F474303

General Info

Members Datasets Scaffolds Average Seq Length
673 312 1346 153

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11315963|Ga0105238_113159632
Length 153
Sequence MYRKILVALENGPADRTLLPHVENLARELGSELVLLHVADGWAARNFDALKLAESDEIKSDRRYLDAAAAQLRTRGVRVEFKLAMGDPAIEIVKMAKAEHCDLIAMTTHGHKFVGDMIHGSTIEPVRHNAPIPLLVIPTAEAVERLKGPAQAL

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
99 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
266 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
269 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
270 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
271 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
276 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
277 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
278 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
279 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
280 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
281 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
282 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
283 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
284 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
285 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
286 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
287 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
288 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
291 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
292 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
293 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
294 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
295 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
296 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
297 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
298 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
299 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 99.11
Stem 0
Stem Tuber 0
Unclassified 13.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_11315963 3300009551 Unclassified 749
2 MRS1b_contig_1444243 2162886011 Bacteria 1142
3 MBSR1b_contig_1592789 2162886012 Unclassified 928
4 Ga0065712_10151222 3300005290 Bacteria 1368
5 Ga0065712_10220671 3300005290 Bacteria 1042
6 Ga0065715_10117978 3300005293 Bacteria 2316
7 Ga0065715_10138322 3300005293 Bacteria 1893
8 Ga0065715_10281362 3300005293 Unclassified 1085
9 Ga0065715_10688025 3300005293 Unclassified 659
10 Ga0065707_10004955 3300005295 Bacteria 5454
11 Ga0065707_10114991 3300005295 Bacteria 2281
12 Ga0065707_10131298 3300005295 Bacteria 1915
13 Ga0070658_10150235 3300005327 Bacteria 1950
14 Ga0070658_10611622 3300005327 Unclassified 945
15 Ga0070676_10650323 3300005328 Bacteria 765
16 Ga0070683_100059749 3300005329 Bacteria 3542
17 Ga0070683_100091081 3300005329 Bacteria 2863
18 Ga0070683_100104221 3300005329 Unclassified 2673
19 Ga0070683_100159058 3300005329 Bacteria 2143
20 Ga0070683_100212048 3300005329 Bacteria 1840
21 Ga0070683_100718419 3300005329 Bacteria 957
22 Ga0070690_100105452 3300005330 Bacteria 1874
23 Ga0070690_100990365 3300005330 Bacteria 662
24 Ga0070670_100004194 3300005331 Bacteria 12065
25 Ga0070670_100037235 3300005331 Bacteria 4185
26 Ga0070670_100210729 3300005331 Bacteria 1689
27 Ga0070670_100294925 3300005331 Bacteria 1418
28 Ga0070677_10275871 3300005333 Bacteria 845
29 Ga0068869_100132467 3300005334 Bacteria 1918
30 Ga0070666_10260323 3300005335 Bacteria 1230
31 Ga0070680_100046238 3300005336 Bacteria 3540
32 Ga0070680_100197683 3300005336 Bacteria 1695
33 Ga0070680_100378663 3300005336 Bacteria 1205
34 Ga0070680_100381267 3300005336 Bacteria 1200
35 Ga0070680_100464654 3300005336 Bacteria 1081
36 Ga0070680_100701490 3300005336 Bacteria 871
37 Ga0070682_100041699 3300005337 Bacteria 2831
38 Ga0070682_100140258 3300005337 Bacteria 1647
39 Ga0068868_100022148 3300005338 Bacteria 4792
40 Ga0068868_100036221 3300005338 Bacteria 3818
41 Ga0070660_100127704 3300005339 Bacteria 2032
42 Ga0070660_100246589 3300005339 Unclassified 1456
43 Ga0070660_100339372 3300005339 Bacteria 1236
44 Ga0070660_100676543 3300005339 Bacteria 865
45 Ga0070660_100820247 3300005339 Bacteria 783
46 Ga0070689_100007166 3300005340 Bacteria 7773
47 Ga0070689_100840555 3300005340 Unclassified 809
48 Ga0070691_10054979 3300005341 Bacteria 1906
49 Ga0070687_100058445 3300005343 Bacteria 2026
50 Ga0070687_100109778 3300005343 Bacteria 1559
51 Ga0070661_100006278 3300005344 Bacteria 8199
52 Ga0070661_100006924 3300005344 Bacteria 7825
53 Ga0070661_100007871 3300005344 Bacteria 7358
54 Ga0070661_100190863 3300005344 Bacteria 1562
55 Ga0070661_100224403 3300005344 Bacteria 1442
56 Ga0070661_100252401 3300005344 Bacteria 1361
57 Ga0070661_100780647 3300005344 Unclassified 783
58 Ga0070668_100011350 3300005347 Bacteria 6637
59 Ga0070669_100017694 3300005353 Bacteria 5084
60 Ga0070675_100066365 3300005354 Bacteria 2984
61 Ga0070675_100466561 3300005354 Bacteria 1134
62 Ga0070675_100977340 3300005354 Bacteria 777
63 Ga0070675_101010964 3300005354 Unclassified 763
64 Ga0070675_101089026 3300005354 Unclassified 734
65 Ga0070671_100027008 3300005355 Bacteria 4723
66 Ga0070671_100307933 3300005355 Bacteria 1349
67 Ga0070671_100316344 3300005355 Bacteria 1330
68 Ga0070671_100576397 3300005355 Bacteria 971
69 Ga0070674_100219228 3300005356 Bacteria 1479
70 Ga0070674_100274964 3300005356 Bacteria 1333
71 Ga0070674_100771949 3300005356 Bacteria 828
72 Ga0070673_100122295 3300005364 Bacteria 2173
73 Ga0070673_100128542 3300005364 Bacteria 2123
74 Ga0070688_100003503 3300005365 Bacteria 8083
75 Ga0070688_100594599 3300005365 Bacteria 846
76 Ga0070659_100002374 3300005366 Bacteria 13383
77 Ga0070667_100019844 3300005367 Bacteria 5577
78 Ga0070667_100030974 3300005367 Bacteria 4460
79 Ga0070709_10010242 3300005434 Bacteria 5185
80 Ga0070709_10155074 3300005434 Bacteria 1586
81 Ga0070709_10579882 3300005434 Unclassified 861
82 Ga0070714_100009539 3300005435 Bacteria 7637
83 Ga0070714_100128778 3300005435 Bacteria 2260
84 Ga0070714_100329904 3300005435 Bacteria 1429
85 Ga0070713_100001159 3300005436 Bacteria 16893
86 Ga0070713_100067132 3300005436 Bacteria 3019
87 Ga0070710_10009652 3300005437 Bacteria 4726
88 Ga0070710_10474410 3300005437 Unclassified 852
89 Ga0070710_10590001 3300005437 Bacteria 772
90 Ga0070701_10101897 3300005438 Bacteria 1592
91 Ga0070701_10331522 3300005438 Bacteria 945
92 Ga0070701_10779932 3300005438 Bacteria 650
93 Ga0070711_100041939 3300005439 Bacteria 3092
