |
| 1l4i-assembly1.cif.gz_B | crystal structure of the periplasmic chaperone sfae | 0.5996 | 16 | 141 |
| 1qpx-assembly1.cif.gz_A | crystal structures of self-capping papd chaperone homodimers | 0.5942 | 20 | 143 |
| 8df2-assembly1.cif.gz_D | the structure of the 'alt' construct of the amuc_1438 glycopeptidase | 0.5926 | 20 | 141 |
| 1qpp-assembly1.cif.gz_A | crystal structures of self capping papd chaperone homodimers | 0.5825 | 20 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QCE4_151_241_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6892 | 115 | 147 | 2.60.40.10 |
| af_Q4DCG3_704_863_2.60.120.430 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin | 0.6852 | 17 | 143 | 2.60.120.430 |
| af_Q8I2V7_318_421_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6839 | 20 | 143 | 2.60.40.10 |
| af_Q7YTU0_40_142_2.60.40.2950 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6726 | 24 | 148 | 2.60.40.2950 |
| af_A0A1D6P2S6_66_166_2.60.40.1220 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6558 | 20 | 141 | 2.60.40.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645JKP4-F1-model_v4 | DUF2271 domain-containing protein | 0.9875 | 43 | 169 |
|
| AF-A0A645JKP4-F1-model_v4 | DUF2271 domain-containing protein | 0.9724 | 43 | 169 |
|
| AF-A0A3D0T1E3-F1-model_v4 | DUF2271 domain-containing protein | 0.9484 | 20 | 169 |
|
| AF-A0A1Y0EPB1-F1-model_v4 | DUF2271 domain-containing protein | 0.945 | 1 | 169 |
|
| AF-A0A519IXS3-F1-model_v4 | DUF2271 domain-containing protein | 0.9447 | 18 | 169 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar