F474397

General Info

Members Datasets Scaffolds Average Seq Length
674 374 599 171

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000022|Ga0501034_0000022_253051_253647
Length 198
Sequence MAFPRPPASRTIFLLHLTDEVSLNMRRLLSVTLTGMATVPFAGPVLAADLNVKVEIPRLNVAEYHKPYVAMWVERADQGPVQTLAVWYDGKLKENEGTKWLKDMRQWWRKAGRDLNMPADGISGATRAPGEHTVSFRDGKNPLGKLPAGDYQLVVEAAREVGGRELVRVPFTWPPQSAQTARARGDHELGGVTVDLKP

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
5 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
6 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
7 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
8 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
9 2547132512 Azospira oryzae 6a3 Isolate Unclassified
10 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
11 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
12 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
13 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
14 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
15 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
16 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
17 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
18 2643221611 Acidovorax sp. Root219 Isolate Unclassified
19 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
20 2643221660 Methylibium sp. Root1272 Isolate Unclassified
21 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
22 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
23 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
24 2721755523 Delftia sp. HK171 Isolate Unclassified
25 2734482264 Dyella sp. AD052 Isolate Unclassified
26 2738543009 Luteibacter sp. OK325 Isolate Unclassified
27 2738543012 Acidovorax sp. CF301 Isolate Unclassified
28 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
29 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
30 2816332133 Acidovorax radicis 2721A Isolate Unclassified
31 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
32 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
33 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
34 2831864461 Roseateles noduli HZ7 Isolate Nodule
35 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
36 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
37 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
38 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
39 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
40 2849560528 Caulobacter zeae 410 Isolate Unclassified
41 2851153111 Caulobacter radicis 736 Isolate Unclassified
42 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
43 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
44 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
45 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
46 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
47 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
48 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
49 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
50 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
51 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
52 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
53 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
54 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
55 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
56 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
57 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
58 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
59 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
60 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
61 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
62 2919085039 Luteibacter sp. 1214 Isolate Unclassified
63 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
64 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
65 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
66 2941471342 Luteibacter sp. 621 Isolate Unclassified
67 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
68 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
69 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
70 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
71 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
72 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
73 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
74 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
75 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
76 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
77 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
78 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
79 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
80 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
81 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
82 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
83 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
99 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
127 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
161 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
235 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
236 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
240 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
241 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
242 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
243 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
246 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
247 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
248 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
249 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
333 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
369 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
370 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
371 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
372 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
373 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
374 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.87
Metatranscriptomes 0
Isolates 11.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.29
Nodule 2.97
Rhizoplane 1.63
Rhizosphere 57.57
Stem 0
Stem Tuber 0
Unclassified 18.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002736 3300001904 Bacteria 3085
2 JGI24740J21852_10009636 3300001979 Bacteria 3769
3 JGI24735J21928_10033649 3300002067 Bacteria 1513
4 JGI25156J39149_1000112 3300002705 Bacteria 59192
5 JGI25156J39149_1000128 3300002705 Bacteria 56012
6 JGI25156J39149_1002904 3300002705 Bacteria 5855
7 JGI25162J39368_1004893 3300002737 Bacteria 2871
8 JGI25154J39366_1000125 3300002738 Bacteria 61587
9 JGI25154J39366_1000143 3300002738 Bacteria 56016
10 JGI25154J39366_1000228 3300002738 Bacteria 37567
11 JGI25157J39369_1000134 3300002741 Bacteria 61613
12 JGI25157J39369_1020182 3300002741 Bacteria 797
13 JGI25151J46595_10003380 3300003187 Bacteria 8833
14 JGI25151J46595_10021364 3300003187 Bacteria 2710
15 JGI25151J46595_10075606 3300003187 Bacteria 998
16 rootH2_10006506 3300003320 Bacteria 13860
17 rootH2_10225852 3300003320 Bacteria 1130
18 rootL2_10000651 3300003322 Bacteria 23314
19 rootH1_10078092 3300003323 Bacteria 1889
20 rootH1_10194283 3300003323 Bacteria 1452
21 Ga0055533_1006056 3300003756 Bacteria 1841
22 Ga0055532_1000101 3300003758 Bacteria 92881
23 Ga0055535_1006661 3300003761 Bacteria 2307
24 Ga0055526_1000535 3300003771 Bacteria 30070
25 Ga0055526_1004129 3300003771 Bacteria 8858
26 Ga0055526_1004782 3300003771 Bacteria 8019
27 Ga0055526_1039208 3300003771 Bacteria 1209
28 Ga0055537_1002025 3300003773 Bacteria 7205
29 Ga0055524_1000007 3300003775 Bacteria 298766
30 Ga0055524_1016574 3300003775 Bacteria 2636
31 Ga0055524_1031489 3300003775 Bacteria 1524
32 Ga0055536_1000078 3300003781 Bacteria 83510
33 Ga0055534_1000733 3300003784 Bacteria 15839
34 Ga0055534_1002174 3300003784 Bacteria 7000
35 Ga0055530_10001592 3300003791 Bacteria 16245
36 Ga0055540_1000042 3300003792 Bacteria 156410
37 Ga0055531_10001613 3300003794 Bacteria 16357
38 Ga0055531_10001667 3300003794 Bacteria 16000
39 Ga0055543_1003956 3300004625 Bacteria 4177
40 Ga0055543_1006647 3300004625 Bacteria 2762
41 Ga0065165_1000079 3300005262 Bacteria 162095
42 Ga0065165_1000405 3300005262 Bacteria 69154
43 Ga0065165_1000482 3300005262 Bacteria 61748
44 Ga0065165_1016998 3300005262 Bacteria 2699
45 Ga0065714_10254944 3300005288 Bacteria 758
46 Ga0065704_10080515 3300005289 Bacteria 3933
47 Ga0065704_10099871 3300005289 Bacteria 2294
48 Ga0070670_100146194 3300005331 Bacteria 2045
49 Ga0070666_10000018 3300005335 Bacteria 187218
50 Ga0070674_100371103 3300005356 Bacteria 1161
51 Ga0070674_100624546 3300005356 Bacteria 913
52 Ga0070667_100168040 3300005367 Bacteria 1935
53 Ga0070694_100430287 3300005444 Bacteria 1038
54 Ga0070678_100532907 3300005456 Bacteria 1040
55 Ga0070662_100086628 3300005457 Bacteria 2343
56 Ga0068853_101029177 3300005539 Bacteria 793
57 Ga0070665_100031056 3300005548 Bacteria 5376
58 Ga0068855_100119522 3300005563 Bacteria 3017
59 Ga0068855_100470313 3300005563 Bacteria 1370
60 Ga0068857_100146157 3300005577 Bacteria 2139
61 Ga0068854_101093607 3300005578 Bacteria 710
62 Ga0068856_100637915 3300005614 Bacteria 1086
63 Ga0068852_100043837 3300005616 Bacteria 3796
64 Ga0068861_100022802 3300005719 Bacteria 4513
65 Ga0068851_10685095 3300005834 Bacteria 630
66 Ga0068870_10638682 3300005840 Bacteria 728
67 Ga0068863_101393182 3300005841 Bacteria 709
68 Ga0068858_100179544 3300005842 Bacteria 1998
69 Ga0068858_100247571 3300005842 Bacteria 1693
70 Ga0068860_100232117 3300005843 Bacteria 1793
71 Ga0068860_100945086 3300005843 Bacteria 879
72 Ga0068862_100267778 3300005844 Bacteria 1562
73 Ga0068862_100619448 3300005844 Bacteria 1041
74 Ga0075365_10002161 3300006038 Bacteria 9457
75 Ga0075368_10085527 3300006042 Bacteria 1286
76 Ga0075368_10237850 3300006042 Bacteria 776
77 Ga0075363_100022892 3300006048 Bacteria 3162
78 Ga0075363_100333590 3300006048 Bacteria 884
79 Ga0075363_100408099 3300006048 Bacteria 799
80 Ga0075364_10099340 3300006051 Bacteria 1937
81 Ga0075367_10011481 3300006178 Bacteria 4690
82 Ga0075367_10075075 3300006178 Bacteria 2039
83 Ga0075367_10370936 3300006178 Bacteria 904
84 Ga0075366_10068254 3300006195 Bacteria 2115
85 Ga0075366_10139572 3300006195 Bacteria 1465
86 Ga0075366_10139853 3300006195 Bacteria 1463
87 Ga0075366_10331776 3300006195 Bacteria 932
88 Ga0075370_10005249 3300006353 Bacteria 6413
89 Ga0075370_10005703 3300006353 Bacteria 6212
90 Ga0075370_10021246 3300006353 Bacteria 3556
91 Ga0075430_100216334 3300006846 Bacteria 1590
92 Ga0075430_100280271 3300006846 Bacteria 1379
93 Ga0099824_1031132 3300006942 Bacteria 2059
94 Ga0099823_1000002 3300006944 Bacteria 212272
95 Ga0079104_1000002 3300006946 Bacteria 514469
96 Ga0079104_1000012 3300006946 Bacteria 355143
97 Ga0099826_10000009 3300006948 Bacteria 336081
98 Ga0099826_10000052 3300006948 Bacteria 73156
99 Ga0105251_10010122 3300009011 Bacteria 5500
100 Ga0105251_10399583 3300009011 Bacteria 632
101 Ga0105244_10106922 3300009036 Bacteria 1364
102 Ga0105244_10183947 3300009036 Bacteria 990
103 Ga0105244_10275385 3300009036 Bacteria 781
104 Ga0105240_10001934 3300009093 Bacteria 34352
105 Ga0105240_10168317 3300009093 Bacteria 2597
106 Ga0105247_10128799 3300009101 Bacteria 1648
107 Ga0105243_10005055 3300009148 Bacteria 10350
108 Ga0105242_10280134 3300009176 Bacteria 1514
109 Ga0105248_10038811 3300009177 Bacteria 5331
110 Ga0105237_10000797 3300009545 Bacteria 43129
111 Ga0105238_10000319 3300009551 Bacteria 52428
112 Ga0105238_10004630 3300009551 Bacteria 13621
113 Ga0105238_10017899 3300009551 Bacteria 7204
114 Ga0105249_10020688 3300009553 Bacteria 5884
115 Ga0105239_10087577 3300010375 Bacteria 3433
116 Ga0105239_10515226 3300010375 Bacteria 1360
117 Ga0157319_1000007 3300012497 Bacteria 318528
118 Ga0157373_10153065 3300013100 Bacteria 1622
119 Ga0157370_10005446 3300013104 Bacteria 14278
120 Ga0157369_10000580 3300013105 Bacteria 47824
121 Ga0163162_10030575 3300013306 Bacteria 5336
122 Ga0163162_10033887 3300013306 Bacteria 5078
123 Ga0157375_10442276 3300013308 Bacteria 1466
124 Ga0157380_10090734 3300014326 Bacteria 2521
125 Ga0182008_10002417 3300014497 Bacteria 11719
126 Ga0182008_10008058 3300014497 Bacteria 5773
127 Ga0157379_10754203 3300014968 Bacteria 916
128 Ga0157376_10461978 3300014969 Bacteria 1240
129 Ga0182006_1000002 3300015261 Bacteria 887990
130 Ga0182006_1000031 3300015261 Bacteria 240055
131 Ga0182006_1000847 3300015261 Bacteria 20577
132 Ga0182006_1001950 3300015261 Bacteria 11702
133 Ga0182006_1071161 3300015261 Bacteria 1289
134 Ga0182007_10001827 3300015262 Bacteria 11105
135 Ga0182007_10002777 3300015262 Bacteria 8548
136 Ga0182007_10020516 3300015262 Bacteria 2361
137 Ga0182007_10029289 3300015262 Bacteria 1886
138 Ga0182007_10055108 3300015262 Bacteria 1307
139 Ga0182005_1000029 3300015265 Bacteria 214132
140 Ga0182005_1000352 3300015265 Bacteria 26091
141 Ga0182005_1000434 3300015265 Bacteria 22191
142 Ga0163161_10004612 3300017792 Bacteria 9591
143 Ga0163161_10637301 3300017792 Bacteria 882
144 Ga0163161_10647303 3300017792 Bacteria 875
145 Ga0209435_100016 3300025206 Bacteria 305566
146 Ga0209435_100101 3300025206 Bacteria 35039
147 Ga0209674_101336 3300025226 Bacteria 6759
148 Ga0209147_100023 3300025229 Bacteria 437803
149 Ga0209147_103555 3300025229 Bacteria 2967
150 Ga0209437_100166 3300025233 Bacteria 144787
151 Ga0209258_100345 3300025242 Bacteria 67870
152 Ga0209646_1000033 3300025246 Bacteria 369507
153 Ga0209646_1000093 3300025246 Bacteria 183840
154 Ga0209026_1000031 3300025250 Bacteria 325747
155 Ga0209026_1000870 3300025250 Bacteria 15779
156 Ga0209148_1008635 3300025254 Bacteria 2037
157 Ga0209759_1000227 3300025256 Bacteria 84278
158 Ga0209759_1000346 3300025256 Bacteria 60977
159 Ga0209565_1000094 3300025263 Bacteria 134853
160 Ga0209565_1004914 3300025263 Bacteria 3983
161 Ga0209455_1010811 3300025272 Bacteria 2293
162 Ga0209673_1006810 3300025273 Bacteria 5426
163 Ga0209673_1023583 3300025273 Bacteria 2090
164 Ga0209675_1000087 3300025291 Bacteria 147632
165 Ga0209675_1001508 3300025291 Bacteria 13319
166 Ga0209675_1004217 3300025291 Bacteria 6491
167 Ga0209675_1013469 3300025291 Bacteria 2552
168 Ga0209675_1028130 3300025291 Bacteria 1371
169 Ga0209676_1000176 3300025292 Bacteria 152347
170 Ga0209025_1000046 3300025294 Bacteria 348962
171 Ga0209025_1000123 3300025294 Bacteria 204125
172 Ga0209025_1000764 3300025294 Bacteria 53509
173 Ga0209025_1008843 3300025294 Bacteria 7147
174 Ga0209025_1057007 3300025294 Bacteria 1497
175 Ga0209564_1000030 3300025295 Bacteria 503296
176 Ga0209564_1000166 3300025295 Bacteria 160208
177 Ga0209564_1001192 3300025295 Bacteria 29807
178 Ga0209564_1001289 3300025295 Bacteria 27413
179 Ga0209758_1014801 3300025297 Bacteria 4109
180 Ga0209050_1001487 3300025298 Bacteria 24916
181 Ga0209050_1002014 3300025298 Bacteria 18937
182 Ga0209256_1000005 3300025299 Bacteria 1315082
183 Ga0209256_1000030 3300025299 Bacteria 414828
184 Ga0209256_1000432 3300025299 Bacteria 65073
185 Ga0209256_1000960 3300025299 Bacteria 34857
186 Ga0209256_1001426 3300025299 Bacteria 24827
187 Ga0209256_1002066 3300025299 Bacteria 17690
188 Ga0209256_1034134 3300025299 Bacteria 1359
189 Ga0207426_1024982 3300025302 Bacteria 2019
190 Ga0209051_1000004 3300025303 Bacteria 1155596
191 Ga0209051_1001383 3300025303 Bacteria 20933
192 Ga0209051_1009602 3300025303 Bacteria 4968
193 Ga0209051_1027983 3300025303 Bacteria 2236
194 Ga0209051_1035742 3300025303 Bacteria 1844
195 Ga0209257_1000063 3300025304 Bacteria 359089
196 Ga0209257_1002063 3300025304 Bacteria 21217
197 Ga0209257_1002789 3300025304 Bacteria 16469
198 Ga0207713_1017282 3300025735 Bacteria 3625
199 Ga0207642_10065029 3300025899 Bacteria 1712
200 Ga0207710_10002899 3300025900 Bacteria 7799
201 Ga0207710_10350156 3300025900 Bacteria 752
202 Ga0207688_10075061 3300025901 Bacteria 1924
203 Ga0207680_10000002 3300025903 Bacteria 1018646
204 Ga0207647_10000008 3300025904 Bacteria 192602
205 Ga0207645_10652017 3300025907 Bacteria 715
206 Ga0207705_10007929 3300025909 Bacteria 7794
207 Ga0207695_10001378 3300025913 Bacteria 41129
208 Ga0207695_10002689 3300025913 Bacteria 25925
209 Ga0207695_10018810 3300025913 Bacteria 7971
210 Ga0207671_10008460 3300025914 Bacteria 8723
211 Ga0207649_10085238 3300025920 Bacteria 2056
212 Ga0207649_10124763 3300025920 Bacteria 1741
213 Ga0207694_10000388 3300025924 Bacteria 40972
214 Ga0207694_10002955 3300025924 Bacteria 13648
215 Ga0207650_10086097 3300025925 Bacteria 2392
216 Ga0207706_10331995 3300025933 Bacteria 1323
217 Ga0207709_10000015 3300025935 Bacteria 493221
218 Ga0207669_10349706 3300025937 Bacteria 1141
219 Ga0207711_10016483 3300025941 Bacteria 6139
220 Ga0207667_10056339 3300025949 Bacteria 4129
221 Ga0207667_10131976 3300025949 Bacteria 2573
222 Ga0207667_10691320 3300025949 Bacteria 1023
223 Ga0207712_10258726 3300025961 Bacteria 1410
224 Ga0207668_10005187 3300025972 Bacteria 7663
225 Ga0207640_10004825 3300025981 Bacteria 7325
226 Ga0207658_10627118 3300025986 Bacteria 967
227 Ga0207703_10259667 3300026035 Bacteria 1570
228 Ga0207678_10297556 3300026067 Bacteria 1386
229 Ga0207674_10274526 3300026116 Bacteria 1633
230 Ga0207674_10300170 3300026116 Bacteria 1555
231 Ga0207675_100035947 3300026118 Bacteria 4621
232 Ga0207675_101297181 3300026118 Bacteria 749
233 Ga0207683_10523963 3300026121 Bacteria 1095
234 Ga0207698_10003707 3300026142 Bacteria 9237
235 Ga0209281_1000007 3300027111 Bacteria 938265
236 Ga0209281_1000039 3300027111 Bacteria 355150
237 Ga0209389_1002519 3300027296 Bacteria 14139
238 Ga0209371_1030596 3300027312 Bacteria 1178
239 Ga0209970_1008497 3300027614 Bacteria 1682
240 Ga0209983_1005646 3300027665 Bacteria 2580
241 Ga0209282_1000001 3300027666 Bacteria 2450367
242 Ga0209282_1000017 3300027666 Bacteria 191482
243 Ga0268266_10000004 3300028379 Bacteria 1495817
244 Ga0268266_10240152 3300028379 Bacteria 1672
245 Ga0268265_10669325 3300028380 Bacteria 1000
246 Ga0268264_10207611 3300028381 Bacteria 1796
247 Ga0268264_10918440 3300028381 Bacteria 879
248 Ga0307517_10206855 3300028786 Bacteria 1216
249 Ga0307515_10000567 3300028794 Bacteria 87086
250 Ga0307515_10001764 3300028794 Bacteria 48206
251 Ga0307515_10006103 3300028794 Bacteria 24230
252 Ga0307515_10032674 3300028794 Bacteria 8606
253 Ga0268256_1009564 3300030500 Bacteria 3201
254 Ga0307512_10021151 3300030522 Bacteria 5870
255 Ga0265332_10000010 3300031238 Bacteria 289041
256 Ga0307513_10002614 3300031456 Bacteria 24859
257 Ga0307513_10023800 3300031456 Bacteria 7146
258 Ga0307513_10359277 3300031456 Bacteria 1202
259 Ga0307509_10022947 3300031507 Bacteria 7018
260 Ga0307408_100015990 3300031548 Bacteria 5003
261 Ga0307408_100029014 3300031548 Bacteria 3829
262 Ga0307408_100943449 3300031548 Bacteria 792
263 Ga0307508_10000133 3300031616 Bacteria 87867
264 Ga0307508_10079502 3300031616 Bacteria 2860
265 Ga0307514_10004805 3300031649 Bacteria 12315
266 Ga0307516_10000253 3300031730 Bacteria 68852
267 Ga0307516_10013972 3300031730 Bacteria 8521
268 Ga0307412_10000608 3300031911 Bacteria 21074
269 Ga0307412_10768968 3300031911 Bacteria 833
270 Ga0307416_101788959 3300032002 Bacteria 718
271 Ga0307414_10009304 3300032004 Bacteria 5635
272 Ga0307411_10107837 3300032005 Bacteria 1986
273 Ga0307507_10029260 3300033179 Bacteria 5846
274 Ga0307510_10001599 3300033180 Bacteria 25051
275 Ga0395905_0219689 3300037471 Bacteria 1778
276 Ga0400483_135774 3300039062 Bacteria 2260
277 Ga0400483_241741 3300039062 Bacteria 8426
278 Ga0439436_0000022 3300041404 Bacteria 60408
279 Ga0451795_0071722 3300041456 Bacteria 802
280 Ga0451835_0702106 3300041492 Bacteria 1312
281 Ga0451845_0298471 3300041501 Bacteria 675
282 Ga0451843_1377075 3300041509 Bacteria 879
283 Ga0451853_1603597 3300041512 Bacteria 1472
284 Ga0439445_0004322 3300042004 Bacteria 3215
285 Ga0450890_002465 3300042127 Bacteria 2546
286 Ga0450892_000837 3300042130 Bacteria 3378
287 Ga0450889_000111 3300042144 Bacteria 8052
288 Ga0450906_041829 3300042145 Bacteria 809
289 Ga0450908_000261 3300042184 Bacteria 10417
290 Ga0439459_0000041 3300042438 Bacteria 10569
291 Ga0450916_000906 3300042530 Bacteria 2825
292 Ga0450893_0044706 3300042532 Bacteria 818
293 Ga0439440_0035434 3300042993 Bacteria 1197
294 Ga0466982_0000049 3300044672 Bacteria 36295
295 Ga0466963_0006616 3300044694 Bacteria 6875
296 Ga0466968_0013434 3300044735 Bacteria 3221
297 Ga0466968_0119663 3300044735 Bacteria 1190
298 Ga0466957_0013309 3300044842 Bacteria 4772
299 Ga0466957_0026700 3300044842 Bacteria 3427
300 Ga0466967_0451957 3300045976 Bacteria 1256
301 Ga0495617_000120 3300046452 Bacteria 52244
302 Ga0495617_000348 3300046452 Bacteria 25506
303 Ga0495590_0107430 3300046457 Bacteria 994
304 Ga0495638_0000564 3300046460 Bacteria 42120
305 Ga0495650_0000011 3300046471 Bacteria 615329
306 Ga0495650_0000637 3300046471 Bacteria 46877
307 Ga0495650_0004416 3300046471 Bacteria 9650
308 Ga0495650_0005076 3300046471 Bacteria 8711
309 Ga0495650_0013995 3300046471 Bacteria 4207
310 Ga0495605_0028815 3300046474 Bacteria 2863
311 Ga0495584_0000688 3300046491 Bacteria 22464
312 Ga0495584_0006451 3300046491 Bacteria 6139
313 Ga0495585_0006964 3300046492 Bacteria 6961
314 Ga0495596_0000070 3300046500 Bacteria 75962
315 Ga0495607_0000090 3300046501 Bacteria 94252
316 Ga0495607_0000244 3300046501 Bacteria 58158
317 Ga0495607_0058090 3300046501 Bacteria 2214
318 Ga0495583_0014440 3300046506 Bacteria 4357
319 Ga0495606_0000218 3300046507 Bacteria 101645
320 Ga0495606_0001182 3300046507 Bacteria 36798
321 Ga0495606_0004271 3300046507 Bacteria 14422
322 Ga0495606_0052282 3300046507 Bacteria 2658
323 Ga0495606_0070176 3300046507 Bacteria 2210
324 Ga0495606_0141397 3300046507 Bacteria 1421
325 Ga0495610_0000277 3300046512 Bacteria 53626
326 Ga0495610_0001156 3300046512 Bacteria 24006
327 Ga0495610_0035249 3300046512 Bacteria 2571
328 Ga0495610_0142818 3300046512 Bacteria 1028
329 Ga0495616_0000006 3300046513 Bacteria 234766
330 Ga0495616_0001909 3300046513 Bacteria 14059
331 Ga0495616_0041065 3300046513 Bacteria 2361
332 Ga0495616_0065467 3300046513 Bacteria 1770
333 Ga0495620_0000806 3300046515 Bacteria 19267
334 Ga0495620_0009092 3300046515 Bacteria 5301
335 Ga0495631_0000820 3300046518 Bacteria 19864
336 Ga0495631_0014388 3300046518 Bacteria 3819
337 Ga0495632_0010885 3300046519 Bacteria 5347
338 Ga0495632_0025389 3300046519 Bacteria 3134
339 Ga0495637_0008754 3300046520 Bacteria 4959
340 Ga0495637_0104759 3300046520 Bacteria 1102
341 Ga0495643_0079344 3300046522 Bacteria 1711
342 Ga0495648_0000334 3300046524 Bacteria 51958
343 Ga0495648_0002324 3300046524 Bacteria 17692
344 Ga0495609_0008576 3300046538 Bacteria 4995
345 Ga0495609_0013246 3300046538 Bacteria 3899
346 Ga0495633_0000305 3300046558 Bacteria 55923
347 Ga0495633_0060118 3300046558 Bacteria 1781
348 Ga0495656_0025926 3300046615 Bacteria 2329
349 Ga0495668_0002024 3300046616 Bacteria 17702
350 Ga0495611_0000001 3300046648 Bacteria 2628469
351 Ga0495611_0000126 3300046648 Bacteria 53596
352 Ga0495625_0000200 3300046660 Bacteria 95445
353 Ga0495625_0000452 3300046660 Bacteria 61641
354 Ga0495625_0001333 3300046660 Bacteria 30655
355 Ga0495625_0004350 3300046660 Bacteria 13456
356 Ga0495625_0050598 3300046660 Bacteria 2981
357 Ga0495625_0184572 3300046660 Bacteria 1385
358 Ga0495625_0398243 3300046660 Bacteria 861
359 Ga0495661_0040309 3300046665 Bacteria 2897
360 Ga0495670_0000526 3300046691 Bacteria 18161
361 Ga0495670_0013489 3300046691 Bacteria 4020
362 Ga0495670_0028409 3300046691 Bacteria 2773
363 Ga0495670_0029855 3300046691 Bacteria 2708
364 Ga0495670_0142427 3300046691 Bacteria 1254
365 Ga0495671_0000457 3300046692 Bacteria 32058
366 Ga0495671_0001886 3300046692 Bacteria 13464
367 Ga0495649_0077961 3300046694 Bacteria 1773
368 Ga0495589_0000008 3300046794 Bacteria 266071
369 Ga0495589_0188993 3300046794 Bacteria 975
370 Ga0495660_0000129 3300046810 Bacteria 83044
371 Ga0495660_0046730 3300046810 Bacteria 2373
372 Ga0495672_0010016 3300047320 Bacteria 6794
373 Ga0495672_0169397 3300047320 Bacteria 1115
374 Ga0495683_0004255 3300047323 Bacteria 8171
375 Ga0495683_0038508 3300047323 Bacteria 2421
376 Ga0495679_000004 3300047446 Bacteria 748056
377 Ga0495685_130051 3300047447 Bacteria 823
378 Ga0495673_0000004 3300047469 Bacteria 1354526
379 Ga0495673_0000041 3300047469 Bacteria 296723
380 Ga0495673_0002539 3300047469 Bacteria 12740
381 Ga0495673_0002704 3300047469 Bacteria 12187
382 Ga0495673_0017017 3300047469 Bacteria 3703
383 Ga0495686_0000108 3300047472 Bacteria 173579
384 Ga0495686_0001764 3300047472 Bacteria 22143
385 Ga0495686_0001911 3300047472 Bacteria 20803
386 Ga0495686_0003220 3300047472 Bacteria 14363
387 Ga0495686_0008150 3300047472 Bacteria 7742
388 Ga0495686_0008342 3300047472 Bacteria 7614
389 Ga0495686_0099252 3300047472 Bacteria 1758
390 Ga0496100_0026786 3300048903 Bacteria 3538
391 Ga0496101_0000399 3300048904 Bacteria 28414
392 Ga0496103_0262270 3300048906 Bacteria 1112
393 Ga0496104_0071049 3300048907 Bacteria 3310
394 Ga0496106_0000716 3300048909 Bacteria 23870
395 Ga0496106_0017532 3300048909 Bacteria 5300
396 Ga0496106_0256073 3300048909 Bacteria 1400
397 Ga0496108_0623598 3300048911 Bacteria 939
398 Ga0496109_0726429 3300048912 Bacteria 931
399 Ga0496116_0002058 3300048919 Bacteria 21537
400 Ga0496116_0008775 3300048919 Bacteria 8720
401 Ga0496116_0025209 3300048919 Bacteria 4376
402 Ga0496117_0181931 3300048920 Bacteria 1207
403 Ga0496118_0002248 3300048921 Bacteria 26506
404 Ga0496118_0005121 3300048921 Bacteria 15059
405 Ga0496118_0107005 3300048921 Bacteria 1869
406 Ga0496121_0001451 3300048924 Bacteria 40023
407 Ga0496121_0001490 3300048924 Bacteria 39440
408 Ga0496121_0001516 3300048924 Bacteria 38982
409 Ga0496121_0003074 3300048924 Bacteria 24167
410 Ga0496121_0003543 3300048924 Bacteria 22104
411 Ga0496121_0003558 3300048924 Bacteria 22042
412 Ga0496121_0006246 3300048924 Bacteria 14921
413 Ga0496121_0007024 3300048924 Bacteria 13676
414 Ga0496121_0041800 3300048924 Bacteria 4000
415 Ga0496121_0187554 3300048924 Bacteria 1486
416 Ga0496121_0373194 3300048924 Bacteria 943
417 Ga0496121_0479508 3300048924 Bacteria 795
418 Ga0496121_0491153 3300048924 Bacteria 782
419 Ga0496122_0000457 3300048925 Bacteria 84895
420 Ga0496122_0003366 3300048925 Bacteria 21050
421 Ga0496122_0024752 3300048925 Bacteria 5243
422 Ga0496122_0081987 3300048925 Bacteria 2242
423 Ga0496123_0000208 3300048926 Bacteria 119807
424 Ga0496123_0000321 3300048926 Bacteria 91682
425 Ga0496123_0009893 3300048926 Bacteria 8510
426 Ga0496123_0018167 3300048926 Bacteria 5611
427 Ga0496124_0061266 3300048927 Bacteria 3154
428 Ga0496124_0497181 3300048927 Bacteria 819
429 Ga0496125_0000383 3300048928 Bacteria 82288
430 Ga0496125_0000464 3300048928 Bacteria 72660
431 Ga0496125_0000895 3300048928 Bacteria 47230
432 Ga0496125_0022596 3300048928 Bacteria 5835
433 Ga0496125_0026144 3300048928 Bacteria 5330
434 Ga0496125_0070787 3300048928 Bacteria 2728
435 Ga0496125_0122306 3300048928 Bacteria 1853
436 Ga0496126_0041831 3300048929 Bacteria 4237
437 Ga0496126_0078991 3300048929 Bacteria 2914
438 Ga0496126_0124680 3300048929 Bacteria 2231
439 Ga0495678_000158 3300049459 Bacteria 81058
440 Ga0495678_002113 3300049459 Bacteria 14106
441 Ga0495682_0099187 3300049460 Bacteria 1045
442 Ga0501031_0017131 3300049568 Bacteria 4707
443 Ga0501031_0183257 3300049568 Bacteria 1367
444 Ga0501032_0004311 3300049569 Bacteria 10743
445 Ga0501032_0010978 3300049569 Bacteria 6512
446 Ga0501032_0049118 3300049569 Bacteria 2847
447 Ga0501032_0052223 3300049569 Bacteria 2754
448 Ga0501032_0103190 3300049569 Bacteria 1889
449 Ga0501032_0116257 3300049569 Bacteria 1768
450 Ga0501032_0373060 3300049569 Bacteria 918
451 Ga0501032_0472475 3300049569 Bacteria 802
452 Ga0501033_0002865 3300049570 Bacteria 14457
453 Ga0501033_0019681 3300049570 Bacteria 5101
454 Ga0501033_0143108 3300049570 Bacteria 1728
455 Ga0501033_0301935 3300049570 Bacteria 1127
456 Ga0501034_0000022 3300049571 Bacteria 264441
457 Ga0501034_0018904 3300049571 Bacteria 7058
458 Ga0501034_0119174 3300049571 Bacteria 2626
459 Ga0501034_0157958 3300049571 Bacteria 2240
460 Ga0501034_0176224 3300049571 Bacteria 2104
461 Ga0501034_0252758 3300049571 Bacteria 1707
462 Ga0501034_0613893 3300049571 Bacteria 992
463 Ga0501037_0036881 3300049573 Bacteria 3603
464 Ga0501037_0075571 3300049573 Bacteria 2446
465 Ga0501037_0084107 3300049573 Bacteria 2304
466 Ga0501037_0174191 3300049573 Bacteria 1528
467 Ga0501037_0468634 3300049573 Bacteria 857
468 Ga0501037_0575971 3300049573 Bacteria 758
469 Ga0501038_0002561 3300049574 Bacteria 16947
470 Ga0501038_0018512 3300049574 Bacteria 6289
471 Ga0501038_0089050 3300049574 Bacteria 2589
472 Ga0501038_0238408 3300049574 Bacteria 1445
473 Ga0501038_0341273 3300049574 Bacteria 1168
474 Ga0501038_0548399 3300049574 Bacteria 879
475 Ga0501039_0084323 3300049575 Bacteria 2474
476 Ga0501039_0679554 3300049575 Bacteria 805
477 Ga0501041_0093338 3300049577 Bacteria 1859
478 Ga0501041_0518490 3300049577 Bacteria 759
479 Ga0501042_0094635 3300049578 Bacteria 2145
480 Ga0501042_0270722 3300049578 Bacteria 1226
481 Ga0501042_0345132 3300049578 Bacteria 1076
482 Ga0501043_0004021 3300049579 Bacteria 12023
483 Ga0501043_0006326 3300049579 Bacteria 9511
484 Ga0501043_0008232 3300049579 Bacteria 8217
485 Ga0501043_0058129 3300049579 Bacteria 3036
486 Ga0501043_0447856 3300049579 Bacteria 970
487 Ga0501046_0004507 3300049580 Bacteria 12624
488 Ga0501046_0024950 3300049580 Bacteria 4898
489 Ga0501046_0131335 3300049580 Bacteria 1899
490 Ga0501047_0015107 3300049581 Bacteria 7350
491 Ga0501047_0138822 3300049581 Bacteria 2309
492 Ga0501047_0252343 3300049581 Bacteria 1612
493 Ga0501047_0496691 3300049581 Bacteria 1047
494 Ga0501048_0000242 3300049582 Bacteria 36361
495 Ga0501048_0002764 3300049582 Bacteria 13390
496 Ga0501048_0018626 3300049582 Bacteria 5104
497 Ga0501048_0133662 3300049582 Bacteria 1753
498 Ga0501048_0328349 3300049582 Bacteria 1090
499 Ga0501067_0017043 3300049583 Bacteria 4014
500 Ga0501068_0012032 3300049584 Bacteria 4895
501 Ga0501068_0081837 3300049584 Bacteria 1982
502 Ga0501069_0002591 3300049585 Bacteria 9222
503 Ga0501069_0010383 3300049585 Bacteria 4926
504 Ga0501070_0072382 3300049586 Bacteria 2853
505 Ga0501070_0118692 3300049586 Bacteria 2186
506 Ga0501070_0172217 3300049586 Bacteria 1783
507 Ga0501070_0340859 3300049586 Bacteria 1217
508 Ga0501071_0017627 3300049587 Bacteria 4929
509 Ga0501071_0084923 3300049587 Bacteria 2321
510 Ga0501071_0137270 3300049587 Bacteria 1820
511 Ga0501071_0209604 3300049587 Bacteria 1465
512 Ga0501072_0137161 3300049588 Bacteria 1950
513 Ga0501072_0270162 3300049588 Bacteria 1353
514 Ga0501072_0305176 3300049588 Bacteria 1265
515 Ga0501072_1097386 3300049588 Unclassified 619
516 Ga0501072_1229879 3300049588 Bacteria 581
517 Ga0501073_0005616 3300049589 Bacteria 9386
518 Ga0501073_0100195 3300049589 Bacteria 2011
519 Ga0501073_0579753 3300049589 Bacteria 775
520 Ga0501074_0014464 3300049590 Bacteria 5741
521 Ga0501074_0081907 3300049590 Bacteria 2314
522 Ga0501076_0037628 3300049592 Bacteria 3796
523 Ga0501076_0111145 3300049592 Bacteria 2215
524 Ga0501076_0220220 3300049592 Unclassified 1551
525 Ga0501076_0566841 3300049592 Bacteria 936
526 Ga0501077_0052620 3300049593 Bacteria 2586
527 Ga0501077_0285170 3300049593 Bacteria 1051
528 Ga0501077_0519480 3300049593 Unclassified 764
529 Ga0501222_026102 3300049662 Bacteria 793
530 Ga0501252_001571 3300049682 Bacteria 2133
531 Ga0501079_0023113 3300049741 Bacteria 4773
532 Ga0501079_0069026 3300049741 Bacteria 2728
533 Ga0501079_0158069 3300049741 Bacteria 1767
534 Ga0501080_0010116 3300049742 Bacteria 8626
535 Ga0501081_0212576 3300049743 Bacteria 1405
536 Ga0501081_0230736 3300049743 Unclassified 1348
537 Ga0501083_0010676 3300049744 Bacteria 6461
538 Ga0501083_0025162 3300049744 Bacteria 4121
539 Ga0501035_0006400 3300049822 Bacteria 11071
540 Ga0501035_0049703 3300049822 Bacteria 3757
541 Ga0501035_0204001 3300049822 Bacteria 1694
542 Ga0501035_0204488 3300049822 Bacteria 1692
543 Ga0501035_0513142 3300049822 Bacteria 985
544 Ga0501044_0017194 3300049823 Bacteria 7760
545 Ga0501044_0035158 3300049823 Bacteria 5248
546 Ga0501044_0217989 3300049823 Bacteria 1860
547 Ga0501044_0265141 3300049823 Bacteria 1655
548 Ga0501044_0688543 3300049823 Bacteria 908
549 Ga0501044_0730636 3300049823 Bacteria 873
550 Ga0501044_1291197 3300049823 Bacteria 596
551 Ga0501045_0006386 3300049824 Bacteria 8162
552 Ga0501045_0275481 3300049824 Bacteria 1252
553 Ga0501045_0560148 3300049824 Bacteria 847
554 nmdc:mga03n38_2045_c1 3300050490 Bacteria 6085
555 nmdc:mga00v17_79234_c1 3300050491 Bacteria 2048
556 nmdc:mga0yw44_22853_c1 3300050492 Bacteria 3514
557 nmdc:mga0k408_132915_c1 3300050493 Bacteria 1477
558 nmdc:mga0k408_55401_c1 3300050493 Bacteria 2299
559 nmdc:mga0k408_555277_c1 3300050493 Bacteria 679
560 nmdc:mga06z11_31637_c1 3300050494 Bacteria 2573
561 nmdc:mga06z11_667789_c1 3300050494 Bacteria 633
562 nmdc:mga07m45_13111_c1 3300050496 Bacteria 4389
563 nmdc:mga07m45_158420_c1 3300050496 Bacteria 1314
564 nmdc:mga07m45_3159_c1 3300050496 Bacteria 7903
565 nmdc:mga0qj67_207741_c1 3300050509 Bacteria 1590
566 nmdc:mga0sz30_5297_c1 3300050516 Bacteria 4725
567 Ga0500578_0098036 3300053086 Bacteria 1857
568 Ga0500643_000140 3300053087 Bacteria 72592
569 Ga0500643_021222 3300053087 Bacteria 2108
570 Ga0500641_0011118 3300053096 Bacteria 3263
571 Ga0500555_000327 3300053103 Bacteria 20441
572 Ga0500555_001522 3300053103 Bacteria 7017
573 Ga0500562_000540 3300053108 Bacteria 9171
574 Ga0500562_002502 3300053108 Bacteria 4589
575 Ga0500562_016650 3300053108 Bacteria 1891
576 Ga0500595_032373 3300053119 Bacteria 1746
577 Ga0500618_058314 3300053125 Bacteria 869
578 Ga0500652_237911 3300053131 Bacteria 726
579 Ga0500658_0034983 3300053134 Bacteria 1986
580 Ga0500564_000419 3300053138 Bacteria 12247
581 Ga0500568_0026007 3300053139 Bacteria 2461
582 Ga0500568_0210067 3300053139 Bacteria 712
583 Ga0500577_0000146 3300053142 Bacteria 17264
584 Ga0500616_0000401 3300053153 Bacteria 59226
585 Ga0500616_0024213 3300053153 Bacteria 3376
586 Ga0500616_0105441 3300053153 Bacteria 1370
587 Ga0500622_0001772 3300053156 Bacteria 16534
588 Ga0500622_0002557 3300053156 Bacteria 13029
589 Ga0500622_0175562 3300053156 Bacteria 994
590 Ga0500633_0003370 3300053160 Bacteria 3476
591 Ga0500645_001108 3300053730 Bacteria 14718
592 Ga0500645_001192 3300053730 Bacteria 13818
593 Ga0500645_002572 3300053730 Bacteria 7982
594 Ga0500587_000148 3300053739 Bacteria 6734
595 Ga0501084_0073006 3300054114 Bacteria 2873
596 Ga0501082_0029927 3300060353 Bacteria 4691
597 Ga0501082_0275186 3300060353 Bacteria 1465
598 Ga0466962_0434926 3300061719 Bacteria 660
599 Ga0530510_0123119 3300061734 Bacteria 1905

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10194283 rootH1_101942832 150
2 3300005614 Ga0068856_100637915 Ga0068856_1006379152 150
3 3300009036 Ga0105244_10106922 Ga0105244_101069222 150
4 3300009093 Ga0105240_10168317 Ga0105240_101683173 150
5 3300009545 Ga0105237_10000797 Ga0105237_1000079738 150
6 3300009551 Ga0105238_10004630 Ga0105238_1000463011 150
7 3300010375 Ga0105239_10087577 Ga0105239_100875774 150
8 3300015261 Ga0182006_1000847 Ga0182006_10008477 150
9 3300025913 Ga0207695_10001378 Ga0207695_1000137818 150
10 3300025914 Ga0207671_10008460 Ga0207671_100084605 150
11 3300025924 Ga0207694_10002955 Ga0207694_100029553 150
12 3300025981 Ga0207640_10004825 Ga0207640_100048258 150
13 3300015262 Ga0182007_10020516 Ga0182007_100205162 151
14 3300041501 Ga0451845_0298471 Ga0451845_0298471_52_582 155
15 iso_pu_bacteria 644736347 644752226 155
16 iso_pu_bacteria 2643221598 2644000454 156
17 3300042127 Ga0450890_002465 Ga0450890_002465_416_946 157
18 3300042130 Ga0450892_000837 Ga0450892_000837_362_892 157
19 3300042144 Ga0450889_000111 Ga0450889_000111_735_1265 157
20 3300042530 Ga0450916_000906 Ga0450916_000906_333_863 157
21 3300042993 Ga0439440_0035434 Ga0439440_0035434_352_882 157
22 3300049570 Ga0501033_0301935 Ga0501033_0301935_471_992 157
23 3300049587 Ga0501071_0209604 Ga0501071_0209604_385_864 158
24 3300049588 Ga0501072_0137161 Ga0501072_0137161_856_1335 158
25 3300049593 Ga0501077_0052620 Ga0501077_0052620_1908_2387 158
26 iso_pu_bacteria 640427133 640486957 159
27 3300015262 Ga0182007_10055108 Ga0182007_100551082 160
28 3300031911 Ga0307412_10768968 Ga0307412_107689681 160
29 3300032005 Ga0307411_10107837 Ga0307411_101078372 160
30 3300039062 Ga0400483_135774 Ga0400483_135774_119_634 160
31 3300039062 Ga0400483_241741 Ga0400483_241741_6396_6899 160
32 3300042532 Ga0450893_0044706 Ga0450893_0044706_286_807 160
33 iso_pu_bacteria 2585428062 2587757815 160
34 3300003320 rootH2_10225852 rootH2_102258522 161
35 3300003771 Ga0055526_1000535 Ga0055526_10005356 161
36 3300009011 Ga0105251_10010122 Ga0105251_100101224 161
37 3300025295 Ga0209564_1000030 Ga0209564_1000030128 161
38 3300046474 Ga0495605_0028815 Ga0495605_0028815_1247_1744 161
39 3300046491 Ga0495584_0006451 Ga0495584_0006451_4320_4817 161
40 3300046500 Ga0495596_0000070 Ga0495596_0000070_43392_43889 161
41 3300046507 Ga0495606_0052282 Ga0495606_0052282_1578_2075 161
42 3300046512 Ga0495610_0000277 Ga0495610_0000277_17139_17636 161
43 3300046513 Ga0495616_0041065 Ga0495616_0041065_1449_1946 161
44 3300046518 Ga0495631_0014388 Ga0495631_0014388_1409_1951 161
45 3300046520 Ga0495637_0104759 Ga0495637_0104759_251_793 161
46 3300046538 Ga0495609_0013246 Ga0495609_0013246_664_1161 161
47 3300046615 Ga0495656_0025926 Ga0495656_0025926_833_1330 161
48 3300046660 Ga0495625_0184572 Ga0495625_0184572_745_1242 161
49 3300046691 Ga0495670_0142427 Ga0495670_0142427_212_709 161
50 3300046692 Ga0495671_0001886 Ga0495671_0001886_3439_3936 161
51 3300046694 Ga0495649_0077961 Ga0495649_0077961_496_993 161
52 3300046794 Ga0495589_0188993 Ga0495589_0188993_355_852 161
53 3300046810 Ga0495660_0046730 Ga0495660_0046730_1471_1968 161
54 3300047320 Ga0495672_0010016 Ga0495672_0010016_2285_2782 161
55 3300047447 Ga0495685_130051 Ga0495685_130051_33_530 161
56 3300048912 Ga0496109_0726429 Ga0496109_0726429_66_611 161
57 3300048919 Ga0496116_0008775 Ga0496116_0008775_1982_2479 161
58 3300048924 Ga0496121_0006246 Ga0496121_0006246_12997_13494 161
59 3300048925 Ga0496122_0003366 Ga0496122_0003366_13293_13790 161
60 3300048926 Ga0496123_0000208 Ga0496123_0000208_35649_36146 161
61 iso_pu_bacteria 2600255292 2601667208 161
62 iso_pu_bacteria 2643221614 2644084771 161
63 iso_pu_bacteria 2643221661 2644342323 161
64 iso_pu_bacteria 2643221666 2644365623 161
65 iso_pu_bacteria 2857547612 2857552601 161
66 iso_pu_bacteria 2885080285 2885081535 161
67 iso_pu_bacteria 2932410948 2932414916 161
68 iso_pu_bacteria 2932416698 2932419602 161
69 3300048929 Ga0496126_0078991 Ga0496126_0078991_170_691 162
70 3300049662 Ga0501222_026102 Ga0501222_026102_149_718 162
71 iso_pu_bacteria 2849560528 2849565528 162
72 iso_pu_bacteria 2851153111 2851153242 162
73 iso_pu_bacteria 2883577096 2883578329 162
74 3300003323 rootH1_10078092 rootH1_100780922 163
75 3300046471 Ga0495650_0000011 Ga0495650_0000011_465076_465591 163
76 3300046471 Ga0495650_0004416 Ga0495650_0004416_8428_8943 163
77 3300046513 Ga0495616_0001909 Ga0495616_0001909_10649_11161 163
78 3300046691 Ga0495670_0028409 Ga0495670_0028409_1285_1830 163
79 3300047323 Ga0495683_0038508 Ga0495683_0038508_214_729 163
80 3300049459 Ga0495678_002113 Ga0495678_002113_1031_1546 163
81 3300053156 Ga0500622_0001772 Ga0500622_0001772_1023_1568 163
82 3300053730 Ga0500645_001192 Ga0500645_001192_12193_12687 163
83 iso_pu_bacteria 2582581279 2585147631 163
84 iso_pu_bacteria 3000865235 3000865907 163
85 3300001979 JGI24740J21852_10009636 JGI24740J21852_100096365 164
86 3300006048 Ga0075363_100333590 Ga0075363_1003335902 164
87 3300006178 Ga0075367_10075075 Ga0075367_100750753 164
88 3300006195 Ga0075366_10139853 Ga0075366_101398531 164
89 3300006195 Ga0075366_10331776 Ga0075366_103317761 164
90 3300014969 Ga0157376_10461978 Ga0157376_104619782 164
91 3300025949 Ga0207667_10131976 Ga0207667_101319763 164
92 3300028794 Ga0307515_10000567 Ga0307515_100005674 164
93 3300028794 Ga0307515_10001764 Ga0307515_1000176444 164
94 3300028794 Ga0307515_10032674 Ga0307515_100326746 164
95 3300030522 Ga0307512_10021151 Ga0307512_100211514 164
96 3300031456 Ga0307513_10002614 Ga0307513_100026144 164
97 3300031456 Ga0307513_10023800 Ga0307513_100238003 164
98 3300031507 Ga0307509_10022947 Ga0307509_100229472 164
99 3300031616 Ga0307508_10000133 Ga0307508_1000013314 164
100 3300031616 Ga0307508_10079502 Ga0307508_100795022 164
101 3300031649 Ga0307514_10004805 Ga0307514_100048056 164
102 3300031730 Ga0307516_10013972 Ga0307516_100139723 164
103 3300033179 Ga0307507_10029260 Ga0307507_100292603 164
104 3300041456 Ga0451795_0071722 Ga0451795_0071722_48_554 164
105 3300041492 Ga0451835_0702106 Ga0451835_0702106_506_1012 164
106 3300041509 Ga0451843_1377075 Ga0451843_1377075_211_717 164
107 3300041512 Ga0451853_1603597 Ga0451853_1603597_647_1153 164
108 3300042145 Ga0450906_041829 Ga0450906_041829_249_764 164
109 3300046512 Ga0495610_0035249 Ga0495610_0035249_848_1354 164
110 3300046522 Ga0495643_0079344 Ga0495643_0079344_558_1064 164
111 3300046660 Ga0495625_0000452 Ga0495625_0000452_59880_60386 164
112 3300047472 Ga0495686_0099252 Ga0495686_0099252_233_739 164
113 3300049569 Ga0501032_0010978 Ga0501032_0010978_3198_3710 164
114 3300049570 Ga0501033_0019681 Ga0501033_0019681_345_857 164
115 3300049571 Ga0501034_0176224 Ga0501034_0176224_1580_2092 164
116 3300049574 Ga0501038_0548399 Ga0501038_0548399_169_681 164
117 3300049579 Ga0501043_0006326 Ga0501043_0006326_114_626 164
118 3300049581 Ga0501047_0252343 Ga0501047_0252343_351_863 164
119 3300049582 Ga0501048_0328349 Ga0501048_0328349_100_612 164
120 3300049586 Ga0501070_0118692 Ga0501070_0118692_1107_1619 164
121 3300049822 Ga0501035_0513142 Ga0501035_0513142_366_878 164
122 3300049823 Ga0501044_0035158 Ga0501044_0035158_527_1039 164
123 3300050493 nmdc:mga0k408_555277_c1 nmdc:mga0k408_555277_c1_113_619 164
124 3300053134 Ga0500658_0034983 Ga0500658_0034983_531_1037 164
125 3300053739 Ga0500587_000148 Ga0500587_000148_5604_6110 164
126 iso_pu_bacteria 2574179768 2574429434 164
127 iso_pu_bacteria 2818991440 2819566482 164
128 iso_pu_bacteria 2891633521 2891637311 164
129 iso_pu_bacteria 2904463128 2904467139 164
130 iso_pu_bacteria 2990196909 2990198559 164
131 iso_pu_bacteria 643348564 643598823 164
132 iso_pu_bacteria 651053060 651174832 164
133 3300003775 Ga0055524_1000007 Ga0055524_100000750 165
134 3300005288 Ga0065714_10254944 Ga0065714_102549442 165
135 3300006846 Ga0075430_100216334 Ga0075430_1002163342 165
136 3300006948 Ga0099826_10000052 Ga0099826_100000526 165
137 3300009036 Ga0105244_10275385 Ga0105244_102753851 165
138 3300014497 Ga0182008_10002417 Ga0182008_100024178 165
139 3300015261 Ga0182006_1000002 Ga0182006_1000002134 165
140 3300015262 Ga0182007_10001827 Ga0182007_1000182711 165
141 3300015265 Ga0182005_1000029 Ga0182005_100002942 165
142 3300025291 Ga0209675_1028130 Ga0209675_10281302 165
143 3300025299 Ga0209256_1000005 Ga0209256_1000005442 165
144 3300027666 Ga0209282_1000001 Ga0209282_10000012299 165
145 3300047472 Ga0495686_0008342 Ga0495686_0008342_2582_3100 165
146 3300048919 Ga0496116_0025209 Ga0496116_0025209_3282_3797 165
147 3300048924 Ga0496121_0003074 Ga0496121_0003074_17061_17639 165
148 3300048924 Ga0496121_0003558 Ga0496121_0003558_12606_13184 165
149 3300048928 Ga0496125_0070787 Ga0496125_0070787_1959_2474 165
150 3300050509 nmdc:mga0qj67_207741_c1 nmdc:mga0qj67_207741_c1_574_1089 165
151 iso_pu_bacteria 2501025502 2501085369 165
152 iso_pu_bacteria 2510917013 2511090791 165
153 iso_pu_bacteria 2513237150 2513954676 165
154 iso_pu_bacteria 2513237165 2514043561 165
155 iso_pu_bacteria 2524023250 2524612385 165
156 iso_pu_bacteria 2593339238 2595447148 165
157 iso_pu_bacteria 2643221660 2644339421 165
158 iso_pu_bacteria 2718218334 2721026190 165
159 iso_pu_bacteria 2734482264 2735833839 165
160 iso_pu_bacteria 2738543009 2739228827 165
161 iso_pu_bacteria 2834641062 2834645966 165
162 iso_pu_bacteria 2842918807 2842920205 165
163 iso_pu_bacteria 2884338543 2884341816 165
164 iso_pu_bacteria 2919085039 2919087424 165
165 iso_pu_bacteria 2941471342 2941475414 165
166 iso_pu_bacteria 2953994433 2953995499 165
167 iso_pu_bacteria 8003400568 8003402737 165
168 3300003320 rootH2_10006506 rootH2_100065062 166
169 3300003322 rootL2_10000651 rootL2_100006515 166
170 3300003775 Ga0055524_1031489 Ga0055524_10314893 166
171 3300003794 Ga0055531_10001613 Ga0055531_1000161312 166
172 3300003794 Ga0055531_10001667 Ga0055531_1000166711 166
173 3300004625 Ga0055543_1006647 Ga0055543_10066472 166
174 3300005262 Ga0065165_1000482 Ga0065165_100048214 166
175 3300006195 Ga0075366_10139572 Ga0075366_101395723 166
176 3300006353 Ga0075370_10005249 Ga0075370_100052498 166
177 3300006353 Ga0075370_10005703 Ga0075370_100057034 166
178 3300006353 Ga0075370_10021246 Ga0075370_100212464 166
179 3300006942 Ga0099824_1031132 Ga0099824_10311323 166
180 3300006944 Ga0099823_1000002 Ga0099823_100000295 166
181 3300012497 Ga0157319_1000007 Ga0157319_1000007108 166
182 3300013105 Ga0157369_10000580 Ga0157369_1000058026 166
183 3300025273 Ga0209673_1006810 Ga0209673_10068103 166
184 3300025298 Ga0209050_1002014 Ga0209050_100201413 166
185 3300025299 Ga0209256_1001426 Ga0209256_10014264 166
186 3300025299 Ga0209256_1002066 Ga0209256_10020664 166
187 3300025299 Ga0209256_1034134 Ga0209256_10341342 166
188 3300025303 Ga0209051_1001383 Ga0209051_100138312 166
189 3300025304 Ga0209257_1002063 Ga0209257_10020634 166
190 3300025304 Ga0209257_1002789 Ga0209257_10027895 166
191 3300027296 Ga0209389_1002519 Ga0209389_10025192 166
192 3300027312 Ga0209371_1030596 Ga0209371_10305962 166
193 3300030500 Ga0268256_1009564 Ga0268256_10095642 166
194 3300031548 Ga0307408_100029014 Ga0307408_1000290144 166
195 3300032002 Ga0307416_101788959 Ga0307416_1017889592 166
196 3300032004 Ga0307414_10009304 Ga0307414_100093043 166
197 3300042438 Ga0439459_0000041 Ga0439459_0000041_9845_10381 166
198 3300044694 Ga0466963_0006616 Ga0466963_0006616_1287_1823 166
199 3300050493 nmdc:mga0k408_132915_c1 nmdc:mga0k408_132915_c1_443_979 166
200 3300050493 nmdc:mga0k408_55401_c1 nmdc:mga0k408_55401_c1_78_614 166
201 3300050496 nmdc:mga07m45_13111_c1 nmdc:mga07m45_13111_c1_412_948 166
202 3300050496 nmdc:mga07m45_158420_c1 nmdc:mga07m45_158420_c1_165_689 166
203 3300050496 nmdc:mga07m45_3159_c1 nmdc:mga07m45_3159_c1_3619_4155 166
204 iso_pu_bacteria 2831864461 2831865407 166
205 iso_pu_bacteria 2839094727 2839096877 166
206 iso_pu_bacteria 2886848708 2886849552 166
207 3300004625 Ga0055543_1003956 Ga0055543_10039561 167
208 3300005262 Ga0065165_1000079 Ga0065165_100007948 167
209 3300005262 Ga0065165_1016998 Ga0065165_10169983 167
210 3300005844 Ga0068862_100619448 Ga0068862_1006194482 167
211 3300046524 Ga0495648_0000334 Ga0495648_0000334_45842_46375 167
212 3300046660 Ga0495625_0398243 Ga0495625_0398243_71_598 167
213 3300047469 Ga0495673_0002704 Ga0495673_0002704_5863_6396 167
214 3300047472 Ga0495686_0001764 Ga0495686_0001764_9339_9881 167
215 3300049460 Ga0495682_0099187 Ga0495682_0099187_79_585 167
216 3300049682 Ga0501252_001571 Ga0501252_001571_759_1268 167
217 3300053108 Ga0500562_000540 Ga0500562_000540_5034_5555 167
218 3300053108 Ga0500562_002502 Ga0500562_002502_450_971 167
219 3300053138 Ga0500564_000419 Ga0500564_000419_8035_8568 167
220 3300053153 Ga0500616_0024213 Ga0500616_0024213_1175_1681 167
221 3300053156 Ga0500622_0002557 Ga0500622_0002557_3231_3773 167
222 3300053730 Ga0500645_001108 Ga0500645_001108_5787_6314 167
223 3300006846 Ga0075430_100280271 Ga0075430_1002802712 168
224 3300028794 Ga0307515_10006103 Ga0307515_100061039 168
225 3300031730 Ga0307516_10000253 Ga0307516_1000025343 168
226 3300037471 Ga0395905_0219689 Ga0395905_0219689_569_1093 168
227 3300044735 Ga0466968_0119663 Ga0466968_0119663_239_757 168
228 3300046452 Ga0495617_000348 Ga0495617_000348_9327_9836 168
229 3300046457 Ga0495590_0107430 Ga0495590_0107430_224_733 168
230 3300046460 Ga0495638_0000564 Ga0495638_0000564_40427_40936 168
231 3300046520 Ga0495637_0008754 Ga0495637_0008754_2564_3073 168
232 3300046538 Ga0495609_0008576 Ga0495609_0008576_803_1312 168
233 3300046648 Ga0495611_0000001 Ga0495611_0000001_2539674_2540183 168
234 3300046660 Ga0495625_0000200 Ga0495625_0000200_6698_7207 168
235 3300046691 Ga0495670_0029855 Ga0495670_0029855_841_1350 168
236 3300046692 Ga0495671_0000457 Ga0495671_0000457_29125_29634 168
237 3300046794 Ga0495589_0000008 Ga0495589_0000008_88129_88638 168
238 3300047446 Ga0495679_000004 Ga0495679_000004_659363_659872 168
239 3300047469 Ga0495673_0002539 Ga0495673_0002539_4413_4922 168
240 3300049577 Ga0501041_0093338 Ga0501041_0093338_556_1065 168
241 3300049578 Ga0501042_0270722 Ga0501042_0270722_612_1121 168
242 3300049582 Ga0501048_0133662 Ga0501048_0133662_507_1016 168
243 3300049587 Ga0501071_0084923 Ga0501071_0084923_952_1461 168
244 3300049588 Ga0501072_1097386 Ga0501072_1097386_55_564 168
245 3300049592 Ga0501076_0111145 Ga0501076_0111145_857_1366 168
246 3300049593 Ga0501077_0519480 Ga0501077_0519480_220_729 168
247 3300053125 Ga0500618_058314 Ga0500618_058314_216_737 168
248 3300053131 Ga0500652_237911 Ga0500652_237911_162_671 168
249 3300061734 Ga0530510_0123119 Ga0530510_0123119_583_1092 168
250 iso_pu_bacteria 2739367655 2739610108 168
251 iso_pu_bacteria 2887375801 2887380726 168
252 iso_pu_bacteria 2894023352 2894025510 168
253 3300001904 JGI24736J21556_1002736 JGI24736J21556_10027363 169
254 3300002067 JGI24735J21928_10033649 JGI24735J21928_100336491 169
255 3300002705 JGI25156J39149_1000112 JGI25156J39149_100011228 169
256 3300002705 JGI25156J39149_1000128 JGI25156J39149_100012834 169
257 3300002705 JGI25156J39149_1002904 JGI25156J39149_10029044 169
258 3300002737 JGI25162J39368_1004893 JGI25162J39368_10048933 169
259 3300002738 JGI25154J39366_1000125 JGI25154J39366_100012534 169
260 3300002738 JGI25154J39366_1000143 JGI25154J39366_100014334 169
261 3300002738 JGI25154J39366_1000228 JGI25154J39366_10002284 169
262 3300002741 JGI25157J39369_1000134 JGI25157J39369_100013434 169
263 3300002741 JGI25157J39369_1020182 JGI25157J39369_10201822 169
264 3300003187 JGI25151J46595_10003380 JGI25151J46595_100033804 169
265 3300003187 JGI25151J46595_10021364 JGI25151J46595_100213642 169
266 3300003187 JGI25151J46595_10075606 JGI25151J46595_100756061 169
267 3300003756 Ga0055533_1006056 Ga0055533_10060562 169
268 3300003758 Ga0055532_1000101 Ga0055532_100010163 169
269 3300003761 Ga0055535_1006661 Ga0055535_10066612 169
270 3300003771 Ga0055526_1004129 Ga0055526_10041292 169
271 3300003771 Ga0055526_1004782 Ga0055526_10047826 169
272 3300003771 Ga0055526_1039208 Ga0055526_10392082 169
273 3300003773 Ga0055537_1002025 Ga0055537_10020257 169
274 3300003775 Ga0055524_1016574 Ga0055524_10165744 169
275 3300003781 Ga0055536_1000078 Ga0055536_10000789 169
276 3300003784 Ga0055534_1000733 Ga0055534_10007339 169
277 3300003784 Ga0055534_1002174 Ga0055534_10021744 169
278 3300003791 Ga0055530_10001592 Ga0055530_100015925 169
279 3300003792 Ga0055540_1000042 Ga0055540_100004298 169
280 3300005262 Ga0065165_1000405 Ga0065165_100040522 169
281 3300005289 Ga0065704_10080515 Ga0065704_100805154 169
282 3300005289 Ga0065704_10099871 Ga0065704_100998712 169
283 3300005331 Ga0070670_100146194 Ga0070670_1001461943 169
284 3300005335 Ga0070666_10000018 Ga0070666_10000018114 169
285 3300005356 Ga0070674_100371103 Ga0070674_1003711032 169
286 3300005356 Ga0070674_100624546 Ga0070674_1006245462 169
287 3300005367 Ga0070667_100168040 Ga0070667_1001680402 169
288 3300005444 Ga0070694_100430287 Ga0070694_1004302871 169
289 3300005456 Ga0070678_100532907 Ga0070678_1005329072 169
290 3300005457 Ga0070662_100086628 Ga0070662_1000866283 169
291 3300005539 Ga0068853_101029177 Ga0068853_1010291771 169
292 3300005548 Ga0070665_100031056 Ga0070665_1000310564 169
293 3300005563 Ga0068855_100119522 Ga0068855_1001195223 169
294 3300005563 Ga0068855_100470313 Ga0068855_1004703132 169
295 3300005577 Ga0068857_100146157 Ga0068857_1001461573 169
296 3300005578 Ga0068854_101093607 Ga0068854_1010936072 169
297 3300005616 Ga0068852_100043837 Ga0068852_1000438374 169
298 3300005719 Ga0068861_100022802 Ga0068861_1000228023 169
299 3300005834 Ga0068851_10685095 Ga0068851_106850951 169
300 3300005840 Ga0068870_10638682 Ga0068870_106386821 169
301 3300005841 Ga0068863_101393182 Ga0068863_1013931821 169
302 3300005842 Ga0068858_100179544 Ga0068858_1001795443 169
303 3300005842 Ga0068858_100247571 Ga0068858_1002475712 169
304 3300005843 Ga0068860_100232117 Ga0068860_1002321172 169
305 3300005843 Ga0068860_100945086 Ga0068860_1009450862 169
306 3300005844 Ga0068862_100267778 Ga0068862_1002677783 169
307 3300006038 Ga0075365_10002161 Ga0075365_100021616 169
308 3300006042 Ga0075368_10085527 Ga0075368_100855272 169
309 3300006042 Ga0075368_10237850 Ga0075368_102378501 169
310 3300006048 Ga0075363_100022892 Ga0075363_1000228924 169
311 3300006048 Ga0075363_100408099 Ga0075363_1004080991 169
312 3300006051 Ga0075364_10099340 Ga0075364_100993402 169
313 3300006178 Ga0075367_10011481 Ga0075367_100114813 169
314 3300006178 Ga0075367_10370936 Ga0075367_103709362 169
315 3300006195 Ga0075366_10068254 Ga0075366_100682542 169
316 3300006946 Ga0079104_1000002 Ga0079104_1000002109 169
317 3300006946 Ga0079104_1000012 Ga0079104_1000012117 169
318 3300006948 Ga0099826_10000009 Ga0099826_10000009169 169
319 3300009011 Ga0105251_10399583 Ga0105251_103995831 169
320 3300009036 Ga0105244_10183947 Ga0105244_101839472 169
321 3300009093 Ga0105240_10001934 Ga0105240_100019344 169
322 3300009101 Ga0105247_10128799 Ga0105247_101287992 169
323 3300009148 Ga0105243_10005055 Ga0105243_100050554 169
324 3300009176 Ga0105242_10280134 Ga0105242_102801342 169
325 3300009177 Ga0105248_10038811 Ga0105248_100388116 169
326 3300009551 Ga0105238_10000319 Ga0105238_1000031932 169
327 3300009551 Ga0105238_10017899 Ga0105238_100178994 169
328 3300009553 Ga0105249_10020688 Ga0105249_100206882 169
329 3300010375 Ga0105239_10515226 Ga0105239_105152262 169
330 3300013100 Ga0157373_10153065 Ga0157373_101530652 169
331 3300013104 Ga0157370_10005446 Ga0157370_1000544611 169
332 3300013306 Ga0163162_10030575 Ga0163162_100305751 169
333 3300013306 Ga0163162_10033887 Ga0163162_100338875 169
334 3300013308 Ga0157375_10442276 Ga0157375_104422762 169
335 3300014326 Ga0157380_10090734 Ga0157380_100907342 169
336 3300014497 Ga0182008_10008058 Ga0182008_100080584 169
337 3300014968 Ga0157379_10754203 Ga0157379_107542032 169
338 3300015261 Ga0182006_1000031 Ga0182006_1000031195 169
339 3300015261 Ga0182006_1001950 Ga0182006_100195010 169
340 3300015261 Ga0182006_1071161 Ga0182006_10711612 169
341 3300015262 Ga0182007_10002777 Ga0182007_100027779 169
342 3300015262 Ga0182007_10029289 Ga0182007_100292891 169
343 3300015265 Ga0182005_1000352 Ga0182005_100035210 169
344 3300015265 Ga0182005_1000434 Ga0182005_100043423 169
345 3300017792 Ga0163161_10004612 Ga0163161_100046123 169
346 3300017792 Ga0163161_10637301 Ga0163161_106373012 169
347 3300017792 Ga0163161_10647303 Ga0163161_106473032 169
348 3300025206 Ga0209435_100016 Ga0209435_100016274 169
349 3300025206 Ga0209435_100101 Ga0209435_10010124 169
350 3300025226 Ga0209674_101336 Ga0209674_1013366 169
351 3300025229 Ga0209147_100023 Ga0209147_10002353 169
352 3300025229 Ga0209147_103555 Ga0209147_1035552 169
353 3300025233 Ga0209437_100166 Ga0209437_100166139 169
354 3300025242 Ga0209258_100345 Ga0209258_10034569 169
355 3300025246 Ga0209646_1000033 Ga0209646_100003334 169
356 3300025246 Ga0209646_1000093 Ga0209646_1000093164 169
357 3300025250 Ga0209026_1000031 Ga0209026_100003153 169
358 3300025250 Ga0209026_1000870 Ga0209026_10008702 169
359 3300025254 Ga0209148_1008635 Ga0209148_10086352 169
360 3300025256 Ga0209759_1000227 Ga0209759_100022733 169
361 3300025256 Ga0209759_1000346 Ga0209759_100034645 169
362 3300025263 Ga0209565_1000094 Ga0209565_1000094129 169
363 3300025263 Ga0209565_1004914 Ga0209565_10049142 169
364 3300025272 Ga0209455_1010811 Ga0209455_10108112 169
365 3300025273 Ga0209673_1023583 Ga0209673_10235833 169
366 3300025291 Ga0209675_1000087 Ga0209675_100008710 169
367 3300025291 Ga0209675_1001508 Ga0209675_10015084 169
368 3300025291 Ga0209675_1004217 Ga0209675_10042175 169
369 3300025291 Ga0209675_1013469 Ga0209675_10134692 169
370 3300025292 Ga0209676_1000176 Ga0209676_100017674 169
371 3300025294 Ga0209025_1000046 Ga0209025_100004697 169
372 3300025294 Ga0209025_1000123 Ga0209025_1000123180 169
373 3300025294 Ga0209025_1000764 Ga0209025_100076423 169
374 3300025294 Ga0209025_1008843 Ga0209025_10088433 169
375 3300025294 Ga0209025_1057007 Ga0209025_10570073 169
376 3300025295 Ga0209564_1000166 Ga0209564_1000166131 169
377 3300025295 Ga0209564_1001192 Ga0209564_100119210 169
378 3300025295 Ga0209564_1001289 Ga0209564_100128914 169
379 3300025297 Ga0209758_1014801 Ga0209758_10148014 169
380 3300025298 Ga0209050_1001487 Ga0209050_100148710 169
381 3300025299 Ga0209256_1000030 Ga0209256_1000030270 169
382 3300025299 Ga0209256_1000432 Ga0209256_100043239 169
383 3300025299 Ga0209256_1000960 Ga0209256_100096029 169
384 3300025302 Ga0207426_1024982 Ga0207426_10249822 169
385 3300025303 Ga0209051_1000004 Ga0209051_1000004690 169
386 3300025303 Ga0209051_1009602 Ga0209051_10096024 169
387 3300025303 Ga0209051_1027983 Ga0209051_10279833 169
388 3300025303 Ga0209051_1035742 Ga0209051_10357422 169
389 3300025304 Ga0209257_1000063 Ga0209257_1000063176 169
390 3300025735 Ga0207713_1017282 Ga0207713_10172824 169
391 3300025899 Ga0207642_10065029 Ga0207642_100650293 169
392 3300025900 Ga0207710_10002899 Ga0207710_100028996 169
393 3300025900 Ga0207710_10350156 Ga0207710_103501561 169
394 3300025901 Ga0207688_10075061 Ga0207688_100750612 169
395 3300025903 Ga0207680_10000002 Ga0207680_10000002500 169
396 3300025904 Ga0207647_10000008 Ga0207647_10000008153 169
397 3300025907 Ga0207645_10652017 Ga0207645_106520171 169
398 3300025909 Ga0207705_10007929 Ga0207705_100079295 169
399 3300025913 Ga0207695_10002689 Ga0207695_1000268919 169
400 3300025913 Ga0207695_10018810 Ga0207695_100188104 169
401 3300025920 Ga0207649_10085238 Ga0207649_100852383 169
402 3300025920 Ga0207649_10124763 Ga0207649_101247632 169
403 3300025924 Ga0207694_10000388 Ga0207694_1000038832 169
404 3300025925 Ga0207650_10086097 Ga0207650_100860972 169
405 3300025933 Ga0207706_10331995 Ga0207706_103319952 169
406 3300025935 Ga0207709_10000015 Ga0207709_10000015107 169
407 3300025937 Ga0207669_10349706 Ga0207669_103497062 169
408 3300025941 Ga0207711_10016483 Ga0207711_100164833 169
409 3300025949 Ga0207667_10056339 Ga0207667_100563393 169
410 3300025949 Ga0207667_10691320 Ga0207667_106913202 169
411 3300025961 Ga0207712_10258726 Ga0207712_102587262 169
412 3300025972 Ga0207668_10005187 Ga0207668_1000518711 169
413 3300025986 Ga0207658_10627118 Ga0207658_106271182 169
414 3300026035 Ga0207703_10259667 Ga0207703_102596672 169
415 3300026067 Ga0207678_10297556 Ga0207678_102975562 169
416 3300026116 Ga0207674_10274526 Ga0207674_102745261 169
417 3300026116 Ga0207674_10300170 Ga0207674_103001702 169
418 3300026118 Ga0207675_100035947 Ga0207675_1000359473 169
419 3300026118 Ga0207675_101297181 Ga0207675_1012971811 169
420 3300026121 Ga0207683_10523963 Ga0207683_105239632 169
421 3300026142 Ga0207698_10003707 Ga0207698_100037078 169
422 3300027111 Ga0209281_1000007 Ga0209281_1000007327 169
423 3300027111 Ga0209281_1000039 Ga0209281_1000039209 169
424 3300027614 Ga0209970_1008497 Ga0209970_10084972 169
425 3300027665 Ga0209983_1005646 Ga0209983_10056462 169
426 3300027666 Ga0209282_1000017 Ga0209282_100001775 169
427 3300028379 Ga0268266_10000004 Ga0268266_10000004496 169
428 3300028379 Ga0268266_10240152 Ga0268266_102401521 169
429 3300028380 Ga0268265_10669325 Ga0268265_106693252 169
430 3300028381 Ga0268264_10207611 Ga0268264_102076112 169
431 3300028381 Ga0268264_10918440 Ga0268264_109184402 169
432 3300028786 Ga0307517_10206855 Ga0307517_102068552 169
433 3300031238 Ga0265332_10000010 Ga0265332_10000010158 169
434 3300031456 Ga0307513_10359277 Ga0307513_103592772 169
435 3300031548 Ga0307408_100015990 Ga0307408_1000159905 169
436 3300031548 Ga0307408_100943449 Ga0307408_1009434492 169
437 3300031911 Ga0307412_10000608 Ga0307412_100006081 169
438 3300033180 Ga0307510_10001599 Ga0307510_1000159926 169
439 3300041404 Ga0439436_0000022 Ga0439436_0000022_53344_53856 169
440 3300042004 Ga0439445_0004322 Ga0439445_0004322_175_687 169
441 3300042184 Ga0450908_000261 Ga0450908_000261_8437_8949 169
442 3300044672 Ga0466982_0000049 Ga0466982_0000049_29095_29607 169
443 3300044735 Ga0466968_0013434 Ga0466968_0013434_1213_1722 169
444 3300044842 Ga0466957_0013309 Ga0466957_0013309_1045_1557 169
445 3300044842 Ga0466957_0026700 Ga0466957_0026700_1945_2457 169
446 3300045976 Ga0466967_0451957 Ga0466967_0451957_304_816 169
447 3300046452 Ga0495617_000120 Ga0495617_000120_48014_48526 169
448 3300046471 Ga0495650_0000637 Ga0495650_0000637_20194_20706 169
449 3300046471 Ga0495650_0005076 Ga0495650_0005076_5368_5880 169
450 3300046471 Ga0495650_0013995 Ga0495650_0013995_3060_3572 169
451 3300046491 Ga0495584_0000688 Ga0495584_0000688_2002_2514 169
452 3300046492 Ga0495585_0006964 Ga0495585_0006964_11_523 169
453 3300046501 Ga0495607_0000090 Ga0495607_0000090_61999_62511 169
454 3300046501 Ga0495607_0000244 Ga0495607_0000244_34090_34602 169
455 3300046501 Ga0495607_0058090 Ga0495607_0058090_982_1494 169
456 3300046506 Ga0495583_0014440 Ga0495583_0014440_420_932 169
457 3300046507 Ga0495606_0000218 Ga0495606_0000218_75846_76358 169
458 3300046507 Ga0495606_0001182 Ga0495606_0001182_22763_23275 169
459 3300046507 Ga0495606_0004271 Ga0495606_0004271_6503_7015 169
460 3300046507 Ga0495606_0070176 Ga0495606_0070176_1026_1538 169
461 3300046507 Ga0495606_0141397 Ga0495606_0141397_541_1053 169
462 3300046512 Ga0495610_0001156 Ga0495610_0001156_14200_14712 169
463 3300046512 Ga0495610_0142818 Ga0495610_0142818_164_676 169
464 3300046513 Ga0495616_0000006 Ga0495616_0000006_210785_211297 169
465 3300046513 Ga0495616_0065467 Ga0495616_0065467_1139_1651 169
466 3300046515 Ga0495620_0000806 Ga0495620_0000806_15007_15519 169
467 3300046515 Ga0495620_0009092 Ga0495620_0009092_4253_4765 169
468 3300046518 Ga0495631_0000820 Ga0495631_0000820_6680_7192 169
469 3300046519 Ga0495632_0010885 Ga0495632_0010885_1886_2398 169
470 3300046519 Ga0495632_0025389 Ga0495632_0025389_1743_2255 169
471 3300046524 Ga0495648_0002324 Ga0495648_0002324_6021_6533 169
472 3300046558 Ga0495633_0000305 Ga0495633_0000305_35310_35831 169
473 3300046558 Ga0495633_0060118 Ga0495633_0060118_397_909 169
474 3300046616 Ga0495668_0002024 Ga0495668_0002024_11154_11666 169
475 3300046648 Ga0495611_0000126 Ga0495611_0000126_6661_7173 169
476 3300046660 Ga0495625_0001333 Ga0495625_0001333_21864_22400 169
477 3300046660 Ga0495625_0004350 Ga0495625_0004350_1539_2051 169
478 3300046660 Ga0495625_0050598 Ga0495625_0050598_1038_1550 169
479 3300046665 Ga0495661_0040309 Ga0495661_0040309_1211_1723 169
480 3300046691 Ga0495670_0000526 Ga0495670_0000526_11331_11843 169
481 3300046691 Ga0495670_0013489 Ga0495670_0013489_2964_3476 169
482 3300046810 Ga0495660_0000129 Ga0495660_0000129_75973_76485 169
483 3300047320 Ga0495672_0169397 Ga0495672_0169397_413_925 169
484 3300047323 Ga0495683_0004255 Ga0495683_0004255_6498_7010 169
485 3300047469 Ga0495673_0000004 Ga0495673_0000004_474406_474918 169
486 3300047469 Ga0495673_0000041 Ga0495673_0000041_89605_90117 169
487 3300047469 Ga0495673_0017017 Ga0495673_0017017_1556_2068 169
488 3300047472 Ga0495686_0000108 Ga0495686_0000108_53806_54315 169
489 3300047472 Ga0495686_0001911 Ga0495686_0001911_13493_14005 169
490 3300047472 Ga0495686_0003220 Ga0495686_0003220_328_840 169
491 3300047472 Ga0495686_0008150 Ga0495686_0008150_634_1146 169
492 3300048903 Ga0496100_0026786 Ga0496100_0026786_1007_1519 169
493 3300048904 Ga0496101_0000399 Ga0496101_0000399_16350_16862 169
494 3300048906 Ga0496103_0262270 Ga0496103_0262270_169_693 169
495 3300048907 Ga0496104_0071049 Ga0496104_0071049_139_663 169
496 3300048909 Ga0496106_0000716 Ga0496106_0000716_22512_23024 169
497 3300048909 Ga0496106_0017532 Ga0496106_0017532_745_1266 169
498 3300048909 Ga0496106_0256073 Ga0496106_0256073_512_1021 169
499 3300048911 Ga0496108_0623598 Ga0496108_0623598_36_548 169
500 3300048919 Ga0496116_0002058 Ga0496116_0002058_17659_18189 169
501 3300048920 Ga0496117_0181931 Ga0496117_0181931_285_797 169
502 3300048921 Ga0496118_0002248 Ga0496118_0002248_5281_5790 169
503 3300048921 Ga0496118_0005121 Ga0496118_0005121_14155_14664 169
504 3300048921 Ga0496118_0107005 Ga0496118_0107005_353_865 169
505 3300048924 Ga0496121_0001451 Ga0496121_0001451_38816_39328 169
506 3300048924 Ga0496121_0001490 Ga0496121_0001490_5815_6324 169
507 3300048924 Ga0496121_0001516 Ga0496121_0001516_13521_14033 169
508 3300048924 Ga0496121_0003543 Ga0496121_0003543_6565_7077 169
509 3300048924 Ga0496121_0007024 Ga0496121_0007024_2339_2851 169
510 3300048924 Ga0496121_0041800 Ga0496121_0041800_534_1046 169
511 3300048924 Ga0496121_0187554 Ga0496121_0187554_531_1043 169
512 3300048924 Ga0496121_0373194 Ga0496121_0373194_290_820 169
513 3300048924 Ga0496121_0479508 Ga0496121_0479508_72_584 169
514 3300048924 Ga0496121_0491153 Ga0496121_0491153_235_756 169
515 3300048925 Ga0496122_0000457 Ga0496122_0000457_2331_2861 169
516 3300048925 Ga0496122_0024752 Ga0496122_0024752_3342_3851 169
517 3300048925 Ga0496122_0081987 Ga0496122_0081987_252_773 169
518 3300048926 Ga0496123_0000321 Ga0496123_0000321_75080_75610 169
519 3300048926 Ga0496123_0009893 Ga0496123_0009893_7287_7808 169
520 3300048926 Ga0496123_0018167 Ga0496123_0018167_3692_4201 169
521 3300048927 Ga0496124_0061266 Ga0496124_0061266_2576_3088 169
522 3300048927 Ga0496124_0497181 Ga0496124_0497181_100_630 169
523 3300048928 Ga0496125_0000383 Ga0496125_0000383_46194_46715 169
524 3300048928 Ga0496125_0000464 Ga0496125_0000464_12563_13075 169
525 3300048928 Ga0496125_0000895 Ga0496125_0000895_22394_22930 169
526 3300048928 Ga0496125_0022596 Ga0496125_0022596_3905_4417 169
527 3300048928 Ga0496125_0026144 Ga0496125_0026144_776_1285 169
528 3300048928 Ga0496125_0122306 Ga0496125_0122306_329_850 169
529 3300048929 Ga0496126_0041831 Ga0496126_0041831_274_786 169
530 3300048929 Ga0496126_0124680 Ga0496126_0124680_43_555 169
531 3300049459 Ga0495678_000158 Ga0495678_000158_51824_52336 169
532 3300049568 Ga0501031_0017131 Ga0501031_0017131_3904_4416 169
533 3300049568 Ga0501031_0183257 Ga0501031_0183257_538_1050 169
534 3300049569 Ga0501032_0004311 Ga0501032_0004311_1777_2289 169
535 3300049569 Ga0501032_0049118 Ga0501032_0049118_646_1158 169
536 3300049569 Ga0501032_0052223 Ga0501032_0052223_891_1403 169
537 3300049569 Ga0501032_0103190 Ga0501032_0103190_849_1361 169
538 3300049569 Ga0501032_0116257 Ga0501032_0116257_33_545 169
539 3300049569 Ga0501032_0373060 Ga0501032_0373060_360_872 169
540 3300049569 Ga0501032_0472475 Ga0501032_0472475_94_606 169
541 3300049570 Ga0501033_0002865 Ga0501033_0002865_6477_6989 169
542 3300049570 Ga0501033_0143108 Ga0501033_0143108_1057_1569 169
543 3300049571 Ga0501034_0000022 Ga0501034_0000022_253051_253647 169
