F474286

General Info

Members Datasets Scaffolds Average Seq Length
673 255 1346 460

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10045040|Ga0070681_100450403
Length 518
Sequence MTIDLGTPMVAEVAVFGLMVLVLFVGLLRKPPVPIGPTFEPRIPDPGSRPSTRSGRPEALEGRIPDSGHASAAGWITLIGLLVTFVLMFFARDGATLLGGSFVNDSLAIFSKKLFVAAAALSVLASLTLRNSSFRRRAAEYHFVLLASVLGMMVLASARDLILLFVSFELMSIPLYVLTGFVKRDGAAPEAALKFFLVGTASSAVIVYGISFIIGVTGTTDLSAIPSALVANDSIMLLGMTLLLAGLGFKIAAFPFHMWAPDTYEAASTPFVAWLAVAPKAAGFIAIIRLYVEGVGASTLVWMPVVAAVAGMTIITGNLMAIPQHNIKRLLAYSGIAHIGYMLIGLAALTSNGIAMVLFYLLAYMFGNMGAFFVVEAVARSEQSDEIDAYKGLAQRSPVLALAMLVFLLSLGGIPFVAGFWAKLYVFLAAVDRGMYGLVFLGAVLTVVALYXXXXVARRMYIEAPVRTERVHVPALLGVAIFICIAGVVGMGAWPGPWVNATQRAAASVFAASAASIK

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 0.45
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10045040 3300005458 Bacteria 4415
2 JGI24746J21847_1000779 3300001977 Bacteria 4908
3 JGI25406J46586_10000120 3300003203 Bacteria 34396
4 JGI25406J46586_10002349 3300003203 Bacteria 8944
5 Ga0065714_10071211 3300005288 Bacteria 3637
6 Ga0065712_10002361 3300005290 Bacteria 8212
7 Ga0065712_10068087 3300005290 Bacteria 15101
8 Ga0065712_10081843 3300005290 Bacteria 2960
9 Ga0065715_10002974 3300005293 Bacteria 4577
10 Ga0065715_10005150 3300005293 Bacteria 6305
11 Ga0065707_10002595 3300005295 Bacteria 6960
12 Ga0065707_10136991 3300005295 Bacteria 1826
13 Ga0070676_10002255 3300005328 Bacteria 9831
14 Ga0070676_10037385 3300005328 Unclassified 2800
15 Ga0070683_100001902 3300005329 Bacteria 16331
16 Ga0070683_100145792 3300005329 Unclassified 2243
17 Ga0070690_100003636 3300005330 Bacteria 8490
18 Ga0070690_100034765 3300005330 Unclassified 3159
19 Ga0070670_100004978 3300005331 Bacteria 11177
20 Ga0070670_100097543 3300005331 Bacteria 2528
21 Ga0070670_100226873 3300005331 Bacteria 1625
22 Ga0068869_100001496 3300005334 Bacteria 13845
23 Ga0068869_100002011 3300005334 Bacteria 12219
24 Ga0068869_100010384 3300005334 Bacteria 6073
25 Ga0068869_100063299 3300005334 Bacteria 2717
26 Ga0070666_10004927 3300005335 Bacteria 8165
27 Ga0070666_10035192 3300005335 Bacteria 3321
28 Ga0070680_100002109 3300005336 Bacteria 14680
29 Ga0070682_100000365 3300005337 Bacteria 30423
30 Ga0068868_100078630 3300005338 Bacteria 2641
31 Ga0068868_100082588 3300005338 Bacteria 2577
32 Ga0070660_100018271 3300005339 Bacteria 5122
33 Ga0070689_100006307 3300005340 Bacteria 8192
34 Ga0070689_100016519 3300005340 Bacteria 5401
35 Ga0070689_100026025 3300005340 Bacteria 4401
36 Ga0070691_10014935 3300005341 Bacteria 3566
37 Ga0070691_10018250 3300005341 Bacteria 3234
38 Ga0070691_10022284 3300005341 Bacteria 2938
39 Ga0070687_100000488 3300005343 Bacteria 13208
40 Ga0070687_100005532 3300005343 Bacteria 5122
41 Ga0070687_100012791 3300005343 Bacteria 3718
42 Ga0070687_100013316 3300005343 Bacteria 3662
43 Ga0070661_100002514 3300005344 Bacteria 12556
44 Ga0070661_100006598 3300005344 Bacteria 8003
45 Ga0070661_100015343 3300005344 Bacteria 5407
46 Ga0070692_10001897 3300005345 Bacteria 7888
47 Ga0070668_100001246 3300005347 Bacteria 18156
48 Ga0070668_100057079 3300005347 Unclassified 3016
49 Ga0070668_100214214 3300005347 Bacteria 1586
50 Ga0070669_100105021 3300005353 Bacteria 2136
51 Ga0070675_100003563 3300005354 Bacteria 11830
52 Ga0070675_100007060 3300005354 Bacteria 8639
53 Ga0070675_100012585 3300005354 Bacteria 6634
54 Ga0070675_100131236 3300005354 Bacteria 2135
55 Ga0070675_100167651 3300005354 Unclassified 1892
56 Ga0070674_100000988 3300005356 Bacteria 14828
57 Ga0070674_100010071 3300005356 Bacteria 5693
58 Ga0070674_100017360 3300005356 Bacteria 4525
59 Ga0070673_100004953 3300005364 Bacteria 8487
60 Ga0070673_100081131 3300005364 Unclassified 2630
61 Ga0070688_100099993 3300005365 Unclassified 1910
62 Ga0070659_100001505 3300005366 Bacteria 16800
63 Ga0070659_100002251 3300005366 Bacteria 13737
64 Ga0070659_100061265 3300005366 Bacteria 2974
65 Ga0070667_100111783 3300005367 Bacteria 2370
66 Ga0070703_10003809 3300005406 Bacteria 4268
67 Ga0070701_10026049 3300005438 Unclassified 2847
68 Ga0070700_100009311 3300005441 Bacteria 5383
69 Ga0070700_100039984 3300005441 Bacteria 2868
70 Ga0070700_100182237 3300005441 Bacteria 1462
71 Ga0070694_100000345 3300005444 Bacteria 24871
72 Ga0070694_100006735 3300005444 Bacteria 6979
73 Ga0070694_100011586 3300005444 Bacteria 5461
74 Ga0070694_100015289 3300005444 Bacteria 4816
75 Ga0070694_100026765 3300005444 Bacteria 3740
76 Ga0070694_100026892 3300005444 Bacteria 3733
77 Ga0070694_100073558 3300005444 Bacteria 2361
78 Ga0070708_100040319 3300005445 Bacteria 4089
79 Ga0070708_100046013 3300005445 Bacteria 3848
80 Ga0070708_100071343 3300005445 Bacteria 3127
81 Ga0070708_100085474 3300005445 Bacteria 2863
82 Ga0070663_100001711 3300005455 Bacteria 12179
83 Ga0070663_100051172 3300005455 Bacteria 2941
84 Ga0070678_100053178 3300005456 Bacteria 2944
85 Ga0070662_100026986 3300005457 Bacteria 3982
86 Ga0070662_100027076 3300005457 Bacteria 3976
87 Ga0070662_100055135 3300005457 Bacteria 2883
88 Ga0070662_100059219 3300005457 Bacteria 2790
89 Ga0068867_100006014 3300005459 Bacteria 8602
90 Ga0068867_100007131 3300005459 Bacteria 7897
91 Ga0068867_100052159 3300005459 Bacteria 3018
92 Ga0070685_10000264 3300005466 Bacteria 33696
93 Ga0070706_100003928 3300005467 Bacteria 14483
94 Ga0070706_100006413 3300005467 Bacteria 11121
95 Ga0070706_100039995 3300005467 Bacteria 4328
96 Ga0070706_100042411 3300005467 Bacteria 4203
97 Ga0070706_100061910 3300005467 Unclassified 3456
98 Ga0070706_100137563 3300005467 Bacteria 2279
99 Ga0070707_100001862 3300005468 Bacteria 20267
100 Ga0070707_100010381 3300005468 Bacteria 8670
101 Ga0070707_100149336 3300005468 Unclassified 2275
102 Ga0070698_100007713 3300005471 Bacteria 11640
103 Ga0070698_100016413 3300005471 Bacteria 7815
104 Ga0070698_100049291 3300005471 Bacteria 4299
105 Ga0070698_100296282 3300005471 Unclassified 1548
106 Ga0070699_100000712 3300005518 Bacteria 30836
107 Ga0070699_100003941 3300005518 Bacteria 13112
108 Ga0070699_100005248 3300005518 Bacteria 11376
109 Ga0070699_100008791 3300005518 Bacteria 8753
110 Ga0070699_100026173 3300005518 Bacteria 5032
111 Ga0070699_100035333 3300005518 Bacteria 4320
112 Ga0070699_100038913 3300005518 Bacteria 4117
113 Ga0070699_100068977 3300005518 Bacteria 3072
114 Ga0070684_100046398 3300005535 Bacteria 3765
115 Ga0070697_100042024 3300005536 Bacteria 3700
116 Ga0070697_100054351 3300005536 Bacteria 3255
117 Ga0068853_100010976 3300005539 Bacteria 7342
118 Ga0068853_100015316 3300005539 Bacteria 6301
119 Ga0068853_100144928 3300005539 Bacteria 2134
120 Ga0070672_100002079 3300005543 Bacteria 12608
121 Ga0070672_100019254 3300005543 Bacteria 4951
122 Ga0070672_100153097 3300005543 Bacteria 1908
123 Ga0070695_100000112 3300005545 Bacteria 36134
124 Ga0070695_100029138 3300005545 Bacteria 3429
125 Ga0070695_100042978 3300005545 Bacteria 2872
126 Ga0070696_100004871 3300005546 Bacteria 8970
127 Ga0070696_100017675 3300005546 Bacteria 4816
128 Ga0070696_100021801 3300005546 Bacteria 4345
129 Ga0070696_100038365 3300005546 Bacteria 3306
130 Ga0070696_100040971 3300005546 Bacteria 3199
131 Ga0070696_100043193 3300005546 Bacteria 3118
132 Ga0070696_100050366 3300005546 Bacteria 2895
133 Ga0070693_100000189 3300005547 Bacteria 28531
134 Ga0070693_100008457 3300005547 Bacteria 5076
135 Ga0070693_100009077 3300005547 Bacteria 4936
136 Ga0070704_100056342 3300005549 Bacteria 2791
137 Ga0070704_100067970 3300005549 Bacteria 2575
138 Ga0070704_100161853 3300005549 Bacteria 1771
139 Ga0068855_100000331 3300005563 Bacteria 58972
140 Ga0068855_100015855 3300005563 Bacteria 9066
141 Ga0070664_100001341 3300005564 Bacteria 19628
142 Ga0070664_100006931 3300005564 Bacteria 9131
143 Ga0070664_100064670 3300005564 Bacteria 3120
144 Ga0068857_100000030 3300005577 Bacteria 76781
145 Ga0068857_100030695 3300005577 Bacteria 4747
146 Ga0068857_100113601 3300005577 Bacteria 2435
147 Ga0068857_100231573 3300005577 Bacteria 1690
148 Ga0068856_100000923 3300005614 Bacteria 31463
149 Ga0068852_100000767 3300005616 Bacteria 21142
150 Ga0068859_100273956 3300005617 Bacteria 1780
151 Ga0068864_100017773 3300005618 Bacteria 5932
152 Ga0068864_100086867 3300005618 Unclassified 2752
153 Ga0068866_10000083 3300005718 Bacteria 38582
154 Ga0068866_10054606 3300005718 Bacteria 2047
155 Ga0068861_100000212 3300005719 Bacteria 31389
156 Ga0068861_100016033 3300005719 Bacteria 5291
157 Ga0068861_100188320 3300005719 Bacteria 1723
158 Ga0068851_10038131 3300005834 Bacteria 2410
159 Ga0068870_10000633 3300005840 Bacteria 13428
160 Ga0068870_10002979 3300005840 Bacteria 7138
161 Ga0068870_10005126 3300005840 Bacteria 5702
162 Ga0068870_10011935 3300005840 Bacteria 4044
163 Ga0068870_10024726 3300005840 Bacteria 2973
164 Ga0068863_100004918 3300005841 Bacteria 13169
165 Ga0068863_100030248 3300005841 Bacteria 5172
166 Ga0068863_100046577 3300005841 Bacteria 4116
167 Ga0068863_100072573 3300005841 Unclassified 3256
168 Ga0068858_100209763 3300005842 Bacteria 1843
169 Ga0068860_100031285 3300005843 Bacteria 5116
170 Ga0068860_100042597 3300005843 Bacteria 4334
171 Ga0068860_100129469 3300005843 Bacteria 2421
172 Ga0068862_100002125 3300005844 Bacteria 17860
173 Ga0068862_100008232 3300005844 Bacteria 8626
174 Ga0068862_100011482 3300005844 Bacteria 7312
175 Ga0068862_100016417 3300005844 Bacteria 6161
176 Ga0068862_100093277 3300005844 Bacteria 2625
177 Ga0081455_10000868 3300005937 Bacteria 39013
178 Ga0081538_10003260 3300005981 Bacteria 15419
179 Ga0081540_1000146 3300005983 Bacteria 72830
180 Ga0081540_1010521 3300005983 Bacteria 6252
181 Ga0081539_10000024 3300005985 Bacteria 354702
182 Ga0081539_10000096 3300005985 Bacteria 204059
183 Ga0081539_10002353 3300005985 Bacteria 27164
184 Ga0075365_10022819 3300006038 Bacteria 3927
185 Ga0075364_10015737 3300006051 Bacteria 4695
186 Ga0070716_100056184 3300006173 Bacteria 2256
187 Ga0070712_100003836 3300006175 Bacteria 9254
188 Ga0075362_10000233 3300006177 Bacteria 15482
189 Ga0075366_10007412 3300006195 Bacteria 6059
190 Ga0075366_10009293 3300006195 Bacteria 5490
191 Ga0075370_10066752 3300006353 Bacteria 2052
192 Ga0068871_100018934 3300006358 Bacteria 5247
193 Ga0068871_100152573 3300006358 Bacteria 1971
194 Ga0068871_100167268 3300006358 Bacteria 1883
195 Ga0075428_100004648 3300006844 Bacteria 15196
196 Ga0075428_100015898 3300006844 Bacteria 8327
197 Ga0075428_100059134 3300006844 Bacteria 4197
198 Ga0075428_100168638 3300006844 Bacteria 2374
199 Ga0075430_100007192 3300006846 Bacteria 9388
200 Ga0075430_100019149 3300006846 Bacteria 5821
201 Ga0075430_100039626 3300006846 Bacteria 3988
202 Ga0075430_100045970 3300006846 Bacteria 3687
203 Ga0075431_100000082 3300006847 Bacteria 56660
204 Ga0075431_100000486 3300006847 Bacteria 32971
205 Ga0075431_100001687 3300006847 Bacteria 20728
206 Ga0075431_100022095 3300006847 Bacteria 6507
207 Ga0075431_100040956 3300006847 Bacteria 4775
208 Ga0075431_100094758 3300006847 Unclassified 3081
209 Ga0075431_100183036 3300006847 Bacteria 2150
210 Ga0075431_100188110 3300006847 Bacteria 2116
211 Ga0075433_10000427 3300006852 Bacteria 27010
212 Ga0075433_10000839 3300006852 Bacteria 21522
213 Ga0075433_10002893 3300006852 Bacteria 13158
214 Ga0075433_10005550 3300006852 Bacteria 9906
215 Ga0075433_10015829 3300006852 Bacteria 6200
216 Ga0075433_10051244 3300006852 Bacteria 3594
217 Ga0075433_10087738 3300006852 Bacteria 2748
218 Ga0075433_10132597 3300006852 Unclassified 2214
219 Ga0075434_100000180 3300006871 Bacteria 41040
220 Ga0075434_100001347 3300006871 Bacteria 20612
221 Ga0075434_100010601 3300006871 Bacteria 8647
222 Ga0075434_100022413 3300006871 Bacteria 6152
223 Ga0075434_100040271 3300006871 Bacteria 4627
224 Ga0075434_100060934 3300006871 Bacteria 3753
225 Ga0075434_100066897 3300006871 Bacteria 3580
226 Ga0075434_100114253 3300006871 Unclassified 2713
227 Ga0075434_100131672 3300006871 Bacteria 2520
228 Ga0075434_100327389 3300006871 Bacteria 1553
229 Ga0075429_100002798 3300006880 Bacteria 14762
230 Ga0075429_100045702 3300006880 Bacteria 3810
231 Ga0075429_100081107 3300006880 Bacteria 2829
232 Ga0075429_100099264 3300006880 Bacteria 2540
233 Ga0068865_100159805 3300006881 Bacteria 1718
234 Ga0075436_100018788 3300006914 Bacteria 4733
235 Ga0097620_100273969 3300006931 Bacteria 1780
236 Ga0075435_100022605 3300007076 Bacteria 4851
237 Ga0075435_100039959 3300007076 Bacteria 3745
238 Ga0075435_100048550 3300007076 Bacteria 3411
239 Ga0075435_100062337 3300007076 Bacteria 3026
240 Ga0099794_10021772 3300007265 Bacteria 2915
241 Ga0099794_10046698 3300007265 Unclassified 2075
242 Ga0105240_10006182 3300009093 Bacteria 17643
243 Ga0111539_10000463 3300009094 Bacteria 51027
244 Ga0111539_10001292 3300009094 Bacteria 33417
245 Ga0111539_10001789 3300009094 Bacteria 28570
246 Ga0111539_10002439 3300009094 Bacteria 24735
247 Ga0111539_10006594 3300009094 Bacteria 14961
248 Ga0111539_10022315 3300009094 Bacteria 7779
249 Ga0111539_10031709 3300009094 Bacteria 6420
250 Ga0111539_10053095 3300009094 Bacteria 4824
251 Ga0111539_10093292 3300009094 Bacteria 3536
252 Ga0111539_10128670 3300009094 Bacteria 2966
253 Ga0111539_10207545 3300009094 Unclassified 2283
254 Ga0105245_10000233 3300009098 Bacteria 52960
255 Ga0105245_10109242 3300009098 Bacteria 2570
256 Ga0105245_10141866 3300009098 Bacteria 2263
257 Ga0105245_10283097 3300009098 Bacteria 1621
258 Ga0105247_10057589 3300009101 Bacteria 2403
259 Ga0114129_10000110 3300009147 Bacteria 81178
260 Ga0114129_10001205 3300009147 Bacteria 34320
261 Ga0114129_10001511 3300009147 Bacteria 31462
262 Ga0114129_10003221 3300009147 Bacteria 22900
263 Ga0114129_10025730 3300009147 Bacteria 8337
264 Ga0114129_10031560 3300009147 Bacteria 7488
265 Ga0114129_10061418 3300009147 Bacteria 5251
266 Ga0114129_10073338 3300009147 Bacteria 4769
267 Ga0114129_10101502 3300009147 Bacteria 3980
268 Ga0114129_10117860 3300009147 Bacteria 3657
269 Ga0114129_10127799 3300009147 Bacteria 3493
270 Ga0114129_10128039 3300009147 Bacteria 3490
271 Ga0114129_10132239 3300009147 Unclassified 3426
272 Ga0114129_10233089 3300009147 Bacteria 2479
273 Ga0114129_10385374 3300009147 Bacteria 1850
274 Ga0105241_10001410 3300009174 Bacteria 18406
275 Ga0105241_10069582 3300009174 Bacteria 2729
276 Ga0105242_10002855 3300009176 Bacteria 13538
277 Ga0105242_10007792 3300009176 Bacteria 8241
278 Ga0105242_10015305 3300009176 Bacteria 5957
279 Ga0105242_10023761 3300009176 Bacteria 4835
280 Ga0105248_10110182 3300009177 Bacteria 3104
281 Ga0105248_10323173 3300009177 Bacteria 1738
282 Ga0105237_10000549 3300009545 Bacteria 52724
283 Ga0105238_10141696 3300009551 Bacteria 2381
284 Ga0105238_10165024 3300009551 Bacteria 2190
285 Ga0105249_10008153 3300009553 Bacteria 9132
286 Ga0105239_10071671 3300010375 Bacteria 3807
287 Ga0105246_10028242 3300011119 Bacteria 3684
288 Ga0157373_10069753 3300013100 Bacteria 2484
289 Ga0157369_10017116 3300013105 Bacteria 8146
290 Ga0157374_10223928 3300013296 Unclassified 1847
291 Ga0157378_10163632 3300013297 Bacteria 2082
292 Ga0163162_10022241 3300013306 Bacteria 6249
293 Ga0163162_10055520 3300013306 Bacteria 3988
294 Ga0157372_10008010 3300013307 Bacteria 11239
295 Ga0157375_10256242 3300013308 Bacteria 1911
296 Ga0157375_10268348 3300013308 Unclassified 1868
297 Ga0157380_10001243 3300014326 Bacteria 16534
298 Ga0157380_10003226 3300014326 Bacteria 11146
299 Ga0157377_10008351 3300014745 Bacteria 5047
300 Ga0157379_10000876 3300014968 Bacteria 24372
301 Ga0157376_10000809 3300014969 Bacteria 20511
302 Ga0163161_10015178 3300017792 Bacteria 5367
303 Ga0207697_10001435 3300025315 Bacteria 13051
304 Ga0207697_10004936 3300025315 Bacteria 6287
305 Ga0207656_10008015 3300025321 Bacteria 3873
306 Ga0207653_10013704 3300025885 Bacteria 2539
307 Ga0207682_10000953 3300025893 Bacteria 13423
308 Ga0207682_10016474 3300025893 Bacteria 2883
309 Ga0207710_10024134 3300025900 Bacteria 2617
310 Ga0207688_10001607 3300025901 Bacteria 11929
311 Ga0207688_10027388 3300025901 Bacteria 3135
312 Ga0207645_10000043 3300025907 Bacteria 85557
313 Ga0207645_10000400 3300025907 Bacteria 35898
314 Ga0207645_10016127 3300025907 Bacteria 4948
315 Ga0207645_10028198 3300025907 Bacteria 3625
316 Ga0207643_10000424 3300025908 Bacteria 27864
317 Ga0207643_10000489 3300025908 Bacteria 25451
318 Ga0207643_10000732 3300025908 Bacteria 20161
319 Ga0207643_10015996 3300025908 Bacteria 4086
320 Ga0207643_10024053 3300025908 Bacteria 3362
321 Ga0207684_10003777 3300025910 Bacteria 14629
322 Ga0207684_10011947 3300025910 Bacteria 7564
323 Ga0207684_10023037 3300025910 Bacteria 5319
324 Ga0207684_10043927 3300025910 Bacteria 3789
325 Ga0207684_10058826 3300025910 Bacteria 3262
326 Ga0207684_10113773 3300025910 Bacteria 2317
327 Ga0207654_10010692 3300025911 Bacteria 4674
328 Ga0207707_10000116 3300025912 Bacteria 81364
329 Ga0207707_10109336 3300025912 Bacteria 2417
330 Ga0207671_10004294 3300025914 Bacteria 13705
331 Ga0207693_10006943 3300025915 Bacteria 9356
332 Ga0207663_10018254 3300025916 Bacteria 3927
333 Ga0207662_10000043 3300025918 Bacteria 56727
334 Ga0207662_10000891 3300025918 Bacteria 13817
335 Ga0207662_10003651 3300025918 Bacteria 7968
336 Ga0207662_10003719 3300025918 Bacteria 7906
337 Ga0207662_10007198 3300025918 Bacteria 6051
338 Ga0207657_10000211 3300025919 Bacteria 60392
339 Ga0207657_10001235 3300025919 Bacteria 27312
340 Ga0207649_10002015 3300025920 Bacteria 11561
341 Ga0207649_10006395 3300025920 Bacteria 6398
342 Ga0207652_10003841 3300025921 Bacteria 12319
343 Ga0207646_10006951 3300025922 Bacteria 11608
344 Ga0207646_10027940 3300025922 Bacteria 5142
345 Ga0207646_10062784 3300025922 Bacteria 3316
346 Ga0207646_10123365 3300025922 Unclassified 2329
347 Ga0207681_10008695 3300025923 Bacteria 6201
348 Ga0207681_10011598 3300025923 Bacteria 5415
349 Ga0207694_10067456 3300025924 Bacteria 2792
350 Ga0207694_10103230 3300025924 Bacteria 2261
351 Ga0207650_10086341 3300025925 Bacteria 2389
352 Ga0207650_10135932 3300025925 Bacteria 1928
353 Ga0207659_10000351 3300025926 Bacteria 27522
354 Ga0207659_10002998 3300025926 Bacteria 10064
355 Ga0207659_10031425 3300025926 Bacteria 3634
356 Ga0207659_10166067 3300025926 Unclassified 1737
357 Ga0207659_10187184 3300025926 Bacteria 1645
358 Ga0207687_10014744 3300025927 Bacteria 5118
359 Ga0207687_10064136 3300025927 Bacteria 2604
360 Ga0207687_10079611 3300025927 Bacteria 2363
361 Ga0207690_10000823 3300025932 Bacteria 19912
362 Ga0207690_10001495 3300025932 Bacteria 14606
363 Ga0207706_10000162 3300025933 Bacteria 74975
364 Ga0207706_10004021 3300025933 Bacteria 13914
365 Ga0207706_10017429 3300025933 Bacteria 6469
366 Ga0207706_10020893 3300025933 Bacteria 5878
367 Ga0207706_10041882 3300025933 Bacteria 4058
368 Ga0207706_10159902 3300025933 Bacteria 1980
369 Ga0207686_10064513 3300025934 Bacteria 2332
370 Ga0207709_10074430 3300025935 Bacteria 2167
371 Ga0207709_10116300 3300025935 Bacteria 1798
372 Ga0207670_10048949 3300025936 Bacteria 2824
373 Ga0207670_10061086 3300025936 Unclassified 2570
374 Ga0207704_10071650 3300025938 Unclassified 2200
375 Ga0207665_10007130 3300025939 Bacteria 7399
376 Ga0207691_10000053 3300025940 Bacteria 91814
377 Ga0207691_10007695 3300025940 Bacteria 10370
378 Ga0207691_10010524 3300025940 Bacteria 8877
379 Ga0207691_10063428 3300025940 Bacteria 3351
380 Ga0207711_10000276 3300025941 Bacteria 55530
381 Ga0207711_10105861 3300025941 Bacteria 2495
382 Ga0207711_10247569 3300025941 Bacteria 1636
383 Ga0207689_10000026 3300025942 Bacteria 103610
384 Ga0207689_10000201 3300025942 Bacteria 52554
385 Ga0207689_10005325 3300025942 Bacteria 11533
386 Ga0207689_10006142 3300025942 Bacteria 10632
387 Ga0207689_10057840 3300025942 Bacteria 3189
388 Ga0207689_10111208 3300025942 Bacteria 2251
389 Ga0207661_10031217 3300025944 Bacteria 4112
390 Ga0207661_10031757 3300025944 Unclassified 4084
391 Ga0207679_10000449 3300025945 Bacteria 29072
392 Ga0207679_10006771 3300025945 Bacteria 7260
393 Ga0207667_10002107 3300025949 Bacteria 24946
394 Ga0207651_10002705 3300025960 Bacteria 8496
395 Ga0207651_10073549 3300025960 Bacteria 2430
396 Ga0207651_10102406 3300025960 Unclassified 2128
397 Ga0207651_10166804 3300025960 Bacteria 1732
398 Ga0207712_10066798 3300025961 Bacteria 2572
399 Ga0207668_10037148 3300025972 Bacteria 3258
400 Ga0207668_10046780 3300025972 Bacteria 2958
401 Ga0207640_10099415 3300025981 Bacteria 2036
402 Ga0207658_10001466 3300025986 Bacteria 18396
403 Ga0207658_10066628 3300025986 Unclassified 2709
404 Ga0207677_10039272 3300026023 Bacteria 3111
405 Ga0207677_10145629 3300026023 Bacteria 1820
406 Ga0207703_10000059 3300026035 Bacteria 134931
407 Ga0207703_10016319 3300026035 Bacteria 5789
408 Ga0207639_10004331 3300026041 Bacteria 9569
409 Ga0207639_10032200 3300026041 Bacteria 3858
410 Ga0207639_10119734 3300026041 Bacteria 2161
411 Ga0207678_10004271 3300026067 Bacteria 12812
412 Ga0207708_10012567 3300026075 Bacteria 6313
413 Ga0207708_10015376 3300026075 Bacteria 5740
414 Ga0207702_10001143 3300026078 Bacteria 27129
415 Ga0207641_10012977 3300026088 Bacteria 6835
416 Ga0207641_10025232 3300026088 Bacteria 4902
417 Ga0207648_10001530 3300026089 Bacteria 25466
418 Ga0207648_10003683 3300026089 Bacteria 16035
419 Ga0207648_10012060 3300026089 Bacteria 8105
420 Ga0207648_10012239 3300026089 Bacteria 8034
421 Ga0207648_10039622 3300026089 Bacteria 4143
422 Ga0207674_10000951 3300026116 Bacteria 37804
423 Ga0207674_10001221 3300026116 Bacteria 33487
424 Ga0207674_10121570 3300026116 Bacteria 2578
425 Ga0207674_10228190 3300026116 Bacteria 1810
426 Ga0207675_100000233 3300026118 Bacteria 52659
427 Ga0207675_100002501 3300026118 Bacteria 18185
428 Ga0207675_100016025 3300026118 Bacteria 6997
429 Ga0207675_100069969 3300026118 Bacteria 3280
430 Ga0207675_100236249 3300026118 Bacteria 1765
431 Ga0207683_10000624 3300026121 Bacteria 32521
432 Ga0207683_10007833 3300026121 Bacteria 9145
433 Ga0207683_10045698 3300026121 Bacteria 3830
434 Ga0209969_1001359 3300027360 Bacteria 3358
435 Ga0209984_1000634 3300027424 Bacteria 3780
436 Ga0209968_1000573 3300027526 Bacteria 5687
437 Ga0209970_1000407 3300027614 Bacteria 7263
438 Ga0209971_1000037 3300027682 Bacteria 45920
439 Ga0209966_1000378 3300027695 Bacteria 13523
440 Ga0209998_10000042 3300027717 Bacteria 51743
441 Ga0209974_10000465 3300027876 Bacteria 13444
442 Ga0207428_10000027 3300027907 Bacteria 250186
443 Ga0207428_10000245 3300027907 Bacteria 74009
444 Ga0207428_10000849 3300027907 Bacteria 34443
445 Ga0207428_10005064 3300027907 Bacteria 12382
446 Ga0207428_10007736 3300027907 Bacteria 9776
447 Ga0207428_10008043 3300027907 Bacteria 9569
448 Ga0207428_10023843 3300027907 Bacteria 5140
449 Ga0207428_10042406 3300027907 Bacteria 3680
450 Ga0207428_10188618 3300027907 Bacteria 1555
451 Ga0268266_10001681 3300028379 Bacteria 25466
452 Ga0268265_10005618 3300028380 Bacteria 8563
453 Ga0268265_10022805 3300028380 Unclassified 4404
454 Ga0268265_10061875 3300028380 Bacteria 2874
455 Ga0268264_10003233 3300028381 Bacteria 14106
456 Ga0307408_100058337 3300031548 Bacteria 2806
457 Ga0307405_10039995 3300031731 Bacteria 2838
458 Ga0307405_10074946 3300031731 Bacteria 2190
459 Ga0307416_100050470 3300032002 Bacteria 3316
460 Ga0307416_100122713 3300032002 Bacteria 2320
461 Ga0373940_0001611 3300035088 Bacteria 4141
462 Ga0373940_0013102 3300035088 Bacteria 1998
463 Ga0373949_0007232 3300035090 Bacteria 2432
464 Ga0373939_0007541 3300035114 Bacteria 2644
465 Ga0373939_0016739 3300035114 Bacteria 1937
466 Ga0373961_0007741 3300035241 Bacteria 2603
467 Ga0373933_0106003 3300035724 Bacteria 1749
468 Ga0373925_0092635 3300037068 Bacteria 2312
469 Ga0395900_0002273 3300037418 Bacteria 21347
470 Ga0395898_0005721 3300037466 Bacteria 13392
471 Ga0395901_0021074 3300038443 Bacteria 6676
472 Ga0439448_0005919 3300042005 Bacteria 3498
473 Ga0439435_0002235 3300042436 Bacteria 3796
474 Ga0439435_0004587 3300042436 Bacteria 2989
475 Ga0439459_0000110 3300042438 Bacteria 7701
476 Ga0439464_0000830 3300042439 Bacteria 6826
477 Ga0439460_0000197 3300042461 Bacteria 11816
478 Ga0451577_0002796 3300042876 Bacteria 20141
479 Ga0451577_0006253 3300042876 Bacteria 11929
480 Ga0451577_0053635 3300042876 Bacteria 3599
481 Ga0451577_0068274 3300042876 Bacteria 3170
482 Ga0439440_0009806 3300042993 Bacteria 1989
483 Ga0453683_0026123 3300044673 Bacteria 3708
484 Ga0453683_0050488 3300044673 Bacteria 2606
485 Ga0453684_0023625 3300044712 Bacteria 9036
486 Ga0453684_0058416 3300044712 Bacteria 4983
487 Ga0453684_0118568 3300044712 Bacteria 3201
488 Ga0453684_0272065 3300044712 Bacteria 1935
489 Ga0451576_0004364 3300045051 Bacteria 18442
490 Ga0451576_0005141 3300045051 Bacteria 16570
491 Ga0451576_0005764 3300045051 Bacteria 15422
492 Ga0451576_0019775 3300045051 Bacteria 7347
493 Ga0451576_0026087 3300045051 Bacteria 6287
494 Ga0451576_0045920 3300045051 Bacteria 4599
495 Ga0451576_0065829 3300045051 Bacteria 3773
496 Ga0451576_0084972 3300045051 Unclassified 3291
497 Ga0451576_0181174 3300045051 Bacteria 2199
498 Ga0495603_0017434 3300046455 Bacteria 4345
499 Ga0495629_0016857 3300046459 Bacteria 5243
500 Ga0495580_0000727 3300046472 Bacteria 28206
501 Ga0495628_0055710 3300046516 Bacteria 3114
502 Ga0495633_0025371 3300046558 Bacteria 2919
503 Ga0495667_0000367 3300046559 Bacteria 28503
504 Ga0495656_0064340 3300046615 Unclassified 1610
505 Ga0495659_0003220 3300046664 Bacteria 5230
506 Ga0495659_0019150 3300046664 Bacteria 2289
507 Ga0495669_0030073 3300046684 Bacteria 2384
508 Ga0495674_0088115 3300047319 Bacteria 2655
509 Ga0496106_0000637 3300048909 Bacteria 25174
510 Ga0496112_0012711 3300048915 Bacteria 7742
511 Ga0496112_0073778 3300048915 Bacteria 3373
512 Ga0501031_0023404 3300049568 Bacteria 4027
513 Ga0501033_0025025 3300049570 Bacteria 4498
514 Ga0501033_0106442 3300049570 Unclassified 2043
515 Ga0501034_0006093 3300049571 Bacteria 13017
516 Ga0501034_0190474 3300049571 Bacteria 2013
517 Ga0501036_0000997 3300049572 Bacteria 21389
518 Ga0501036_0050451 3300049572 Unclassified 3524
519 Ga0501037_0086148 3300049573 Bacteria 2274
520 Ga0501038_0000877 3300049574 Bacteria 26657
521 Ga0501038_0054489 3300049574 Bacteria 3440
522 Ga0501039_0000306 3300049575 Bacteria 34767
523 Ga0501039_0012641 3300049575 Bacteria 6453
524 Ga0501039_0072161 3300049575 Bacteria 2683
525 Ga0501040_0000832 3300049576 Bacteria 19300
526 Ga0501040_0002340 3300049576 Bacteria 12167
527 Ga0501040_0015254 3300049576 Bacteria 5078
528 Ga0501040_0047905 3300049576 Bacteria 2920
529 Ga0501040_0156538 3300049576 Bacteria 1609
530 Ga0501041_0006125 3300049577 Bacteria 7033
531 Ga0501041_0006839 3300049577 Bacteria 6683
532 Ga0501041_0013389 3300049577 Bacteria 4862
533 Ga0501042_0006874 3300049578 Bacteria 7423
534 Ga0501042_0014338 3300049578 Bacteria 5409
535 Ga0501042_0034409 3300049578 Bacteria 3593
536 Ga0501042_0157396 3300049578 Bacteria 1639
537 Ga0501046_0033137 3300049580 Bacteria 4177
538 Ga0501046_0075277 3300049580 Bacteria 2617
539 Ga0501046_0114920 3300049580 Bacteria 2053
540 Ga0501047_0109507 3300049581 Bacteria 2645
541 Ga0501047_0221891 3300049581 Bacteria 1746
542 Ga0501048_0001234 3300049582 Bacteria 19386
543 Ga0501048_0024994 3300049582 Bacteria 4357
544 Ga0501048_0083670 3300049582 Bacteria 2250
545 Ga0501068_0001222 3300049584 Bacteria 13619
546 Ga0501068_0031832 3300049584 Bacteria 3134
547 Ga0501070_0013626 3300049586 Bacteria 6852
548 Ga0501072_0002438 3300049588 Bacteria 13931
549 Ga0501072_0027727 3300049588 Bacteria 4418
550 Ga0501072_0035451 3300049588 Bacteria 3908
551 Ga0501072_0078538 3300049588 Bacteria 2613
552 Ga0501072_0132229 3300049588 Bacteria 1989
553 Ga0501073_0106623 3300049589 Bacteria 1944
554 Ga0501074_0000224 3300049590 Bacteria 31333
555 Ga0501074_0032375 3300049590 Bacteria 3787
556 Ga0501074_0164172 3300049590 Bacteria 1586
557 Ga0501075_0001171 3300049591 Bacteria 16961
558 Ga0501075_0006351 3300049591 Bacteria 8129
559 Ga0501075_0007121 3300049591 Bacteria 7737
560 Ga0501075_0043634 3300049591 Bacteria 3363
561 Ga0501075_0055523 3300049591 Bacteria 2980
562 Ga0501075_0093010 3300049591 Bacteria 2289
563 Ga0501076_0001587 3300049592 Bacteria 15287
564 Ga0501076_0029084 3300049592 Bacteria 4295
565 Ga0501076_0069071 3300049592 Bacteria 2823
566 Ga0501076_0118503 3300049592 Bacteria 2143
567 Ga0501077_0009200 3300049593 Bacteria 6134
568 Ga0501077_0009822 3300049593 Bacteria 5953
569 Ga0501077_0079258 3300049593 Unclassified 2081
570 Ga0501077_0080278 3300049593 Bacteria 2067
571 Ga0501079_0001398 3300049741 Bacteria 17010
572 Ga0501079_0011415 3300049741 Bacteria 6780
573 Ga0501079_0012871 3300049741 Bacteria 6386
574 Ga0501079_0033516 3300049741 Bacteria 3951
575 Ga0501079_0056218 3300049741 Bacteria 3036
576 Ga0501079_0085288 3300049741 Bacteria 2444
577 Ga0501080_0003252 3300049742 Bacteria 14335
578 Ga0501080_0162053 3300049742 Bacteria 2065
579 Ga0501081_0003382 3300049743 Bacteria 10153
580 Ga0501081_0005258 3300049743 Bacteria 8341
581 Ga0501081_0011638 3300049743 Bacteria 5758
582 Ga0501081_0013942 3300049743 Bacteria 5292
583 Ga0501081_0028626 3300049743 Bacteria 3760
584 Ga0501081_0055063 3300049743 Bacteria 2748
585 Ga0501081_0151553 3300049743 Unclassified 1666
586 Ga0501083_0014659 3300049744 Bacteria 5480
587 Ga0501045_0001152 3300049824 Bacteria 17508
588 Ga0501045_0018435 3300049824 Bacteria 4964
589 Ga0501045_0019119 3300049824 Bacteria 4880
590 Ga0501045_0035209 3300049824 Bacteria 3634
591 Ga0501045_0039549 3300049824 Bacteria 3432
592 Ga0501045_0230241 3300049824 Bacteria 1380
593 nmdc:mga03683_2028_c1 3300050489 Bacteria 6198
594 nmdc:mga00v17_2153_c1 3300050491 Bacteria 10125
595 nmdc:mga0k408_19033_c1 3300050493 Bacteria 3834
596 nmdc:mga0k408_7123_c1 3300050493 Bacteria 5975
597 nmdc:mga05p37_11414_c1 3300050507 Bacteria 10575
598 nmdc:mga05p37_14939_c1 3300050507 Bacteria 6685
599 nmdc:mga05p37_174216_c1 3300050507 Unclassified 2622
600 nmdc:mga05p37_183619_c1 3300050507 Bacteria 2543
601 nmdc:mga05p37_19057_c1 3300050507 Bacteria 8299
602 nmdc:mga05p37_208119_c1 3300050507 Bacteria 2365
603 nmdc:mga05p37_250013_c1 3300050507 Bacteria 2127
604 nmdc:mga05p37_67675_c2 3300050507 Bacteria 1529
605 nmdc:mga05p37_70532_c1 3300050507 Bacteria 4298
606 nmdc:mga05p37_7406_c1 3300050507 Bacteria 12949
607 nmdc:mga05p37_7480_c1 3300050507 Bacteria 12877
608 nmdc:mga09592_17484_c1 3300050508 Bacteria 5875
609 nmdc:mga09592_190943_c1 3300050508 Bacteria 1773
610 nmdc:mga09592_244269_c1 3300050508 Bacteria 1556
611 nmdc:mga09592_28662_c1 3300050508 Bacteria 3669
612 nmdc:mga09592_3878_c1 3300050508 Bacteria 12046
613 nmdc:mga09592_48767_c1 3300050508 Bacteria 3570
614 nmdc:mga0qj67_22405_c1 3300050509 Bacteria 4853
615 nmdc:mga0qj67_54944_c1 3300050509 Bacteria 3154
616 nmdc:mga0qj67_7809_c1 3300050509 Bacteria 7907
617 nmdc:mga06r32_1744_c1 3300050510 Bacteria 19568
618 nmdc:mga06r32_174880_c1 3300050510 Bacteria 2131
619 nmdc:mga06r32_39458_c1 3300050510 Bacteria 4480
620 nmdc:mga06r32_71500_c1 3300050510 Bacteria 3357
621 nmdc:mga06r32_7977_c1 3300050510 Bacteria 9516
622 nmdc:mga06r32_89056_c1 3300050510 Unclassified 3013
623 nmdc:mga08y16_11754_c1 3300050511 Bacteria 9196
624 nmdc:mga08y16_1306_c1 3300050511 Bacteria 24771
625 nmdc:mga08y16_17787_c1 3300050511 Bacteria 7488
626 nmdc:mga08y16_201006_c1 3300050511 Bacteria 2065
627 nmdc:mga08y16_24924_c1 3300050511 Bacteria 6310
628 nmdc:mga08y16_2919_c1 3300050511 Bacteria 17590
629 nmdc:mga08y16_31120_c1 3300050511 Bacteria 5614
630 nmdc:mga08y16_52414_c1 3300050511 Bacteria 4269
631 nmdc:mga08y16_597_c1 3300050511 Bacteria 33660
632 nmdc:mga0n895_14004_c1 3300050512 Bacteria 7265
633 nmdc:mga0n895_1895_c1 3300050512 Bacteria 16010
634 nmdc:mga0n895_24005_c1 3300050512 Bacteria 5740
635 nmdc:mga0n895_43435_c1 3300050512 Bacteria 4380
636 nmdc:mga0n895_477_c1 3300050512 Bacteria 26935
637 nmdc:mga0n895_53201_c1 3300050512 Bacteria 3978
638 nmdc:mga0n895_57467_c1 3300050512 Bacteria 3835
639 nmdc:mga0n895_60869_c1 3300050512 Bacteria 3726
640 nmdc:mga0n895_77660_c1 3300050512 Bacteria 3303
641 nmdc:mga0n895_83684_c1 3300050512 Bacteria 3183
642 nmdc:mga0rr50_109889_c1 3300050513 Bacteria 2180
643 nmdc:mga0rr50_27543_c1 3300050513 Bacteria 3981