94 Ga0070711_100233875 3300005439 Bacteria 1434
95 Ga0070711_100455257 3300005439 Unclassified 1048
96 Ga0070711_100689857 3300005439 Bacteria 859
97 Ga0070705_101668787 3300005440 Bacteria 538
98 Ga0070700_100749549 3300005441 Bacteria 781
99 Ga0070694_100089607 3300005444 Bacteria 2156
100 Ga0070694_100113568 3300005444 Bacteria 1933
101 Ga0070663_100220178 3300005455 Bacteria 1490
102 Ga0070678_100060579 3300005456 Bacteria 2787
103 Ga0070678_100170820 3300005456 Bacteria 1771
104 Ga0070662_100010809 3300005457 Bacteria 6010
105 Ga0070662_100109425 3300005457 Bacteria 2103
106 Ga0070662_100317760 3300005457 Bacteria 1269
107 Ga0070662_100691092 3300005457 Bacteria 863
108 Ga0070681_10005821 3300005458 Bacteria 11930
109 Ga0070681_10013477 3300005458 Bacteria 8123
110 Ga0070681_10030872 3300005458 Bacteria 5378
111 Ga0070681_10140417 3300005458 Bacteria 2346
112 Ga0070681_10243091 3300005458 Bacteria 1713
113 Ga0070681_10649881 3300005458 Bacteria 969
114 Ga0068867_100120462 3300005459 Bacteria 2027
115 Ga0068867_100309651 3300005459 Bacteria 1304
116 Ga0068867_101631690 3300005459 Unclassified 603
117 Ga0070685_10024869 3300005466 Bacteria 3293
118 Ga0070685_10331062 3300005466 Bacteria 1035
119 Ga0070707_100148766 3300005468 Bacteria 2280
120 Ga0070707_100172006 3300005468 Unclassified 2111
121 Ga0070698_100002955 3300005471 Bacteria 18700
122 Ga0070698_100015327 3300005471 Bacteria 8100
123 Ga0070698_100825887 3300005471 Unclassified 871
124 Ga0070699_100000733 3300005518 Bacteria 30397
125 Ga0070699_100060172 3300005518 Bacteria 3291
126 Ga0070699_100104274 3300005518 Bacteria 2487
127 Ga0070699_101229231 3300005518 Bacteria 687
128 Ga0070679_100001159 3300005530 Bacteria 23071
129 Ga0070679_100049891 3300005530 Bacteria 4169
130 Ga0070679_100162117 3300005530 Bacteria 2210
131 Ga0070679_100180757 3300005530 Bacteria 2082
132 Ga0070679_100302089 3300005530 Bacteria 1551
133 Ga0070679_100330267 3300005530 Unclassified 1473
134 Ga0070679_100632406 3300005530 Bacteria 1013
135 Ga0070684_100044337 3300005535 Bacteria 3847
136 Ga0070684_100062332 3300005535 Bacteria 3266
137 Ga0070684_100081531 3300005535 Bacteria 2863
138 Ga0070684_100083791 3300005535 Bacteria 2825
139 Ga0070684_100094000 3300005535 Bacteria 2670
140 Ga0070684_100688780 3300005535 Bacteria 952
141 Ga0070697_100489118 3300005536 Bacteria 1075
142 Ga0068853_100647827 3300005539 Bacteria 1005
143 Ga0068853_100838704 3300005539 Bacteria 881
144 Ga0068853_100925781 3300005539 Bacteria 838
145 Ga0068853_100947709 3300005539 Unclassified 827
146 Ga0070672_100006565 3300005543 Bacteria 7826
147 Ga0070672_100027445 3300005543 Bacteria 4246
148 Ga0070672_100524176 3300005543 Bacteria 1027
149 Ga0070672_101151591 3300005543 Bacteria 690
150 Ga0070686_100001162 3300005544 Bacteria 15047
151 Ga0070695_100000416 3300005545 Bacteria 22064
152 Ga0070695_100095439 3300005545 Bacteria 1993
153 Ga0070695_100432172 3300005545 Unclassified 1005
154 Ga0070695_101370680 3300005545 Bacteria 586
155 Ga0070696_100013378 3300005546 Bacteria 5504
156 Ga0070693_100004085 3300005547 Bacteria 6872
157 Ga0070693_100079173 3300005547 Unclassified 1955
158 Ga0070665_100040789 3300005548 Bacteria 4665
159 Ga0068855_100063180 3300005563 Bacteria 4321
160 Ga0068855_100356687 3300005563 Bacteria 1610
161 Ga0068855_100780581 3300005563 Bacteria 1017
162 Ga0068855_101440495 3300005563 Bacteria 709
163 Ga0068855_101967886 3300005563 Bacteria 591
164 Ga0070664_100002756 3300005564 Bacteria 14182
165 Ga0070664_100061733 3300005564 Bacteria 3194
166 Ga0070664_100062017 3300005564 Bacteria 3187
167 Ga0070664_100131403 3300005564 Bacteria 2199
168 Ga0070664_100136185 3300005564 Bacteria 2160
169 Ga0070664_100292762 3300005564 Bacteria 1470
170 Ga0070664_100331527 3300005564 Bacteria 1381
171 Ga0068857_100004441 3300005577 Bacteria 11867
172 Ga0068857_100007418 3300005577 Bacteria 9440
173 Ga0068857_100274464 3300005577 Bacteria 1550
174 Ga0068857_100288336 3300005577 Bacteria 1511
175 Ga0068857_100546399 3300005577 Bacteria 1091
176 Ga0068857_101083474 3300005577 Bacteria 773
177 Ga0068854_100056400 3300005578 Bacteria 2831
178 Ga0068856_100552273 3300005614 Bacteria 1173
179 Ga0068856_101142331 3300005614 Unclassified 796
180 Ga0070702_100201827 3300005615 Bacteria 1317
181 Ga0068852_100025587 3300005616 Bacteria 4784
182 Ga0068852_100045605 3300005616 Bacteria 3730
183 Ga0068852_100175709 3300005616 Bacteria 2011
184 Ga0068852_100515712 3300005616 Bacteria 1192
185 Ga0068859_100176150 3300005617 Bacteria 2220
186 Ga0068859_102131637 3300005617 Bacteria 619
187 Ga0068864_100042332 3300005618 Bacteria 3897
188 Ga0068866_10153030 3300005718 Unclassified 1338
189 Ga0068861_100009561 3300005719 Bacteria 6698
190 Ga0068861_100037119 3300005719 Bacteria 3622
191 Ga0068861_100427085 3300005719 Bacteria 1182
192 Ga0068870_10011776 3300005840 Bacteria 4068
193 Ga0068863_100109093 3300005841 Bacteria 2634
194 Ga0068863_101708217 3300005841 Unclassified 639
195 Ga0068858_100044365 3300005842 Bacteria 4121
196 Ga0068858_100795917 3300005842 Unclassified 922
197 Ga0068860_100077141 3300005843 Bacteria 3168
198 Ga0068862_100058570 3300005844 Bacteria 3304
199 Ga0068862_100959093 3300005844 Bacteria 844
200 Ga0070717_10004301 3300006028 Bacteria 10269
201 Ga0070717_10338612 3300006028 Bacteria 1343
202 Ga0070717_10815241 3300006028 Bacteria 849
203 Ga0070712_100042409 3300006175 Bacteria 3129
204 Ga0070712_100067023 3300006175 Bacteria 2553
205 Ga0070712_100072375 3300006175 Bacteria 2469
206 Ga0070712_100539116 3300006175 Bacteria 982
207 Ga0070712_100853821 3300006175 Bacteria 783
208 Ga0068871_100340759 3300006358 Bacteria 1324
209 Ga0075428_100085952 3300006844 Bacteria 3431
210 Ga0075430_100003632 3300006846 Bacteria 12940
211 Ga0075430_100027695 3300006846 Bacteria 4813
212 Ga0075430_100189996 3300006846 Bacteria 1707
213 Ga0075430_100249441 3300006846 Bacteria 1471
214 Ga0075431_100009724 3300006847 Bacteria 9658
215 Ga0075431_100156785 3300006847 Bacteria 2342
216 Ga0075431_100275016 3300006847 Bacteria 1706
217 Ga0075431_100358544 3300006847 Unclassified 1465
218 Ga0075431_100909161 3300006847 Bacteria 849
219 Ga0075431_101353944 3300006847 Unclassified 672
220 Ga0075433_10064658 3300006852 Bacteria 3207
221 Ga0075433_10066703 3300006852 Bacteria 3158
222 Ga0075433_10277850 3300006852 Bacteria 1484
223 Ga0075433_10867050 3300006852 Bacteria 788
224 Ga0075434_100012915 3300006871 Bacteria 7933
225 Ga0075434_100133044 3300006871 Bacteria 2506