544 3300049571 Ga0501034_0018904 Ga0501034_0018904_217_729 169
545 3300049571 Ga0501034_0119174 Ga0501034_0119174_1474_1986 169
546 3300049571 Ga0501034_0157958 Ga0501034_0157958_217_729 169
547 3300049571 Ga0501034_0252758 Ga0501034_0252758_1154_1666 169
548 3300049571 Ga0501034_0613893 Ga0501034_0613893_112_630 169
549 3300049573 Ga0501037_0036881 Ga0501037_0036881_1104_1625 169
550 3300049573 Ga0501037_0075571 Ga0501037_0075571_1902_2414 169
551 3300049573 Ga0501037_0084107 Ga0501037_0084107_478_990 169
552 3300049573 Ga0501037_0174191 Ga0501037_0174191_163_675 169
553 3300049573 Ga0501037_0468634 Ga0501037_0468634_312_824 169
554 3300049573 Ga0501037_0575971 Ga0501037_0575971_133_645 169
555 3300049574 Ga0501038_0002561 Ga0501038_0002561_16384_16896 169
556 3300049574 Ga0501038_0018512 Ga0501038_0018512_4463_4975 169
557 3300049574 Ga0501038_0089050 Ga0501038_0089050_1861_2373 169
558 3300049574 Ga0501038_0238408 Ga0501038_0238408_262_774 169
559 3300049574 Ga0501038_0341273 Ga0501038_0341273_460_972 169
560 3300049575 Ga0501039_0084323 Ga0501039_0084323_803_1315 169
561 3300049575 Ga0501039_0679554 Ga0501039_0679554_280_792 169
562 3300049577 Ga0501041_0518490 Ga0501041_0518490_127_639 169
563 3300049578 Ga0501042_0094635 Ga0501042_0094635_162_674 169
564 3300049578 Ga0501042_0345132 Ga0501042_0345132_334_846 169
565 3300049579 Ga0501043_0004021 Ga0501043_0004021_6845_7357 169
566 3300049579 Ga0501043_0008232 Ga0501043_0008232_85_597 169
567 3300049579 Ga0501043_0058129 Ga0501043_0058129_2027_2539 169
568 3300049579 Ga0501043_0447856 Ga0501043_0447856_429_941 169
569 3300049580 Ga0501046_0004507 Ga0501046_0004507_7405_7917 169
570 3300049580 Ga0501046_0024950 Ga0501046_0024950_163_675 169
571 3300049580 Ga0501046_0131335 Ga0501046_0131335_108_620 169
572 3300049581 Ga0501047_0015107 Ga0501047_0015107_89_601 169
573 3300049581 Ga0501047_0138822 Ga0501047_0138822_574_1086 169
574 3300049581 Ga0501047_0496691 Ga0501047_0496691_352_864 169
575 3300049582 Ga0501048_0000242 Ga0501048_0000242_2174_2692 169
576 3300049582 Ga0501048_0002764 Ga0501048_0002764_4501_5013 169
577 3300049582 Ga0501048_0018626 Ga0501048_0018626_1975_2487 169
578 3300049583 Ga0501067_0017043 Ga0501067_0017043_3460_3972 169
579 3300049584 Ga0501068_0012032 Ga0501068_0012032_347_859 169
580 3300049584 Ga0501068_0081837 Ga0501068_0081837_500_1012 169
581 3300049585 Ga0501069_0002591 Ga0501069_0002591_2245_2757 169
582 3300049585 Ga0501069_0010383 Ga0501069_0010383_2256_2768 169
583 3300049586 Ga0501070_0072382 Ga0501070_0072382_1779_2291 169
584 3300049586 Ga0501070_0172217 Ga0501070_0172217_550_1062 169
585 3300049586 Ga0501070_0340859 Ga0501070_0340859_318_830 169
586 3300049587 Ga0501071_0017627 Ga0501071_0017627_1713_2225 169
587 3300049587 Ga0501071_0137270 Ga0501071_0137270_434_946 169
588 3300049588 Ga0501072_0270162 Ga0501072_0270162_822_1334 169
589 3300049588 Ga0501072_0305176 Ga0501072_0305176_623_1135 169
590 3300049588 Ga0501072_1229879 Ga0501072_1229879_51_563 169
591 3300049589 Ga0501073_0005616 Ga0501073_0005616_8677_9189 169
592 3300049589 Ga0501073_0100195 Ga0501073_0100195_1182_1694 169
593 3300049589 Ga0501073_0579753 Ga0501073_0579753_106_618 169
594 3300049590 Ga0501074_0014464 Ga0501074_0014464_3264_3776 169
595 3300049590 Ga0501074_0081907 Ga0501074_0081907_25_537 169
596 3300049592 Ga0501076_0037628 Ga0501076_0037628_1413_1925 169
597 3300049592 Ga0501076_0220220 Ga0501076_0220220_53_565 169
598 3300049592 Ga0501076_0566841 Ga0501076_0566841_411_923 169
599 3300049593 Ga0501077_0285170 Ga0501077_0285170_509_1021 169
600 3300049741 Ga0501079_0023113 Ga0501079_0023113_1619_2131 169
601 3300049741 Ga0501079_0069026 Ga0501079_0069026_363_875 169
602 3300049741 Ga0501079_0158069 Ga0501079_0158069_978_1490 169
603 3300049742 Ga0501080_0010116 Ga0501080_0010116_993_1505 169
604 3300049743 Ga0501081_0212576 Ga0501081_0212576_284_796 169
605 3300049743 Ga0501081_0230736 Ga0501081_0230736_44_556 169
606 3300049744 Ga0501083_0010676 Ga0501083_0010676_13_525 169
607 3300049744 Ga0501083_0025162 Ga0501083_0025162_3510_4022 169
608 3300049822 Ga0501035_0006400 Ga0501035_0006400_4829_5341 169
609 3300049822 Ga0501035_0049703 Ga0501035_0049703_3003_3515 169
610 3300049822 Ga0501035_0204001 Ga0501035_0204001_387_899 169
611 3300049822 Ga0501035_0204488 Ga0501035_0204488_678_1190 169
612 3300049823 Ga0501044_0017194 Ga0501044_0017194_5421_5933 169
613 3300049823 Ga0501044_0217989 Ga0501044_0217989_404_916 169
614 3300049823 Ga0501044_0265141 Ga0501044_0265141_925_1446 169
615 3300049823 Ga0501044_0688543 Ga0501044_0688543_77_589 169
616 3300049823 Ga0501044_0730636 Ga0501044_0730636_327_839 169
617 3300049823 Ga0501044_1291197 Ga0501044_1291197_33_545 169
618 3300049824 Ga0501045_0006386 Ga0501045_0006386_6589_7101 169
619 3300049824 Ga0501045_0275481 Ga0501045_0275481_78_590 169
620 3300049824 Ga0501045_0560148 Ga0501045_0560148_50_571 169
621 3300050490 nmdc:mga03n38_2045_c1 nmdc:mga03n38_2045_c1_2793_3305 169
622 3300050491 nmdc:mga00v17_79234_c1 nmdc:mga00v17_79234_c1_1225_1749 169
623 3300050492 nmdc:mga0yw44_22853_c1 nmdc:mga0yw44_22853_c1_212_724 169
624 3300050494 nmdc:mga06z11_31637_c1 nmdc:mga06z11_31637_c1_88_600 169
625 3300050494 nmdc:mga06z11_667789_c1 nmdc:mga06z11_667789_c1_61_573 169
626 3300050516 nmdc:mga0sz30_5297_c1 nmdc:mga0sz30_5297_c1_2247_2759 169
627 3300053086 Ga0500578_0098036 Ga0500578_0098036_12_533 169
628 3300053087 Ga0500643_000140 Ga0500643_000140_38134_38646 169
629 3300053087 Ga0500643_021222 Ga0500643_021222_768_1298 169
630 3300053096 Ga0500641_0011118 Ga0500641_0011118_1410_1922 169
631 3300053103 Ga0500555_000327 Ga0500555_000327_10408_10920 169
632 3300053103 Ga0500555_001522 Ga0500555_001522_3159_3671 169
633 3300053108 Ga0500562_016650 Ga0500562_016650_1250_1777 169
634 3300053119 Ga0500595_032373 Ga0500595_032373_1056_1568 169
635 3300053139 Ga0500568_0026007 Ga0500568_0026007_1449_1961 169
636 3300053139 Ga0500568_0210067 Ga0500568_0210067_43_555 169
637 3300053142 Ga0500577_0000146 Ga0500577_0000146_75_587 169
638 3300053153 Ga0500616_0000401 Ga0500616_0000401_21678_22190 169
639 3300053153 Ga0500616_0105441 Ga0500616_0105441_697_1209 169
640 3300053156 Ga0500622_0175562 Ga0500622_0175562_117_629 169
641 3300053160 Ga0500633_0003370 Ga0500633_0003370_2096_2608 169
642 3300053730 Ga0500645_002572 Ga0500645_002572_1219_1740 169
643 3300054114 Ga0501084_0073006 Ga0501084_0073006_2146_2658 169
644 3300060353 Ga0501082_0029927 Ga0501082_0029927_336_848 169
645 3300060353 Ga0501082_0275186 Ga0501082_0275186_520_1032 169
646 3300061719 Ga0466962_0434926 Ga0466962_0434926_65_577 169
647 iso_pu_bacteria 2511231003 2511251075 169
648 iso_pu_bacteria 2511231026 2511385381 169
649 iso_pu_bacteria 2521172590 2521557650 169
650 iso_pu_bacteria 2547132512 2548846432 169
651 iso_pu_bacteria 2548876994 2550692528 169
652 iso_pu_bacteria 2551306416 2553002767 169
653 iso_pu_bacteria 2643221611 2644074410 169
654 iso_pu_bacteria 2721755523 2722882435 169
655 iso_pu_bacteria 2738543012 2739241504 169
656 iso_pu_bacteria 2765235838 2765570181 169
657 iso_pu_bacteria 2816332133 2816473668 169
658 iso_pu_bacteria 2818991445 2819591508 169
659 iso_pu_bacteria 2818991449 2819615208 169
660 iso_pu_bacteria 2839138175 2839140799 169
661 iso_pu_bacteria 2842718218 2842721137 169
662 iso_pu_bacteria 2884811622 2884816600 169
663 iso_pu_bacteria 2884836552 2884837317 169
664 iso_pu_bacteria 2884852848 2884853608 169
665 iso_pu_bacteria 2896154374 2896155275 169
666 iso_pu_bacteria 2904439833 2904441611 169
667 iso_pu_bacteria 2904530477 2904531467 169
668 iso_pu_bacteria 2904584206 2904586894 169
669 iso_pu_bacteria 2904589729 2904593073 169
670 iso_pu_bacteria 2904601388 2904603089 169
671 iso_pu_bacteria 2919046199 2919050915 169
672 iso_pu_bacteria 2919079590 2919083898 169
673 iso_pu_bacteria 2923510766 2923510847 169
674 iso_pu_bacteria 2974320154 2974324036 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10029

DUF2271

Predicted periplasmic protein (DUF2271)

49

191

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qpx-assembly1.cif.gz_B crystal structures of self-capping papd chaperone homodimers 0.6198 17 144
1l4i-assembly1.cif.gz_B crystal structure of the periplasmic chaperone sfae 0.5996 16 141
1qpx-assembly1.cif.gz_A crystal structures of self-capping papd chaperone homodimers 0.5942 20 143
8df2-assembly1.cif.gz_D the structure of the 'alt' construct of the amuc_1438 glycopeptidase 0.5926 20 141
1qpp-assembly1.cif.gz_A crystal structures of self capping papd chaperone homodimers 0.5825 20 143
ID Description Score Start End Superfamily
af_A0A2R8QCE4_151_241_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6892 115 147 2.60.40.10
af_Q4DCG3_704_863_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.6852 17 143 2.60.120.430
af_Q8I2V7_318_421_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6839 20 143 2.60.40.10
af_Q7YTU0_40_142_2.60.40.2950 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6726 24 148 2.60.40.2950
af_A0A1D6P2S6_66_166_2.60.40.1220 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6558 20 141 2.60.40.1220
ID Description Score Start End GO Terms
AF-A0A645JKP4-F1-model_v4 DUF2271 domain-containing protein 0.9875 43 169
AF-A0A645JKP4-F1-model_v4 DUF2271 domain-containing protein 0.9724 43 169
AF-A0A3D0T1E3-F1-model_v4 DUF2271 domain-containing protein 0.9484 20 169
AF-A0A1Y0EPB1-F1-model_v4 DUF2271 domain-containing protein 0.945 1 169
AF-A0A519IXS3-F1-model_v4 DUF2271 domain-containing protein 0.9447 18 169

Feature Viewer

pLDDT pTM Quality
91.69 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map