644 nmdc:mga0rr50_34073_c1 3300050513 Bacteria 3644
645 nmdc:mga0rr50_35406_c1 3300050513 Bacteria 3585
646 nmdc:mga0rr50_7633_c1 3300050513 Bacteria 6688
647 nmdc:mga08x19_17737_c1 3300050514 Bacteria 4359
648 nmdc:mga08x19_57107_c1 3300050514 Bacteria 2521
649 nmdc:mga0a205_11142_c1 3300050515 Bacteria 8275
650 nmdc:mga0a205_112429_c1 3300050515 Bacteria 2623
651 nmdc:mga0a205_133836_c1 3300050515 Bacteria 2380
652 nmdc:mga0a205_13783_c1 3300050515 Bacteria 7537
653 nmdc:mga0a205_139255_c1 3300050515 Unclassified 2327
654 nmdc:mga0a205_17339_c1 3300050515 Bacteria 6748
655 nmdc:mga0a205_196715_c1 3300050515 Bacteria 1907
656 nmdc:mga0a205_1991_c1 3300050515 Bacteria 17807
657 nmdc:mga0a205_227_c1 3300050515 Bacteria 39744
658 nmdc:mga0a205_58581_c1 3300050515 Bacteria 3720
659 nmdc:mga0a205_646_c1 3300050515 Bacteria 27674
660 nmdc:mga0a205_66283_c1 3300050515 Bacteria 3489
661 Ga0501084_0001523 3300054114 Bacteria 18387
662 Ga0501084_0014381 3300054114 Bacteria 6558
663 Ga0501084_0017452 3300054114 Bacteria 5967
664 Ga0501082_0000243 3300060353 Bacteria 47694
665 Ga0501082_0005963 3300060353 Bacteria 10570
666 Ga0530510_0001138 3300061734 Bacteria 17692
667 Ga0530510_0005834 3300061734 Bacteria 8533
668 Ga0530510_0006581 3300061734 Bacteria 8100
669 Ga0530510_0022799 3300061734 Bacteria 4461
670 Ga0530510_0047130 3300061734 Bacteria 3114
671 Ga0530510_0057599 3300061734 Bacteria 2808
672 Ga0530510_0099475 3300061734 Bacteria 2126
673 Ga0530510_0138480 3300061734 Bacteria 1792
674 Ga0070681_10045040
675 JGI24746J21847_1000779
676 JGI25406J46586_10000120
677 JGI25406J46586_10002349
678 Ga0065714_10071211
679 Ga0065712_10002361
680 Ga0065712_10068087
681 Ga0065712_10081843
682 Ga0065715_10002974
683 Ga0065715_10005150
684 Ga0065707_10002595
685 Ga0065707_10136991
686 Ga0070676_10002255
687 Ga0070676_10037385
688 Ga0070683_100001902
689 Ga0070683_100145792
690 Ga0070690_100003636
691 Ga0070690_100034765
692 Ga0070670_100004978
693 Ga0070670_100097543
694 Ga0070670_100226873
695 Ga0068869_100001496
696 Ga0068869_100002011
697 Ga0068869_100010384
698 Ga0068869_100063299
699 Ga0070666_10004927
700 Ga0070666_10035192
701 Ga0070680_100002109
702 Ga0070682_100000365
703 Ga0068868_100078630
704 Ga0068868_100082588
705 Ga0070660_100018271
706 Ga0070689_100006307
707 Ga0070689_100016519
708 Ga0070689_100026025
709 Ga0070691_10014935
710 Ga0070691_10018250
711 Ga0070691_10022284
712 Ga0070687_100000488
713 Ga0070687_100005532
714 Ga0070687_100012791
715 Ga0070687_100013316
716 Ga0070661_100002514
717 Ga0070661_100006598
718 Ga0070661_100015343
719 Ga0070692_10001897
720 Ga0070668_100001246
721 Ga0070668_100057079
722 Ga0070668_100214214
723 Ga0070669_100105021
724 Ga0070675_100003563
725 Ga0070675_100007060
726 Ga0070675_100012585
727 Ga0070675_100131236
728 Ga0070675_100167651
729 Ga0070674_100000988
730 Ga0070674_100010071
731 Ga0070674_100017360
732 Ga0070673_100004953
733 Ga0070673_100081131
734 Ga0070688_100099993
735 Ga0070659_100001505
736 Ga0070659_100002251
737 Ga0070659_100061265
738 Ga0070667_100111783
739 Ga0070703_10003809
740 Ga0070701_10026049
741 Ga0070700_100009311
742 Ga0070700_100039984
743 Ga0070700_100182237
744 Ga0070694_100000345
745 Ga0070694_100006735
746 Ga0070694_100011586
747 Ga0070694_100015289
748 Ga0070694_100026765
749 Ga0070694_100026892
750 Ga0070694_100073558
751 Ga0070708_100040319
752 Ga0070708_100046013
753 Ga0070708_100071343
754 Ga0070708_100085474
755 Ga0070663_100001711
756 Ga0070663_100051172
757 Ga0070678_100053178
758 Ga0070662_100026986
759 Ga0070662_100027076
760 Ga0070662_100055135
761 Ga0070662_100059219
762 Ga0068867_100006014
763 Ga0068867_100007131
764 Ga0068867_100052159
765 Ga0070685_10000264
766 Ga0070706_100003928
767 Ga0070706_100006413
768 Ga0070706_100039995
769 Ga0070706_100042411
770 Ga0070706_100061910
771 Ga0070706_100137563
772 Ga0070707_100001862
773 Ga0070707_100010381
774 Ga0070707_100149336
775 Ga0070698_100007713
776 Ga0070698_100016413
777 Ga0070698_100049291
778 Ga0070698_100296282
779 Ga0070699_100000712
780 Ga0070699_100003941
781 Ga0070699_100005248
782 Ga0070699_100008791
783 Ga0070699_100026173
784 Ga0070699_100035333
785 Ga0070699_100038913
786 Ga0070699_100068977
787 Ga0070684_100046398
788 Ga0070697_100042024
789 Ga0070697_100054351
790 Ga0068853_100010976
791 Ga0068853_100015316
792 Ga0068853_100144928
793 Ga0070672_100002079
794 Ga0070672_100019254
795 Ga0070672_100153097
796 Ga0070695_100000112
797 Ga0070695_100029138
798 Ga0070695_100042978
799 Ga0070696_100004871
800 Ga0070696_100017675
801 Ga0070696_100021801
802 Ga0070696_100038365
803 Ga0070696_100040971
804 Ga0070696_100043193
805 Ga0070696_100050366
806 Ga0070693_100000189
807 Ga0070693_100008457
808 Ga0070693_100009077
809 Ga0070704_100056342
810 Ga0070704_100067970
811 Ga0070704_100161853
812 Ga0068855_100000331
813 Ga0068855_100015855
814 Ga0070664_100001341
815 Ga0070664_100006931
816 Ga0070664_100064670
817 Ga0068857_100000030
818 Ga0068857_100030695
819 Ga0068857_100113601
820 Ga0068857_100231573
821 Ga0068856_100000923
822 Ga0068852_100000767
823 Ga0068859_100273956
824 Ga0068864_100017773
825 Ga0068864_100086867
826 Ga0068866_10000083
827 Ga0068866_10054606
828 Ga0068861_100000212
829 Ga0068861_100016033
830 Ga0068861_100188320
831 Ga0068851_10038131
832 Ga0068870_10000633
833 Ga0068870_10002979
834 Ga0068870_10005126
835 Ga0068870_10011935
836 Ga0068870_10024726
837 Ga0068863_100004918
838 Ga0068863_100030248
839 Ga0068863_100046577
840 Ga0068863_100072573
841 Ga0068858_100209763
842 Ga0068860_100031285
843 Ga0068860_100042597
844 Ga0068860_100129469
845 Ga0068862_100002125
846 Ga0068862_100008232
847 Ga0068862_100011482
848 Ga0068862_100016417
849 Ga0068862_100093277
850 Ga0081455_10000868
851 Ga0081538_10003260
852 Ga0081540_1000146
853 Ga0081540_1010521
854 Ga0081539_10000024
855 Ga0081539_10000096
856 Ga0081539_10002353
857 Ga0075365_10022819
858 Ga0075364_10015737
859 Ga0070716_100056184
860 Ga0070712_100003836
861 Ga0075362_10000233
862 Ga0075366_10007412
863 Ga0075366_10009293
864 Ga0075370_10066752
865 Ga0068871_100018934
866 Ga0068871_100152573
867 Ga0068871_100167268
868 Ga0075428_100004648
869 Ga0075428_100015898
870 Ga0075428_100059134
871 Ga0075428_100168638
872 Ga0075430_100007192
873 Ga0075430_100019149
874 Ga0075430_100039626
875 Ga0075430_100045970
876 Ga0075431_100000082
877 Ga0075431_100000486
878 Ga0075431_100001687
879 Ga0075431_100022095