226 Ga0075434_100187498 3300006871 Bacteria 2089
227 Ga0075434_100548889 3300006871 Bacteria 1175
228 Ga0075429_100299454 3300006880 Bacteria 1408
229 Ga0068865_100423808 3300006881 Bacteria 1095
230 Ga0068865_100612532 3300006881 Bacteria 921
231 Ga0068865_101528036 3300006881 Bacteria 599
232 Ga0097620_100176155 3300006931 Bacteria 2220
233 Ga0097620_102131823 3300006931 Bacteria 619
234 Ga0075435_100184327 3300007076 Unclassified 1765
235 Ga0105240_10002958 3300009093 Bacteria 26766
236 Ga0111539_10032859 3300009094 Bacteria 6301
237 Ga0111539_10056899 3300009094 Bacteria 4647
238 Ga0111539_10158820 3300009094 Bacteria 2645
239 Ga0111539_10199829 3300009094 Bacteria 2331
240 Ga0111539_12205338 3300009094 Bacteria 639
241 Ga0105245_10730937 3300009098 Bacteria 1025
242 Ga0114129_10046113 3300009147 Bacteria 6127
243 Ga0114129_10243801 3300009147 Bacteria 2415
244 Ga0114129_10292418 3300009147 Bacteria 2173
245 Ga0114129_10358086 3300009147 Bacteria 1931
246 Ga0105243_10773596 3300009148 Unclassified 943
247 Ga0105243_11475248 3300009148 Unclassified 703
248 Ga0105242_10002317 3300009176 Bacteria 15010
249 Ga0105242_10812495 3300009176 Bacteria 927
250 Ga0105248_10011768 3300009177 Bacteria 9651
251 Ga0105248_10044660 3300009177 Bacteria 4970
252 Ga0105248_10338297 3300009177 Bacteria 1695
253 Ga0105237_10700105 3300009545 Bacteria 1020
254 Ga0105249_10000023 3300009553 Bacteria 238850
255 Ga0105249_10000668 3300009553 Bacteria 31143
256 Ga0105249_10096876 3300009553 Bacteria 2769
257 Ga0105249_10519683 3300009553 Bacteria 1238
258 Ga0105239_10154177 3300010375 Bacteria 2565
259 Ga0157314_1016943 3300012500 Bacteria 704
260 Ga0157313_1036054 3300012503 Bacteria 586
261 Ga0157373_10008677 3300013100 Bacteria 7542
262 Ga0157373_10667714 3300013100 Bacteria 760
263 Ga0157371_10073332 3300013102 Bacteria 2424
264 Ga0157370_10007605 3300013104 Bacteria 11767
265 Ga0157370_10103588 3300013104 Unclassified 2664
266 Ga0157369_10048295 3300013105 Bacteria 4618
267 Ga0157369_10463394 3300013105 Bacteria 1312
268 Ga0157374_10037324 3300013296 Bacteria 4459
269 Ga0157374_10727869 3300013296 Bacteria 1006
270 Ga0157374_11016150 3300013296 Unclassified 848
271 Ga0157378_10102852 3300013297 Unclassified 2609
272 Ga0157378_11114062 3300013297 Bacteria 827
273 Ga0157378_11526242 3300013297 Bacteria 713
274 Ga0163162_10023127 3300013306 Bacteria 6130
275 Ga0163162_10054411 3300013306 Bacteria 4026
276 Ga0157372_10019310 3300013307 Bacteria 7341
277 Ga0157372_10109696 3300013307 Bacteria 3161
278 Ga0157372_11295141 3300013307 Unclassified 841
279 Ga0157372_11869639 3300013307 Bacteria 690
280 Ga0157372_11923642 3300013307 Unclassified 680
281 Ga0157375_10041936 3300013308 Bacteria 4424
282 Ga0157375_10069740 3300013308 Bacteria 3523
283 Ga0157375_10313922 3300013308 Bacteria 1732
284 Ga0157375_10650989 3300013308 Unclassified 1210
285 Ga0163163_10082571 3300014325 Bacteria 3217
286 Ga0157380_10019857 3300014326 Bacteria 5014
287 Ga0157380_10044643 3300014326 Bacteria 3475
288 Ga0157380_10092572 3300014326 Unclassified 2498
289 Ga0157380_10347929 3300014326 Bacteria 1386
290 Ga0157380_11201681 3300014326 Bacteria 802
291 Ga0157377_10053528 3300014745 Bacteria 2282
292 Ga0157377_10543062 3300014745 Unclassified 820
293 Ga0157379_11613070 3300014968 Unclassified 634
294 Ga0157376_10010646 3300014969 Bacteria 6738
295 Ga0182005_1040648 3300015265 Bacteria 1265
296 Ga0163161_10008639 3300017792 Bacteria 7043
297 Ga0213876_10142736 3300021384 Bacteria 1273
298 Ga0207697_10004405 3300025315 Bacteria 6732
299 Ga0207656_10011873 3300025321 Bacteria 3300
300 Ga0207682_10045864 3300025893 Bacteria 1795
301 Ga0207692_10017916 3300025898 Bacteria 3169
302 Ga0207692_10498952 3300025898 Bacteria 772
303 Ga0207642_10057724 3300025899 Bacteria 1787
304 Ga0207680_10401922 3300025903 Bacteria 968
305 Ga0207680_11011125 3300025903 Bacteria 595
306 Ga0207647_10230585 3300025904 Bacteria 1065
307 Ga0207699_10017984 3300025906 Bacteria 3736
308 Ga0207699_10044960 3300025906 Bacteria 2574
309 Ga0207699_10083390 3300025906 Bacteria 1988
310 Ga0207699_10193902 3300025906 Bacteria 1372
311 Ga0207645_10001763 3300025907 Bacteria 17537
312 Ga0207645_10345578 3300025907 Bacteria 995
313 Ga0207643_10004206 3300025908 Bacteria 7755
314 Ga0207643_10980149 3300025908 Unclassified 547
315 Ga0207705_10130517 3300025909 Bacteria 1870
316 Ga0207705_10382312 3300025909 Unclassified 1087
317 Ga0207705_10567864 3300025909 Bacteria 882
318 Ga0207707_10000539 3300025912 Bacteria 38632
319 Ga0207707_10000647 3300025912 Bacteria 34450
320 Ga0207707_10001080 3300025912 Bacteria 26121
321 Ga0207707_10015643 3300025912 Bacteria 6609
322 Ga0207707_10025514 3300025912 Bacteria 5170
323 Ga0207695_10024740 3300025913 Bacteria 6743
324 Ga0207695_10108149 3300025913 Bacteria 2765
325 Ga0207671_10637935 3300025914 Bacteria 848
326 Ga0207693_10025901 3300025915 Bacteria 4645
327 Ga0207693_10430908 3300025915 Bacteria 1031
328 Ga0207663_10015455 3300025916 Bacteria 4212
329 Ga0207663_10044489 3300025916 Bacteria 2726
330 Ga0207660_10016071 3300025917 Bacteria 4948
331 Ga0207660_10017390 3300025917 Bacteria 4777
332 Ga0207660_10162286 3300025917 Bacteria 1725
333 Ga0207662_10023497 3300025918 Bacteria 3542
334 Ga0207662_10045355 3300025918 Bacteria 2598
335 Ga0207657_10136836 3300025919 Bacteria 2004
336 Ga0207657_10181840 3300025919 Unclassified 1699
337 Ga0207657_10227266 3300025919 Unclassified 1493
338 Ga0207657_10389452 3300025919 Bacteria 1097
339 Ga0207657_10533100 3300025919 Bacteria 918
340 Ga0207657_10682422 3300025919 Bacteria 798
341 Ga0207649_10079289 3300025920 Unclassified 2121
342 Ga0207649_10220368 3300025920 Bacteria 1351
343 Ga0207649_10428722 3300025920 Bacteria 994
344 Ga0207649_10714438 3300025920 Bacteria 778
345 Ga0207649_11009198 3300025920 Unclassified 655
346 Ga0207652_10000291 3300025921 Bacteria 52011
347 Ga0207652_10006023 3300025921 Bacteria 9818
348 Ga0207652_10010561 3300025921 Bacteria 7432
349 Ga0207652_10037306 3300025921 Bacteria 4114
350 Ga0207652_10051475 3300025921 Bacteria 3531
351 Ga0207652_10088785 3300025921 Bacteria 2713
352 Ga0207652_10173534 3300025921 Bacteria 1935
353 Ga0207652_10412166 3300025921 Bacteria 1219
354 Ga0207646_10878325 3300025922 Unclassified 796
355 Ga0207681_10021219 3300025923 Bacteria 4125
356 Ga0207681_10072366 3300025923 Bacteria 2407
357 Ga0207681_10090507 3300025923 Unclassified 2184
358 Ga0207681_10193128 3300025923 Bacteria 1559
359 Ga0207681_11516851 3300025923 Bacteria 562
360 Ga0207650_10022228 3300025925 Bacteria 4488
361 Ga0207650_10036851 3300025925 Bacteria 3560
362 Ga0207650_10070622 3300025925 Bacteria 2625
363 Ga0207650_10237398 3300025925 Bacteria 1472
364 Ga0207659_10173467 3300025926 Bacteria 1703
365 Ga0207659_10362892 3300025926 Bacteria 1204
366 Ga0207659_10512034 3300025926 Bacteria 1017
367 Ga0207687_10221827 3300025927 Bacteria 1489
368 Ga0207700_10000727 3300025928 Bacteria 19039
369 Ga0207700_10044797 3300025928 Bacteria 3259
370 Ga0207700_11308887 3300025928 Bacteria 645
371 Ga0207664_10066234 3300025929 Bacteria 2895
372 Ga0207664_10087690 3300025929 Bacteria 2544
373 Ga0207664_10290423 3300025929 Bacteria 1437
374 Ga0207664_10461989 3300025929 Bacteria 1134
375 Ga0207644_10036989 3300025931 Bacteria 3431
376 Ga0207644_10510404 3300025931 Bacteria 992
377 Ga0207644_10725331 3300025931 Bacteria 829
378 Ga0207690_10281169 3300025932 Bacteria 1296
379 Ga0207690_11374794 3300025932 Unclassified 590
380 Ga0207706_10002688 3300025933 Bacteria 17330
381 Ga0207706_10330932 3300025933 Bacteria 1325
382 Ga0207706_10334669 3300025933 Bacteria 1317
383 Ga0207706_10347869 3300025933 Bacteria 1289
384 Ga0207686_10018924 3300025934 Bacteria 3906
385 Ga0207709_10495451 3300025935 Unclassified 952
386 Ga0207670_10544818 3300025936 Bacteria 947
387 Ga0207670_10811410 3300025936 Unclassified 780
388 Ga0207669_10175329 3300025937 Bacteria 1531
389 Ga0207669_10305027 3300025937 Bacteria 1212
390 Ga0207704_10291091 3300025938 Bacteria 1246
391 Ga0207704_10412685 3300025938 Bacteria 1068
392 Ga0207704_11623146 3300025938 Bacteria 555
393 Ga0207691_10001121 3300025940 Bacteria 26617
394 Ga0207691_10008246 3300025940 Bacteria 10004
395 Ga0207691_10045186 3300025940 Bacteria 4050
396 Ga0207691_10061121 3300025940 Bacteria 3422
397 Ga0207711_11077185 3300025941 Unclassified 744
398 Ga0207689_10391899 3300025942 Bacteria 1157
399 Ga0207661_10001206 3300025944 Bacteria 17298
400 Ga0207661_10026094 3300025944 Bacteria 4449
401 Ga0207661_10035974 3300025944 Bacteria 3862
402 Ga0207661_10316488 3300025944 Bacteria 1402
403 Ga0207661_11016589 3300025944 Bacteria 763
404 Ga0207679_10004635 3300025945 Bacteria 8559
405 Ga0207679_10010332 3300025945 Bacteria 6006
406 Ga0207679_10021521 3300025945 Bacteria 4373
407 Ga0207679_10024922 3300025945 Bacteria 4107
408 Ga0207679_10033013 3300025945 Bacteria 3640
409 Ga0207679_10154849 3300025945 Bacteria 1870
410 Ga0207679_10589296 3300025945 Bacteria 1001
411 Ga0207667_10076140 3300025949 Bacteria 3482
412 Ga0207667_10544404 3300025949 Bacteria 1174
413 Ga0207667_11118849 3300025949 Bacteria 770
414 Ga0207651_10026976 3300025960 Unclassified 3600
415 Ga0207651_10341187 3300025960 Bacteria 1258
416 Ga0207651_10371308 3300025960 Bacteria 1210
417 Ga0207651_10636756 3300025960 Bacteria 935
418 Ga0207712_10000155 3300025961 Bacteria 70305
419 Ga0207712_10001273 3300025961 Bacteria 17347
420 Ga0207712_10031908 3300025961 Bacteria 3552
421 Ga0207668_10010496 3300025972 Bacteria 5599
422 Ga0207668_10041893 3300025972 Bacteria 3097
423 Ga0207668_10069989 3300025972 Bacteria 2500
424 Ga0207640_10040095 3300025981 Bacteria 2968
425 Ga0207640_10850783 3300025981 Bacteria 794
426 Ga0207658_10041603 3300025986 Bacteria 3329
427 Ga0207658_10441113 3300025986 Bacteria 1151
428 Ga0207677_10033757 3300026023 Bacteria 3305
429 Ga0207703_10712559 3300026035 Unclassified 955
430 Ga0207703_10958420 3300026035 Bacteria 820
431 Ga0207639_10399284 3300026041 Bacteria 1238
432 Ga0207639_10539825 3300026041 Bacteria 1070
433 Ga0207639_10626917 3300026041 Unclassified 993
434 Ga0207639_11707638 3300026041 Unclassified 590
435 Ga0207678_10210448 3300026067 Bacteria 1663
436 Ga0207678_10292811 3300026067 Bacteria 1398
437 Ga0207708_10008133 3300026075 Bacteria 7767
438 Ga0207708_10184074 3300026075 Bacteria 1659
439 Ga0207702_10815404 3300026078 Bacteria 923
440 Ga0207641_10393888 3300026088 Bacteria 1329
441 Ga0207648_10003560 3300026089 Bacteria 16287
442 Ga0207648_10234071 3300026089 Bacteria 1634
443 Ga0207648_10242175 3300026089 Bacteria 1606
444 Ga0207648_10613493 3300026089 Unclassified 1003
445 Ga0207676_10445200 3300026095 Bacteria 1220
446 Ga0207676_11725349 3300026095 Unclassified 624
447 Ga0207674_10000586 3300026116 Bacteria 47919
448 Ga0207674_10006873 3300026116 Bacteria 13334
449 Ga0207674_10030041 3300026116 Bacteria 5717
450 Ga0207674_10681485 3300026116 Bacteria 992
451 Ga0207674_10803728 3300026116 Bacteria 908
452 Ga0207675_100001600 3300026118 Bacteria 22693
453 Ga0207675_100072026 3300026118 Bacteria 3231
454 Ga0207675_100128345 3300026118 Bacteria 2403
455 Ga0207683_10053154 3300026121 Bacteria 3551
456 Ga0207683_10076357 3300026121 Bacteria 2966
457 Ga0207683_10505289 3300026121 Unclassified 1117
458 Ga0207698_10056418 3300026142 Bacteria 3033
459 Ga0207698_10156992 3300026142 Bacteria 1984
460 Ga0207698_10184117 3300026142 Bacteria 1853
461 Ga0209967_1022787 3300027364 Unclassified 920
462 Ga0209981_1015991 3300027378 Bacteria 1053
463 Ga0209970_1009427 3300027614 Bacteria 1595
464 Ga0209983_1006132 3300027665 Bacteria 2477
465 Ga0209971_1009207 3300027682 Bacteria 2340
466 Ga0209998_10001908 3300027717 Bacteria 4908
467 Ga0207428_10022088 3300027907 Bacteria 5374
468 Ga0207428_10116590 3300027907 Bacteria 2050
469 Ga0207428_10459779 3300027907 Bacteria 927
470 Ga0268266_10071505 3300028379 Bacteria 3007
471 Ga0268266_10286001 3300028379 Bacteria 1534
472 Ga0268265_10002085 3300028380 Bacteria 15582
473 Ga0268265_10636219 3300028380 Bacteria 1024
474 Ga0268264_10096209 3300028381 Bacteria 2564
475 Ga0268264_10317988 3300028381 Bacteria 1471
476 Ga0307408_100006075 3300031548 Bacteria 8033
477 Ga0307408_100949524 3300031548 Bacteria 790
478 Ga0307405_10044547 3300031731 Unclassified 2714
479 Ga0307405_10053564 3300031731 Bacteria 2514
480 Ga0307413_10096376 3300031824 Bacteria 1942
481 Ga0307413_10694502 3300031824 Unclassified 844
482 Ga0307413_11430142 3300031824 Unclassified 609
483 Ga0307410_10043433 3300031852 Bacteria 2979
484 Ga0307410_10309908 3300031852 Bacteria 1248
485 Ga0307410_10582561 3300031852 Bacteria 931
486 Ga0307406_10025874 3300031901 Bacteria 3517
487 Ga0307406_10075360 3300031901 Bacteria 2226
488 Ga0307407_10052262 3300031903 Bacteria 2346
489 Ga0307407_10088188 3300031903 Bacteria 1895
490 Ga0307407_10503696 3300031903 Bacteria 888
491 Ga0307407_10912488 3300031903 Unclassified 674
492 Ga0307412_10016265 3300031911 Bacteria 4429
493 Ga0307412_10071490 3300031911 Bacteria 2369
494 Ga0307412_10074938 3300031911 Bacteria 2320
495 Ga0307412_10553010 3300031911 Unclassified 967
496 Ga0307412_10762524 3300031911 Unclassified 836
497 Ga0307409_100031604 3300031995 Bacteria 3824
498 Ga0307409_100087740 3300031995 Bacteria 2536
499 Ga0307409_100100579 3300031995 Bacteria 2397
500 Ga0307409_100727545 3300031995 Bacteria 994
501 Ga0307409_100747719 3300031995 Bacteria 981
502 Ga0307416_100204221 3300032002 Bacteria 1878
503 Ga0307416_100255461 3300032002 Bacteria 1709
504 Ga0307416_100454142 3300032002 Bacteria 1335
505 Ga0307416_102220305 3300032002 Unclassified 650
506 Ga0307414_10153684 3300032004 Bacteria 1819
507 Ga0307414_10211386 3300032004 Bacteria 1586
508 Ga0307414_10641540 3300032004 Bacteria 956
509 Ga0307411_10159392 3300032005 Bacteria 1688
510 Ga0307411_10241495 3300032005 Bacteria 1414
511 Ga0307411_10569760 3300032005 Bacteria 969
512 Ga0307411_11451920 3300032005 Unclassified 629
513 Ga0307415_100159014 3300032126 Bacteria 1749
514 Ga0307415_100278370 3300032126 Bacteria 1374
515 Ga0307415_100280190 3300032126 Bacteria 1370
516 Ga0373926_0011089 3300035083 Bacteria 3029
517 Ga0373944_0029503 3300035089 Bacteria 1640
518 Ga0373945_0024453 3300035116 Bacteria 2093
519 Ga0373953_0001775 3300035117 Bacteria 6372
520 Ga0373954_0004888 3300035118 Bacteria 5783
521 Ga0373956_0000901 3300035119 Bacteria 12281
522 Ga0373946_0044281 3300035171 Bacteria 1837
523 Ga0373955_0004431 3300035172 Bacteria 6219
524 Ga0373924_0005944 3300035410 Bacteria 4349
525 Ga0373935_0165339 3300035692 Bacteria 1511
526 Ga0373927_1085423 3300035695 Unclassified 528
527 Ga0373933_0001456 3300035724 Bacteria 13857
528 Ga0373947_0003019 3300035725 Bacteria 10028
529 Ga0373947_0348615 3300035725 Unclassified 993
530 Ga0373937_0011254 3300036401 Bacteria 7842
531 Ga0373925_0027707 3300037068 Bacteria 4147
532 Ga0373925_0756406 3300037068 Bacteria 801
533 Ga0395905_0348795 3300037471 Bacteria 1372
534 Ga0395905_0589150 3300037471 Unclassified 1014
535 Ga0451839_1530400 3300041496 Unclassified 636
536 Ga0439448_0217192 3300042005 Unclassified 672
537 Ga0439434_0015120 3300042435 Bacteria 2300
538 Ga0466969_0182177 3300044656 Bacteria 961
539 Ga0466966_0053510 3300044684 Bacteria 2561
540 Ga0466961_0170274 3300044693 Bacteria 1355
541 Ga0466959_0116433 3300045049 Unclassified 1903
542 Ga0451576_0116327 3300045051 Unclassified 2784
543 Ga0451576_0155981 3300045051 Bacteria 2381
544 Ga0466958_0044774 3300045836 Bacteria 2668
545 Ga0466958_0220436 3300045836 Unclassified 1210
546 Ga0466967_0294002 3300045976 Bacteria 1561
547 Ga0466967_0306470 3300045976 Bacteria 1529
548 Ga0495592_0000192 3300046454 Bacteria 52370
549 Ga0495592_0112663 3300046454 Bacteria 1923
550 Ga0495603_0654482 3300046455 Unclassified 601
551 Ga0495629_0004982 3300046459 Bacteria 9961
552 Ga0495629_0576976 3300046459 Bacteria 753
553 Ga0495629_0681663 3300046459 Bacteria 683
554 Ga0495651_0004600 3300046462 Bacteria 10545
555 Ga0495653_0000789 3300046463 Bacteria 24311
556 Ga0495580_0012451 3300046472 Bacteria 6521
557 Ga0495580_0067947 3300046472 Bacteria 2493
558 Ga0495580_0420708 3300046472 Unclassified 899
559 Ga0495582_0001860 3300046473 Bacteria 11899
560 Ga0495639_0001152 3300046475 Bacteria 11930
561 Ga0495662_0103064 3300046476 Bacteria 1396
562 Ga0495664_0041580 3300046477 Bacteria 2720
563 Ga0495664_0297050 3300046477 Bacteria 975
564 Ga0495608_0002625 3300046511 Bacteria 12907
565 Ga0495628_0000368 3300046516 Bacteria 41318
566 Ga0495630_0002980 3300046517 Bacteria 11753
567 Ga0495630_0073317 3300046517 Bacteria 2578
568 Ga0495652_0000127 3300046529 Bacteria 84285
569 Ga0495665_0000353 3300046531 Bacteria 23264
570 Ga0495665_0112312 3300046531 Bacteria 1429
571 Ga0495586_0099147 3300046535 Bacteria 1616
572 Ga0495586_0499355 3300046535 Bacteria 702
573 Ga0495587_0000449 3300046536 Bacteria 28822
574 Ga0495645_0000845 3300046543 Bacteria 20832
575 Ga0495667_0000364 3300046559 Bacteria 28871
576 Ga0495635_0014151 3300046663 Bacteria 5582
577 Ga0495588_0016305 3300046674 Bacteria 3590
578 Ga0495657_0000618 3300046675 Bacteria 32269
579 Ga0495599_0000156 3300046678 Bacteria 44910
580 Ga0495599_0012337 3300046678 Bacteria 5262
581 Ga0495623_0000596 3300046679 Bacteria 24124
582 Ga0495646_0011703 3300046680 Bacteria 5578
583 Ga0495658_0003868 3300046683 Bacteria 7412
584 Ga0495613_0070323 3300046689 Bacteria 2552
585 Ga0495613_0629179 3300046689 Bacteria 712
586 Ga0495600_0001234 3300046809 Bacteria 14023
587 Ga0495581_0010120 3300047315 Bacteria 5459
588 Ga0495581_0217523 3300047315 Bacteria 1117
589 Ga0495604_0002634 3300047317 Bacteria 14410
590 Ga0495674_0004059 3300047319 Bacteria 14164
591 Ga0495675_0001831 3300047444 Bacteria 12678
592 Ga0495684_0000041 3300047471 Bacteria 98420
593 Ga0495593_0000624 3300047673 Bacteria 20232
594 Ga0495602_0014621 3300048088 Bacteria 7964
595 Ga0495614_0008800 3300048089 Bacteria 4481
596 Ga0496106_0128762 3300048909 Bacteria 1984
597 Ga0496108_0276261 3300048911 Bacteria 1463
598 Ga0496109_0057063 3300048912 Bacteria 3563
599 Ga0496113_0503187 3300048916 Bacteria 973
600 Ga0501296_013189 3300049519 Bacteria 1004
601 Ga0501298_061700 3300049521 Unclassified 795
602 Ga0501076_0925122 3300049592 Unclassified 719
603 Ga0501209_013373 3300049656 Bacteria 1775
604 Ga0501214_066093 3300049659 Bacteria 582
605 Ga0501216_000465 3300049660 Bacteria 4802
606 Ga0501222_034483 3300049662 Bacteria 703
607 Ga0501223_081702 3300049663 Bacteria 648
608 Ga0501227_006070 3300049665 Bacteria 2594
609 Ga0501233_008468 3300049668 Bacteria 1983
610 Ga0501235_000360 3300049669 Bacteria 8707
611 Ga0501240_017671 3300049673 Bacteria 1040
612 Ga0501242_010058 3300049674 Bacteria 1126
613 Ga0501243_031027 3300049675 Bacteria 912
614 Ga0501247_002319 3300049677 Bacteria 1968
615 Ga0501249_001598 3300049679 Bacteria 4640
616 Ga0501249_034665 3300049679 Bacteria 1133
617 Ga0501257_003515 3300049686 Bacteria 3368
618 Ga0501259_011008 3300049688 Bacteria 1488
619 Ga0501260_033528 3300049689 Bacteria 600
620 Ga0501261_030849 3300049690 Bacteria 810
621 Ga0501221_002326 3300049704 Unclassified 3156
622 Ga0501225_0019690 3300049705 Bacteria 1866
623 Ga0501234_005966 3300049707 Bacteria 1906
624 Ga0501245_005897 3300049708 Bacteria 1704
625 Ga0501245_054817 3300049708 Unclassified 715
626 Ga0501080_0306075 3300049742 Bacteria 1441
627 Ga0501262_004741 3300049759 Bacteria 1587
628 Ga0501265_006648 3300049762 Bacteria 1348
629 Ga0501266_000550 3300049763 Bacteria 4981
630 Ga0501268_000025 3300049765 Bacteria 13107
631 Ga0501268_033317 3300049765 Bacteria 942
632 Ga0501269_040885 3300049766 Bacteria 617
633 Ga0501270_041813 3300049767 Bacteria 801
634 Ga0501273_028017 3300049770 Bacteria 791
635 Ga0501274_005097 3300049771 Bacteria 1103
636 Ga0501283_006403 3300049779 Bacteria 1648
637 Ga0501212_003694 3300049851 Bacteria 1938
638 nmdc:mga05p37_341703_c1 3300050507 Bacteria 1765
639 nmdc:mga05p37_345003_c1 3300050507 Bacteria 1755
640 nmdc:mga05p37_40251_c1 3300050507 Bacteria 5739
641 nmdc:mga09592_1535957_c1 3300050508 Unclassified 541
642 nmdc:mga09592_17618_c1 3300050508 Bacteria 5853
643 nmdc:mga09592_191136_c2 3300050508 Bacteria 1407
644 nmdc:mga09592_241022_c1 3300050508 Bacteria 1567
645 nmdc:mga09592_272311_c1 3300050508 Bacteria 1468
646 nmdc:mga0qj67_100585_c1 3300050509 Bacteria 2331
647 nmdc:mga0qj67_1062183_c1 3300050509 Unclassified 634
648 nmdc:mga0qj67_120933_c1 3300050509 Bacteria 2118
649 nmdc:mga0qj67_416218_c1 3300050509 Unclassified 1084
650 nmdc:mga0qj67_68150_c1 3300050509 Bacteria 2836
651 nmdc:mga0qj67_873991_c1 3300050509 Bacteria 709
652 nmdc:mga0qj67_945687_c1 3300050509 Bacteria 678
653 nmdc:mga06r32_124092_c1 3300050510 Bacteria 2549
654 nmdc:mga06r32_244237_c1 3300050510 Bacteria 1783
655 nmdc:mga06r32_256804_c1 3300050510 Unclassified 1735
656 nmdc:mga06r32_494407_c1 3300050510 Bacteria 1201
657 nmdc:mga08y16_105376_c1 3300050511 Bacteria 2935
658 nmdc:mga08y16_1068412_c1 3300050511 Bacteria 784
659 nmdc:mga08y16_1483954_c1 3300050511 Bacteria 639
660 nmdc:mga08y16_1669720_c1 3300050511 Unclassified 593
661 nmdc:mga08y16_9780_c1 3300050511 Bacteria 10068
662 nmdc:mga0n895_513153_c1 3300050512 Bacteria 1207
663 nmdc:mga0n895_7287_c1 3300050512 Bacteria 9478
664 nmdc:mga0n895_830_c1 3300050512 Bacteria 22145
665 nmdc:mga0rr50_101419_c1 3300050513 Bacteria 2262
666 nmdc:mga0rr50_499238_c1 3300050513 Unclassified 1034
667 nmdc:mga0a205_184783_c1 3300050515 Bacteria 1978
668 nmdc:mga0a205_76295_c1 3300050515 Bacteria 3239
669 Ga0495601_0012644 3300053077 Bacteria 5063
670 Ga0495612_0000341 3300053078 Bacteria 18831
671 Ga0495595_0066486 3300053084 Unclassified 1697
672 Ga0501082_0825444 3300060353 Unclassified 811
673 Ga0466962_0223973 3300061719 Bacteria 921
674 Ga0105238_11315963
675 MRS1b_contig_1444243
676 MBSR1b_contig_1592789
677 Ga0065712_10151222
678 Ga0065712_10220671
679 Ga0065715_10117978
680 Ga0065715_10138322
681 Ga0065715_10281362
682 Ga0065715_10688025
683 Ga0065707_10004955
684 Ga0065707_10114991
685 Ga0065707_10131298
686 Ga0070658_10150235
687 Ga0070658_10611622
688 Ga0070676_10650323
689 Ga0070683_100059749
690 Ga0070683_100091081
691 Ga0070683_100104221
692 Ga0070683_100159058
693 Ga0070683_100212048
694 Ga0070683_100718419
695 Ga0070690_100105452
696 Ga0070690_100990365
697 Ga0070670_100004194
698 Ga0070670_100037235
699 Ga0070670_100210729
700 Ga0070670_100294925
701 Ga0070677_10275871
702 Ga0068869_100132467
703 Ga0070666_10260323
704 Ga0070680_100046238
705 Ga0070680_100197683
706 Ga0070680_100378663
707 Ga0070680_100381267
708 Ga0070680_100464654
709 Ga0070680_100701490
710 Ga0070682_100041699
711 Ga0070682_100140258
712 Ga0068868_100022148
713 Ga0068868_100036221
714 Ga0070660_100127704
715 Ga0070660_100246589
716 Ga0070660_100339372
717 Ga0070660_100676543
718 Ga0070660_100820247
719 Ga0070689_100007166
720 Ga0070689_100840555
721 Ga0070691_10054979
722 Ga0070687_100058445
723 Ga0070687_100109778
724 Ga0070661_100006278
725 Ga0070661_100006924
726 Ga0070661_100007871
727 Ga0070661_100190863
728 Ga0070661_100224403
729 Ga0070661_100252401
730 Ga0070661_100780647
731 Ga0070668_100011350
732 Ga0070669_100017694
733 Ga0070675_100066365
734 Ga0070675_100466561
735 Ga0070675_100977340
736 Ga0070675_101010964
737 Ga0070675_101089026
738 Ga0070671_100027008
739 Ga0070671_100307933
740 Ga0070671_100316344
741 Ga0070671_100576397
742 Ga0070674_100219228
743 Ga0070674_100274964
744 Ga0070674_100771949
745 Ga0070673_100122295
746 Ga0070673_100128542
747 Ga0070688_100003503
748 Ga0070688_100594599
749 Ga0070659_100002374
750 Ga0070667_100019844
751 Ga0070667_100030974
752 Ga0070709_10010242
753 Ga0070709_10155074
754 Ga0070709_10579882
755 Ga0070714_100009539
756 Ga0070714_100128778
757 Ga0070714_100329904
758 Ga0070713_100001159
759 Ga0070713_100067132
760 Ga0070710_10009652
761 Ga0070710_10474410
762 Ga0070710_10590001
763 Ga0070701_10101897
764 Ga0070701_10331522
765 Ga0070701_10779932
766 Ga0070711_100041939
767 Ga0070711_100233875
768 Ga0070711_100455257
769 Ga0070711_100689857
770 Ga0070705_101668787
771 Ga0070700_100749549
772 Ga0070694_100089607
773 Ga0070694_100113568
774 Ga0070663_100220178
775 Ga0070678_100060579
776 Ga0070678_100170820
777 Ga0070662_100010809
778 Ga0070662_100109425
779 Ga0070662_100317760
780 Ga0070662_100691092
781 Ga0070681_10005821
782 Ga0070681_10013477
783 Ga0070681_10030872
784 Ga0070681_10140417
785 Ga0070681_10243091
786 Ga0070681_10649881
787 Ga0068867_100120462
788 Ga0068867_100309651
789 Ga0068867_101631690
790 Ga0070685_10024869
791 Ga0070685_10331062
792 Ga0070707_100148766
793 Ga0070707_100172006
794 Ga0070698_100002955
795 Ga0070698_100015327
796 Ga0070698_100825887
797 Ga0070699_100000733
798 Ga0070699_100060172
799 Ga0070699_100104274
800 Ga0070699_101229231
801 Ga0070679_100001159
802 Ga0070679_100049891
803 Ga0070679_100162117
804 Ga0070679_100180757
805 Ga0070679_100302089
806 Ga0070679_100330267
807 Ga0070679_100632406
808 Ga0070684_100044337
809 Ga0070684_100062332
810 Ga0070684_100081531
811 Ga0070684_100083791
812 Ga0070684_100094000
813 Ga0070684_100688780
814 Ga0070697_100489118
815 Ga0068853_100647827
816 Ga0068853_100838704
817 Ga0068853_100925781
818 Ga0068853_100947709
819 Ga0070672_100006565
820 Ga0070672_100027445
821 Ga0070672_100524176
822 Ga0070672_101151591
823 Ga0070686_100001162
824 Ga0070695_100000416
825 Ga0070695_100095439
826 Ga0070695_100432172
827 Ga0070695_101370680
828 Ga0070696_100013378
829 Ga0070693_100004085
830 Ga0070693_100079173
831 Ga0070665_100040789
832 Ga0068855_100063180
833 Ga0068855_100356687
834 Ga0068855_100780581
835 Ga0068855_101440495
836 Ga0068855_101967886
837 Ga0070664_100002756
838 Ga0070664_100061733
839 Ga0070664_100062017
840 Ga0070664_100131403
841 Ga0070664_100136185
842 Ga0070664_100292762
843 Ga0070664_100331527
844 Ga0068857_100004441
845 Ga0068857_100007418
846 Ga0068857_100274464
847 Ga0068857_100288336
848 Ga0068857_100546399
849 Ga0068857_101083474
850 Ga0068854_100056400
851 Ga0068856_100552273
852 Ga0068856_101142331
853 Ga0070702_100201827
854 Ga0068852_100025587
855 Ga0068852_100045605
856 Ga0068852_100175709
857 Ga0068852_100515712
858 Ga0068859_100176150
859 Ga0068859_102131637
860 Ga0068864_100042332
861 Ga0068866_10153030
862 Ga0068861_100009561
863 Ga0068861_100037119
864 Ga0068861_100427085
865 Ga0068870_10011776
866 Ga0068863_100109093
867 Ga0068863_101708217
868 Ga0068858_100044365
869 Ga0068858_100795917
870 Ga0068860_100077141
871 Ga0068862_100058570
872 Ga0068862_100959093
873 Ga0070717_10004301
874 Ga0070717_10338612
875 Ga0070717_10815241
876 Ga0070712_100042409
877 Ga0070712_100067023
878 Ga0070712_100072375
879 Ga0070712_100539116
880 Ga0070712_100853821
881 Ga0068871_100340759
882 Ga0075428_100085952
883 Ga0075430_100003632
884 Ga0075430_100027695
885 Ga0075430_100189996
886 Ga0075430_100249441
887 Ga0075431_100009724
888 Ga0075431_100156785
889 Ga0075431_100275016
890 Ga0075431_100358544
891 Ga0075431_100909161
892 Ga0075431_101353944
893 Ga0075433_10064658
894 Ga0075433_10066703
895 Ga0075433_10277850
896 Ga0075433_10867050
897 Ga0075434_100012915
898 Ga0075434_100133044
899 Ga0075434_100187498
900 Ga0075434_100548889
901 Ga0075429_100299454
902 Ga0068865_100423808
903 Ga0068865_100612532
904 Ga0068865_101528036
905 Ga0097620_100176155
906 Ga0097620_102131823
907 Ga0075435_100184327
908 Ga0105240_10002958
909 Ga0111539_10032859
910 Ga0111539_10056899
911 Ga0111539_10158820
912 Ga0111539_10199829
913 Ga0111539_12205338
914 Ga0105245_10730937
915 Ga0114129_10046113
916 Ga0114129_10243801
917 Ga0114129_10292418
918 Ga0114129_10358086
919 Ga0105243_10773596
920 Ga0105243_11475248
921 Ga0105242_10002317
922 Ga0105242_10812495
923 Ga0105248_10011768
924 Ga0105248_10044660
925 Ga0105248_10338297
926 Ga0105237_10700105
927 Ga0105249_10000023
928 Ga0105249_10000668
929 Ga0105249_10096876
930 Ga0105249_10519683
931 Ga0105239_10154177
932 Ga0157314_1016943
933 Ga0157313_1036054
934 Ga0157373_10008677
935 Ga0157373_10667714
936 Ga0157371_10073332
937 Ga0157370_10007605
938 Ga0157370_10103588
939 Ga0157369_10048295
940 Ga0157369_10463394
941 Ga0157374_10037324
942 Ga0157374_10727869
943 Ga0157374_11016150
944 Ga0157378_10102852
945 Ga0157378_11114062
946 Ga0157378_11526242
947 Ga0163162_10023127
948 Ga0163162_10054411
949 Ga0157372_10019310
950 Ga0157372_10109696
951 Ga0157372_11295141
952 Ga0157372_11869639
953 Ga0157372_11923642
954 Ga0157375_10041936
955 Ga0157375_10069740
956 Ga0157375_10313922
957 Ga0157375_10650989
958 Ga0163163_10082571
959 Ga0157380_10019857
960 Ga0157380_10044643
961 Ga0157380_10092572
962 Ga0157380_10347929
963 Ga0157380_11201681
964 Ga0157377_10053528
965 Ga0157377_10543062
966 Ga0157379_11613070
967 Ga0157376_10010646
968 Ga0182005_1040648
969 Ga0163161_10008639
970 Ga0213876_10142736
971 Ga0207697_10004405
972 Ga0207656_10011873
973 Ga0207682_10045864
974 Ga0207692_10017916
975 Ga0207692_10498952
976 Ga0207642_10057724
977 Ga0207680_10401922
978 Ga0207680_11011125
979 Ga0207647_10230585
980 Ga0207699_10017984
981 Ga0207699_10044960
982 Ga0207699_10083390
983 Ga0207699_10193902
984 Ga0207645_10001763
985 Ga0207645_10345578
986 Ga0207643_10004206
987 Ga0207643_10980149
988 Ga0207705_10130517
989 Ga0207705_10382312
990 Ga0207705_10567864
991 Ga0207707_10000539
992 Ga0207707_10000647
993 Ga0207707_10001080
994 Ga0207707_10015643
995 Ga0207707_10025514
996 Ga0207695_10024740
997 Ga0207695_10108149
998 Ga0207671_10637935
999 Ga0207693_10025901
1000 Ga0207693_10430908
1001 Ga0207663_10015455
1002 Ga0207663_10044489
1003 Ga0207660_10016071
1004 Ga0207660_10017390
1005 Ga0207660_10162286
1006 Ga0207662_10023497
1007 Ga0207662_10045355
1008 Ga0207657_10136836
1009 Ga0207657_10181840
1010 Ga0207657_10227266
1011 Ga0207657_10389452
1012 Ga0207657_10533100
1013 Ga0207657_10682422
1014 Ga0207649_10079289
1015 Ga0207649_10220368
1016 Ga0207649_10428722
1017 Ga0207649_10714438
1018 Ga0207649_11009198
1019 Ga0207652_10000291
1020 Ga0207652_10006023
1021 Ga0207652_10010561
1022 Ga0207652_10037306
1023 Ga0207652_10051475
1024 Ga0207652_10088785
1025 Ga0207652_10173534
1026 Ga0207652_10412166
1027 Ga0207646_10878325
1028 Ga0207681_10021219
1029 Ga0207681_10072366
1030 Ga0207681_10090507
1031 Ga0207681_10193128
1032 Ga0207681_11516851
1033 Ga0207650_10022228
1034 Ga0207650_10036851
1035 Ga0207650_10070622
1036 Ga0207650_10237398
1037 Ga0207659_10173467
1038 Ga0207659_10362892
1039 Ga0207659_10512034
1040 Ga0207687_10221827
1041 Ga0207700_10000727
1042 Ga0207700_10044797
1043 Ga0207700_11308887
1044 Ga0207664_10066234
1045 Ga0207664_10087690
1046 Ga0207664_10290423
1047 Ga0207664_10461989
1048 Ga0207644_10036989
1049 Ga0207644_10510404
1050 Ga0207644_10725331
1051 Ga0207690_10281169
1052 Ga0207690_11374794
1053 Ga0207706_10002688
1054 Ga0207706_10330932
1055 Ga0207706_10334669
1056 Ga0207706_10347869
1057 Ga0207686_10018924
1058 Ga0207709_10495451
1059 Ga0207670_10544818
1060 Ga0207670_10811410
1061 Ga0207669_10175329
1062 Ga0207669_10305027
1063 Ga0207704_10291091
1064 Ga0207704_10412685
1065 Ga0207704_11623146
1066 Ga0207691_10001121
1067 Ga0207691_10008246
1068 Ga0207691_10045186
1069 Ga0207691_10061121
1070 Ga0207711_11077185
1071 Ga0207689_10391899
1072 Ga0207661_10001206
1073 Ga0207661_10026094
1074 Ga0207661_10035974
1075 Ga0207661_10316488
1076 Ga0207661_11016589
1077 Ga0207679_10004635
1078 Ga0207679_10010332
1079 Ga0207679_10021521
1080 Ga0207679_10024922
1081 Ga0207679_10033013
1082 Ga0207679_10154849
1083 Ga0207679_10589296
1084 Ga0207667_10076140
1085 Ga0207667_10544404
1086 Ga0207667_11118849
1087 Ga0207651_10026976
1088 Ga0207651_10341187
1089 Ga0207651_10371308
1090 Ga0207651_10636756
1091 Ga0207712_10000155
1092 Ga0207712_10001273
1093 Ga0207712_10031908
1094 Ga0207668_10010496
1095 Ga0207668_10041893
1096 Ga0207668_10069989
1097 Ga0207640_10040095
1098 Ga0207640_10850783
1099 Ga0207658_10041603
1100 Ga0207658_10441113
1101 Ga0207677_10033757
1102 Ga0207703_10712559
1103 Ga0207703_10958420
1104 Ga0207639_10399284
1105 Ga0207639_10539825
1106 Ga0207639_10626917
1107 Ga0207639_11707638
1108 Ga0207678_10210448
1109 Ga0207678_10292811
1110 Ga0207708_10008133
1111 Ga0207708_10184074
1112 Ga0207702_10815404
1113 Ga0207641_10393888
1114 Ga0207648_10003560
1115 Ga0207648_10234071
1116 Ga0207648_10242175
1117 Ga0207648_10613493
1118 Ga0207676_10445200
1119 Ga0207676_11725349
1120 Ga0207674_10000586
1121 Ga0207674_10006873
1122 Ga0207674_10030041
1123 Ga0207674_10681485
1124 Ga0207674_10803728
1125 Ga0207675_100001600
1126 Ga0207675_100072026
1127 Ga0207675_100128345
1128 Ga0207683_10053154
1129 Ga0207683_10076357
1130 Ga0207683_10505289
1131 Ga0207698_10056418
1132 Ga0207698_10156992
1133 Ga0207698_10184117
1134 Ga0209967_1022787
1135 Ga0209981_1015991
1136 Ga0209970_1009427
1137 Ga0209983_1006132
1138 Ga0209971_1009207
1139 Ga0209998_10001908
1140 Ga0207428_10022088
1141 Ga0207428_10116590
1142 Ga0207428_10459779
1143 Ga0268266_10071505
1144 Ga0268266_10286001
1145 Ga0268265_10002085
1146 Ga0268265_10636219
1147 Ga0268264_10096209
1148 Ga0268264_10317988
1149 Ga0307408_100006075
1150 Ga0307408_100949524
1151 Ga0307405_10044547
1152 Ga0307405_10053564
1153 Ga0307413_10096376
1154 Ga0307413_10694502
1155 Ga0307413_11430142
1156 Ga0307410_10043433
1157 Ga0307410_10309908
1158 Ga0307410_10582561
1159 Ga0307406_10025874
1160 Ga0307406_10075360
1161 Ga0307407_10052262
1162 Ga0307407_10088188
1163 Ga0307407_10503696
1164 Ga0307407_10912488
1165 Ga0307412_10016265
1166 Ga0307412_10071490
1167 Ga0307412_10074938
1168 Ga0307412_10553010
1169 Ga0307412_10762524
1170 Ga0307409_100031604
1171 Ga0307409_100087740
1172 Ga0307409_100100579
1173 Ga0307409_100727545
1174 Ga0307409_100747719
1175 Ga0307416_100204221
1176 Ga0307416_100255461
1177 Ga0307416_100454142
1178 Ga0307416_102220305
1179 Ga0307414_10153684
1180 Ga0307414_10211386
1181 Ga0307414_10641540
1182 Ga0307411_10159392
1183 Ga0307411_10241495
1184 Ga0307411_10569760
1185 Ga0307411_11451920
1186 Ga0307415_100159014
1187 Ga0307415_100278370
1188 Ga0307415_100280190
1189 Ga0373926_0011089
1190 Ga0373944_0029503
1191 Ga0373945_0024453
1192 Ga0373953_0001775
1193 Ga0373954_0004888
1194 Ga0373956_0000901
1195 Ga0373946_0044281
1196 Ga0373955_0004431
1197 Ga0373924_0005944
1198 Ga0373935_0165339
1199 Ga0373927_1085423
1200 Ga0373933_0001456
1201 Ga0373947_0003019
1202 Ga0373947_0348615
1203 Ga0373937_0011254
1204 Ga0373925_0027707
1205 Ga0373925_0756406
1206 Ga0395905_0348795
1207 Ga0395905_0589150
1208 Ga0451839_1530400
1209 Ga0439448_0217192
1210 Ga0439434_0015120
1211 Ga0466969_0182177
1212 Ga0466966_0053510
1213 Ga0466961_0170274
1214 Ga0466959_0116433
1215 Ga0451576_0116327
1216 Ga0451576_0155981
1217 Ga0466958_0044774
1218 Ga0466958_0220436
1219 Ga0466967_0294002
1220 Ga0466967_0306470
1221 Ga0495592_0000192
1222 Ga0495592_0112663
1223 Ga0495603_0654482
1224 Ga0495629_0004982
1225 Ga0495629_0576976
1226 Ga0495629_0681663
1227 Ga0495651_0004600
1228 Ga0495653_0000789
1229 Ga0495580_0012451
1230 Ga0495580_0067947
1231 Ga0495580_0420708
1232 Ga0495582_0001860
1233 Ga0495639_0001152
1234 Ga0495662_0103064
1235 Ga0495664_0041580
1236 Ga0495664_0297050
1237 Ga0495608_0002625
1238 Ga0495628_0000368
1239 Ga0495630_0002980
1240 Ga0495630_0073317
1241 Ga0495652_0000127
1242 Ga0495665_0000353
1243 Ga0495665_0112312
1244 Ga0495586_0099147
1245 Ga0495586_0499355
1246 Ga0495587_0000449
1247 Ga0495645_0000845
1248 Ga0495667_0000364
1249 Ga0495635_0014151
1250 Ga0495588_0016305
1251 Ga0495657_0000618
1252 Ga0495599_0000156
1253 Ga0495599_0012337
1254 Ga0495623_0000596
1255 Ga0495646_0011703
1256 Ga0495658_0003868
1257 Ga0495613_0070323
1258 Ga0495613_0629179
1259 Ga0495600_0001234
1260 Ga0495581_0010120
1261 Ga0495581_0217523
1262 Ga0495604_0002634
1263 Ga0495674_0004059
1264 Ga0495675_0001831
1265 Ga0495684_0000041
1266 Ga0495593_0000624
1267 Ga0495602_0014621
1268 Ga0495614_0008800
1269 Ga0496106_0128762
1270 Ga0496108_0276261
1271 Ga0496109_0057063
1272 Ga0496113_0503187
1273 Ga0501296_013189
1274 Ga0501298_061700
1275 Ga0501076_0925122
1276 Ga0501209_013373
1277 Ga0501214_066093
1278 Ga0501216_000465
1279 Ga0501222_034483
1280 Ga0501223_081702
1281 Ga0501227_006070
1282 Ga0501233_008468
1283 Ga0501235_000360
1284 Ga0501240_017671
1285 Ga0501242_010058
1286 Ga0501243_031027
1287 Ga0501247_002319
1288 Ga0501249_001598
1289 Ga0501249_034665
1290 Ga0501257_003515
1291 Ga0501259_011008
1292 Ga0501260_033528
1293 Ga0501261_030849
1294 Ga0501221_002326
1295 Ga0501225_0019690
1296 Ga0501234_005966
1297 Ga0501245_005897
1298 Ga0501245_054817
1299 Ga0501080_0306075
1300 Ga0501262_004741
1301 Ga0501265_006648
1302 Ga0501266_000550
1303 Ga0501268_000025
1304 Ga0501268_033317
1305 Ga0501269_040885
1306 Ga0501270_041813
1307 Ga0501273_028017
1308 Ga0501274_005097
1309 Ga0501283_006403
1310 Ga0501212_003694
1311 nmdc:mga05p37_341703_c1
1312 nmdc:mga05p37_345003_c1
1313 nmdc:mga05p37_40251_c1
1314 nmdc:mga09592_1535957_c1
1315 nmdc:mga09592_17618_c1
1316 nmdc:mga09592_191136_c2
1317 nmdc:mga09592_241022_c1
1318 nmdc:mga09592_272311_c1
1319 nmdc:mga0qj67_100585_c1
1320 nmdc:mga0qj67_1062183_c1
1321 nmdc:mga0qj67_120933_c1
1322 nmdc:mga0qj67_416218_c1
1323 nmdc:mga0qj67_68150_c1
1324 nmdc:mga0qj67_873991_c1
1325 nmdc:mga0qj67_945687_c1
1326 nmdc:mga06r32_124092_c1
1327 nmdc:mga06r32_244237_c1
1328 nmdc:mga06r32_256804_c1
1329 nmdc:mga06r32_494407_c1
1330 nmdc:mga08y16_105376_c1
1331 nmdc:mga08y16_1068412_c1
1332 nmdc:mga08y16_1483954_c1
1333 nmdc:mga08y16_1669720_c1
1334 nmdc:mga08y16_9780_c1
1335 nmdc:mga0n895_513153_c1
1336 nmdc:mga0n895_7287_c1
1337 nmdc:mga0n895_830_c1
1338 nmdc:mga0rr50_101419_c1
1339 nmdc:mga0rr50_499238_c1
1340 nmdc:mga0a205_184783_c1
1341 nmdc:mga0a205_76295_c1
1342 Ga0495601_0012644
1343 Ga0495612_0000341
1344 Ga0495595_0066486
1345 Ga0501082_0825444
1346 Ga0466962_0223973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

1

138

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3loq-assembly2.cif.gz_B the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8716 3 138
3loq-assembly1.cif.gz_A the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8554 3 141
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8481 2 140
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.844 2 137
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8296 2 140
ID Description Score Start End Superfamily
2pfsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.889 2 138 3.40.50.620
2pfsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8594 2 138 3.40.50.620
3loqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8343 3 141 3.40.50.620
3qtbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.829 3 137 3.40.50.620
5ahwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8281 2 138 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V6CJ74-F1-model_v4 Universal stress protein 0.991 1 94
AF-A0A2V6CJ74-F1-model_v4 Universal stress protein 0.9705 1 94
AF-A0A3B9LCE8-F1-model_v4 Universal stress protein 0.9616 1 140
AF-A0A538PDV1-F1-model_v4 Universal stress protein 0.9601 1 112
AF-A0A1G3ZHE9-F1-model_v4 Universal stress protein UspA 0.9589 1 114

Map