880 Ga0075431_100040956
881 Ga0075431_100094758
882 Ga0075431_100183036
883 Ga0075431_100188110
884 Ga0075433_10000427
885 Ga0075433_10000839
886 Ga0075433_10002893
887 Ga0075433_10005550
888 Ga0075433_10015829
889 Ga0075433_10051244
890 Ga0075433_10087738
891 Ga0075433_10132597
892 Ga0075434_100000180
893 Ga0075434_100001347
894 Ga0075434_100010601
895 Ga0075434_100022413
896 Ga0075434_100040271
897 Ga0075434_100060934
898 Ga0075434_100066897
899 Ga0075434_100114253
900 Ga0075434_100131672
901 Ga0075434_100327389
902 Ga0075429_100002798
903 Ga0075429_100045702
904 Ga0075429_100081107
905 Ga0075429_100099264
906 Ga0068865_100159805
907 Ga0075436_100018788
908 Ga0097620_100273969
909 Ga0075435_100022605
910 Ga0075435_100039959
911 Ga0075435_100048550
912 Ga0075435_100062337
913 Ga0099794_10021772
914 Ga0099794_10046698
915 Ga0105240_10006182
916 Ga0111539_10000463
917 Ga0111539_10001292
918 Ga0111539_10001789
919 Ga0111539_10002439
920 Ga0111539_10006594
921 Ga0111539_10022315
922 Ga0111539_10031709
923 Ga0111539_10053095
924 Ga0111539_10093292
925 Ga0111539_10128670
926 Ga0111539_10207545
927 Ga0105245_10000233
928 Ga0105245_10109242
929 Ga0105245_10141866
930 Ga0105245_10283097
931 Ga0105247_10057589
932 Ga0114129_10000110
933 Ga0114129_10001205
934 Ga0114129_10001511
935 Ga0114129_10003221
936 Ga0114129_10025730
937 Ga0114129_10031560
938 Ga0114129_10061418
939 Ga0114129_10073338
940 Ga0114129_10101502
941 Ga0114129_10117860
942 Ga0114129_10127799
943 Ga0114129_10128039
944 Ga0114129_10132239
945 Ga0114129_10233089
946 Ga0114129_10385374
947 Ga0105241_10001410
948 Ga0105241_10069582
949 Ga0105242_10002855
950 Ga0105242_10007792
951 Ga0105242_10015305
952 Ga0105242_10023761
953 Ga0105248_10110182
954 Ga0105248_10323173
955 Ga0105237_10000549
956 Ga0105238_10141696
957 Ga0105238_10165024
958 Ga0105249_10008153
959 Ga0105239_10071671
960 Ga0105246_10028242
961 Ga0157373_10069753
962 Ga0157369_10017116
963 Ga0157374_10223928
964 Ga0157378_10163632
965 Ga0163162_10022241
966 Ga0163162_10055520
967 Ga0157372_10008010
968 Ga0157375_10256242
969 Ga0157375_10268348
970 Ga0157380_10001243
971 Ga0157380_10003226
972 Ga0157377_10008351
973 Ga0157379_10000876
974 Ga0157376_10000809
975 Ga0163161_10015178
976 Ga0207697_10001435
977 Ga0207697_10004936
978 Ga0207656_10008015
979 Ga0207653_10013704
980 Ga0207682_10000953
981 Ga0207682_10016474
982 Ga0207710_10024134
983 Ga0207688_10001607
984 Ga0207688_10027388
985 Ga0207645_10000043
986 Ga0207645_10000400
987 Ga0207645_10016127
988 Ga0207645_10028198
989 Ga0207643_10000424
990 Ga0207643_10000489
991 Ga0207643_10000732
992 Ga0207643_10015996
993 Ga0207643_10024053
994 Ga0207684_10003777
995 Ga0207684_10011947
996 Ga0207684_10023037
997 Ga0207684_10043927
998 Ga0207684_10058826
999 Ga0207684_10113773
1000 Ga0207654_10010692
1001 Ga0207707_10000116
1002 Ga0207707_10109336
1003 Ga0207671_10004294
1004 Ga0207693_10006943
1005 Ga0207663_10018254
1006 Ga0207662_10000043
1007 Ga0207662_10000891
1008 Ga0207662_10003651
1009 Ga0207662_10003719
1010 Ga0207662_10007198
1011 Ga0207657_10000211
1012 Ga0207657_10001235
1013 Ga0207649_10002015
1014 Ga0207649_10006395
1015 Ga0207652_10003841
1016 Ga0207646_10006951
1017 Ga0207646_10027940
1018 Ga0207646_10062784
1019 Ga0207646_10123365
1020 Ga0207681_10008695
1021 Ga0207681_10011598
1022 Ga0207694_10067456
1023 Ga0207694_10103230
1024 Ga0207650_10086341
1025 Ga0207650_10135932
1026 Ga0207659_10000351
1027 Ga0207659_10002998
1028 Ga0207659_10031425
1029 Ga0207659_10166067
1030 Ga0207659_10187184
1031 Ga0207687_10014744
1032 Ga0207687_10064136
1033 Ga0207687_10079611
1034 Ga0207690_10000823
1035 Ga0207690_10001495
1036 Ga0207706_10000162
1037 Ga0207706_10004021
1038 Ga0207706_10017429
1039 Ga0207706_10020893
1040 Ga0207706_10041882
1041 Ga0207706_10159902
1042 Ga0207686_10064513
1043 Ga0207709_10074430
1044 Ga0207709_10116300
1045 Ga0207670_10048949
1046 Ga0207670_10061086
1047 Ga0207704_10071650
1048 Ga0207665_10007130
1049 Ga0207691_10000053
1050 Ga0207691_10007695
1051 Ga0207691_10010524
1052 Ga0207691_10063428
1053 Ga0207711_10000276
1054 Ga0207711_10105861
1055 Ga0207711_10247569
1056 Ga0207689_10000026
1057 Ga0207689_10000201
1058 Ga0207689_10005325
1059 Ga0207689_10006142
1060 Ga0207689_10057840
1061 Ga0207689_10111208
1062 Ga0207661_10031217
1063 Ga0207661_10031757
1064 Ga0207679_10000449
1065 Ga0207679_10006771
1066 Ga0207667_10002107
1067 Ga0207651_10002705
1068 Ga0207651_10073549
1069 Ga0207651_10102406
1070 Ga0207651_10166804
1071 Ga0207712_10066798
1072 Ga0207668_10037148
1073 Ga0207668_10046780
1074 Ga0207640_10099415
1075 Ga0207658_10001466
1076 Ga0207658_10066628
1077 Ga0207677_10039272
1078 Ga0207677_10145629
1079 Ga0207703_10000059
1080 Ga0207703_10016319
1081 Ga0207639_10004331
1082 Ga0207639_10032200
1083 Ga0207639_10119734
1084 Ga0207678_10004271
1085 Ga0207708_10012567
1086 Ga0207708_10015376
1087 Ga0207702_10001143
1088 Ga0207641_10012977
1089 Ga0207641_10025232
1090 Ga0207648_10001530
1091 Ga0207648_10003683
1092 Ga0207648_10012060
1093 Ga0207648_10012239
1094 Ga0207648_10039622
1095 Ga0207674_10000951
1096 Ga0207674_10001221
1097 Ga0207674_10121570
1098 Ga0207674_10228190
1099 Ga0207675_100000233
1100 Ga0207675_100002501
1101 Ga0207675_100016025
1102 Ga0207675_100069969
1103 Ga0207675_100236249
1104 Ga0207683_10000624
1105 Ga0207683_10007833
1106 Ga0207683_10045698
1107 Ga0209969_1001359
1108 Ga0209984_1000634
1109 Ga0209968_1000573
1110 Ga0209970_1000407
1111 Ga0209971_1000037
1112 Ga0209966_1000378
1113 Ga0209998_10000042
1114 Ga0209974_10000465
1115 Ga0207428_10000027
1116 Ga0207428_10000245
1117 Ga0207428_10000849
1118 Ga0207428_10005064
1119 Ga0207428_10007736
1120 Ga0207428_10008043
1121 Ga0207428_10023843
1122 Ga0207428_10042406
1123 Ga0207428_10188618
1124 Ga0268266_10001681
1125 Ga0268265_10005618
1126 Ga0268265_10022805
1127 Ga0268265_10061875
1128 Ga0268264_10003233
1129 Ga0307408_100058337
1130 Ga0307405_10039995
1131 Ga0307405_10074946
1132 Ga0307416_100050470
1133 Ga0307416_100122713
1134 Ga0373940_0001611
1135 Ga0373940_0013102
1136 Ga0373949_0007232
1137 Ga0373939_0007541
1138 Ga0373939_0016739
1139 Ga0373961_0007741
1140 Ga0373933_0106003
1141 Ga0373925_0092635
1142 Ga0395900_0002273
1143 Ga0395898_0005721
1144 Ga0395901_0021074
1145 Ga0439448_0005919
1146 Ga0439435_0002235
1147 Ga0439435_0004587
1148 Ga0439459_0000110
1149 Ga0439464_0000830
1150 Ga0439460_0000197
1151 Ga0451577_0002796
1152 Ga0451577_0006253
1153 Ga0451577_0053635
1154 Ga0451577_0068274
1155 Ga0439440_0009806
1156 Ga0453683_0026123
1157 Ga0453683_0050488
1158 Ga0453684_0023625
1159 Ga0453684_0058416
1160 Ga0453684_0118568
1161 Ga0453684_0272065
1162 Ga0451576_0004364
1163 Ga0451576_0005141
1164 Ga0451576_0005764
1165 Ga0451576_0019775
1166 Ga0451576_0026087
1167 Ga0451576_0045920
1168 Ga0451576_0065829
1169 Ga0451576_0084972
1170 Ga0451576_0181174
1171 Ga0495603_0017434
1172 Ga0495629_0016857
1173 Ga0495580_0000727
1174 Ga0495628_0055710
1175 Ga0495633_0025371
1176 Ga0495667_0000367
1177 Ga0495656_0064340
1178 Ga0495659_0003220
1179 Ga0495659_0019150
1180 Ga0495669_0030073
1181 Ga0495674_0088115
1182 Ga0496106_0000637
1183 Ga0496112_0012711
1184 Ga0496112_0073778
1185 Ga0501031_0023404
1186 Ga0501033_0025025
1187 Ga0501033_0106442
1188 Ga0501034_0006093
1189 Ga0501034_0190474
1190 Ga0501036_0000997
1191 Ga0501036_0050451
1192 Ga0501037_0086148
1193 Ga0501038_0000877
1194 Ga0501038_0054489
1195 Ga0501039_0000306
1196 Ga0501039_0012641
1197 Ga0501039_0072161
1198 Ga0501040_0000832
1199 Ga0501040_0002340
1200 Ga0501040_0015254
1201 Ga0501040_0047905
1202 Ga0501040_0156538
1203 Ga0501041_0006125
1204 Ga0501041_0006839
1205 Ga0501041_0013389
1206 Ga0501042_0006874
1207 Ga0501042_0014338
1208 Ga0501042_0034409
1209 Ga0501042_0157396
1210 Ga0501046_0033137
1211 Ga0501046_0075277
1212 Ga0501046_0114920
1213 Ga0501047_0109507
1214 Ga0501047_0221891
1215 Ga0501048_0001234
1216 Ga0501048_0024994
1217 Ga0501048_0083670
1218 Ga0501068_0001222
1219 Ga0501068_0031832
1220 Ga0501070_0013626
1221 Ga0501072_0002438
1222 Ga0501072_0027727
1223 Ga0501072_0035451
1224 Ga0501072_0078538
1225 Ga0501072_0132229
1226 Ga0501073_0106623
1227 Ga0501074_0000224
1228 Ga0501074_0032375
1229 Ga0501074_0164172
1230 Ga0501075_0001171
1231 Ga0501075_0006351
1232 Ga0501075_0007121
1233 Ga0501075_0043634
1234 Ga0501075_0055523
1235 Ga0501075_0093010
1236 Ga0501076_0001587
1237 Ga0501076_0029084
1238 Ga0501076_0069071
1239 Ga0501076_0118503
1240 Ga0501077_0009200
1241 Ga0501077_0009822
1242 Ga0501077_0079258
1243 Ga0501077_0080278
1244 Ga0501079_0001398
1245 Ga0501079_0011415
1246 Ga0501079_0012871
1247 Ga0501079_0033516
1248 Ga0501079_0056218
1249 Ga0501079_0085288
1250 Ga0501080_0003252
1251 Ga0501080_0162053
1252 Ga0501081_0003382
1253 Ga0501081_0005258
1254 Ga0501081_0011638
1255 Ga0501081_0013942
1256 Ga0501081_0028626
1257 Ga0501081_0055063
1258 Ga0501081_0151553
1259 Ga0501083_0014659
1260 Ga0501045_0001152
1261 Ga0501045_0018435
1262 Ga0501045_0019119
1263 Ga0501045_0035209
1264 Ga0501045_0039549
1265 Ga0501045_0230241
1266 nmdc:mga03683_2028_c1
1267 nmdc:mga00v17_2153_c1
1268 nmdc:mga0k408_19033_c1
1269 nmdc:mga0k408_7123_c1
1270 nmdc:mga05p37_11414_c1
1271 nmdc:mga05p37_14939_c1
1272 nmdc:mga05p37_174216_c1
1273 nmdc:mga05p37_183619_c1
1274 nmdc:mga05p37_19057_c1
1275 nmdc:mga05p37_208119_c1
1276 nmdc:mga05p37_250013_c1
1277 nmdc:mga05p37_67675_c2
1278 nmdc:mga05p37_70532_c1
1279 nmdc:mga05p37_7406_c1
1280 nmdc:mga05p37_7480_c1
1281 nmdc:mga09592_17484_c1
1282 nmdc:mga09592_190943_c1
1283 nmdc:mga09592_244269_c1
1284 nmdc:mga09592_28662_c1
1285 nmdc:mga09592_3878_c1
1286 nmdc:mga09592_48767_c1
1287 nmdc:mga0qj67_22405_c1
1288 nmdc:mga0qj67_54944_c1
1289 nmdc:mga0qj67_7809_c1
1290 nmdc:mga06r32_1744_c1
1291 nmdc:mga06r32_174880_c1
1292 nmdc:mga06r32_39458_c1
1293 nmdc:mga06r32_71500_c1
1294 nmdc:mga06r32_7977_c1
1295 nmdc:mga06r32_89056_c1
1296 nmdc:mga08y16_11754_c1
1297 nmdc:mga08y16_1306_c1
1298 nmdc:mga08y16_17787_c1
1299 nmdc:mga08y16_201006_c1
1300 nmdc:mga08y16_24924_c1
1301 nmdc:mga08y16_2919_c1
1302 nmdc:mga08y16_31120_c1
1303 nmdc:mga08y16_52414_c1
1304 nmdc:mga08y16_597_c1
1305 nmdc:mga0n895_14004_c1
1306 nmdc:mga0n895_1895_c1
1307 nmdc:mga0n895_24005_c1
1308 nmdc:mga0n895_43435_c1
1309 nmdc:mga0n895_477_c1
1310 nmdc:mga0n895_53201_c1
1311 nmdc:mga0n895_57467_c1
1312 nmdc:mga0n895_60869_c1
1313 nmdc:mga0n895_77660_c1
1314 nmdc:mga0n895_83684_c1
1315 nmdc:mga0rr50_109889_c1
1316 nmdc:mga0rr50_27543_c1
1317 nmdc:mga0rr50_34073_c1
1318 nmdc:mga0rr50_35406_c1
1319 nmdc:mga0rr50_7633_c1
1320 nmdc:mga08x19_17737_c1
1321 nmdc:mga08x19_57107_c1
1322 nmdc:mga0a205_11142_c1
1323 nmdc:mga0a205_112429_c1
1324 nmdc:mga0a205_133836_c1
1325 nmdc:mga0a205_13783_c1
1326 nmdc:mga0a205_139255_c1
1327 nmdc:mga0a205_17339_c1
1328 nmdc:mga0a205_196715_c1
1329 nmdc:mga0a205_1991_c1
1330 nmdc:mga0a205_227_c1
1331 nmdc:mga0a205_58581_c1
1332 nmdc:mga0a205_646_c1
1333 nmdc:mga0a205_66283_c1
1334 Ga0501084_0001523
1335 Ga0501084_0014381
1336 Ga0501084_0017452
1337 Ga0501082_0000243
1338 Ga0501082_0005963
1339 Ga0530510_0001138
1340 Ga0530510_0005834
1341 Ga0530510_0006581
1342 Ga0530510_0022799
1343 Ga0530510_0047130
1344 Ga0530510_0057599
1345 Ga0530510_0099475
1346 Ga0530510_0138480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

158

449

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aqq-assembly1.cif.gz_N cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.9295 8 475
8e73-assembly1.cif.gz_2M vigna radiata supercomplex i+iii2 (full bridge) 0.9179 8 476
6khj-assembly1.cif.gz_B supercomplex for electron transfer 0.9143 8 473
7aqq-assembly1.cif.gz_N cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.9125 8 475
7f9o-assembly1.cif.gz_M psi-ndh supercomplex of barley 0.9116 9 469
ID Description Score Start End Superfamily
af_Q8IIQ6_781_1032_1.25.40.660 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein 35, helical subcomplex Vps35-C 0.344 8 245 1.25.40.660
af_I1LLV0_1_234_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3315 40 268 1.20.1410.10
af_F4HWQ7_36_219_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3253 4 229 1.20.1070.10
af_I1LLV0_1_234_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3248 40 268 1.20.1410.10
af_F4HWQ7_36_219_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3224 4 229 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A661UT51-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9673 292 476 GO:0012505
GO:0016020
GO:0048038
AF-A0A351XEN3-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9666 258 475 GO:0012505
GO:0016020
AF-A0A3N5QKU7-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9666 320 475 GO:0012505
GO:0016020
AF-A0A6L3AAY0-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9577 82 475 GO:0008137
GO:0012505
GO:0016020
GO:0042773
AF-A0A2G8MKL7-F1-model_v4 deleted 0.9574 227 476

Map