F474284
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 315 | 671 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100601184|Ga0070714_1006011841 |
| Length | 246 |
| Sequence | MEGMGSVRCWLRNRAASPRNRAQCHGRARADMIPLKLNPTTGRLRVLCLGAHSDDIEIGCGGTILRLAEEHPDCEFHWVVFSATGVRASEAARAAQLFAGSRLRNALLKPFRDGYMPWLGAEIKSVFEEELKPLSPDLVLTHYGNDAHQDHRLISQLTWNTFRDHLIFEYEIPKYDGDLGCPGLFVPLDQRQYQVKVQHIMEAFPSQHAKHWFKPETFLSLMRLRGLECVAPAGHAEAFYCRKLIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 2 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 189 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.66 |
| Metatranscriptomes | 1.04 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.42 |
| Nodule | 0 |
| Rhizoplane | 2.82 |
| Rhizosphere | 90.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10323060 | 3300003320 | Bacteria | 1855 |
| 2 | JGI25405J52794_10000050 | 3300003911 | Bacteria | 13151 |
| 3 | JGI25405J52794_10000986 | 3300003911 | Bacteria | 4493 |
| 4 | JGI25405J52794_10010023 | 3300003911 | Bacteria | 1798 |
| 5 | Ga0058862_12721418 | 3300004803 | Bacteria | 820 |
| 6 | Ga0065712_10241463 | 3300005290 | Unclassified | 983 |
| 7 | Ga0065707_10187006 | 3300005295 | Bacteria | 1383 |
| 8 | Ga0065707_10328279 | 3300005295 | Bacteria | 954 |
| 9 | Ga0070683_100157677 | 3300005329 | Unclassified | 2153 |
| 10 | Ga0070690_100132851 | 3300005330 | Bacteria | 1682 |
| 11 | Ga0068869_100100935 | 3300005334 | Bacteria | 2182 |
| 12 | Ga0068869_100104670 | 3300005334 | Unclassified | 2145 |
| 13 | Ga0070680_100001666 | 3300005336 | Bacteria | 16258 |
| 14 | Ga0070680_100020369 | 3300005336 | Bacteria | 5264 |
| 15 | Ga0070680_100229748 | 3300005336 | Bacteria | 1567 |
| 16 | Ga0070680_100531453 | 3300005336 | Bacteria | 1007 |
| 17 | Ga0070682_100062412 | 3300005337 | Bacteria | 2360 |
| 18 | Ga0068868_100106935 | 3300005338 | Bacteria | 2270 |
| 19 | Ga0070689_100008344 | 3300005340 | Bacteria | 7293 |
| 20 | Ga0070689_100356674 | 3300005340 | Bacteria | 1228 |
| 21 | Ga0070691_10091770 | 3300005341 | Bacteria | 1498 |
| 22 | Ga0070687_100129270 | 3300005343 | Bacteria | 1456 |
| 23 | Ga0070661_100074818 | 3300005344 | Unclassified | 2495 |
| 24 | Ga0070669_100051618 | 3300005353 | Bacteria | 3007 |
| 25 | Ga0070669_100110486 | 3300005353 | Bacteria | 2086 |
| 26 | Ga0070671_100351519 | 3300005355 | Bacteria | 1258 |
| 27 | Ga0070674_100469463 | 3300005356 | Bacteria | 1042 |
| 28 | Ga0070688_100002898 | 3300005365 | Bacteria | 8746 |
| 29 | Ga0070688_100675060 | 3300005365 | Unclassified | 798 |
| 30 | Ga0070667_100048014 | 3300005367 | Bacteria | 3592 |
| 31 | Ga0070667_100491503 | 3300005367 | Bacteria | 1124 |
| 32 | Ga0070703_10021190 | 3300005406 | Bacteria | 1898 |
| 33 | Ga0070709_10011535 | 3300005434 | Bacteria | 4929 |
| 34 | Ga0070709_10019638 | 3300005434 | Bacteria | 3910 |
| 35 | Ga0070709_10083013 | 3300005434 | Bacteria | 2095 |
| 36 | Ga0070714_100000541 | 3300005435 | Bacteria | 27233 |
| 37 | Ga0070714_100002329 | 3300005435 | Bacteria | 13963 |
| 38 | Ga0070714_100168581 | 3300005435 | Bacteria | 1986 |
| 39 | Ga0070714_100601184 | 3300005435 | Bacteria | 1056 |
| 40 | Ga0070713_100019881 | 3300005436 | Bacteria | 5139 |
| 41 | Ga0070713_100050670 | 3300005436 | Bacteria | 3430 |
| 42 | Ga0070713_100261979 | 3300005436 | Unclassified | 1580 |
| 43 | Ga0070713_100342639 | 3300005436 | Bacteria | 1385 |
| 44 | Ga0070713_100564048 | 3300005436 | Bacteria | 1079 |
| 45 | Ga0070710_10018100 | 3300005437 | Bacteria | 3619 |
| 46 | Ga0070710_10055258 | 3300005437 | Bacteria | 2243 |
| 47 | Ga0070701_10005385 | 3300005438 | Bacteria | 5279 |
| 48 | Ga0070701_10009282 | 3300005438 | Bacteria | 4302 |
| 49 | Ga0070711_100049701 | 3300005439 | Bacteria | 2872 |
| 50 | Ga0070711_100545258 | 3300005439 | Unclassified | 961 |
| 51 | Ga0070705_100004605 | 3300005440 | Archaea | 6710 |
| 52 | Ga0070705_100006354 | 3300005440 | Bacteria | 5790 |
| 53 | Ga0070700_100047353 | 3300005441 | Bacteria | 2660 |
| 54 | Ga0070708_100020381 | 3300005445 | Bacteria | 5591 |
| 55 | Ga0070708_100105514 | 3300005445 | Unclassified | 2585 |
| 56 | Ga0070708_100196209 | 3300005445 | Bacteria | 1889 |
| 57 | Ga0070663_100044385 | 3300005455 | Bacteria | 3133 |
| 58 | Ga0070678_100019067 | 3300005456 | Bacteria | 4461 |
| 59 | Ga0070678_100074577 | 3300005456 | Bacteria | 2550 |
| 60 | Ga0070678_100110671 | 3300005456 | Bacteria | 2148 |
| 61 | Ga0070678_100342982 | 3300005456 | Bacteria | 1282 |
| 62 | Ga0070681_10004741 | 3300005458 | Bacteria | 13024 |
| 63 | Ga0070681_10091616 | 3300005458 | Bacteria | 2990 |
| 64 | Ga0070681_10354250 | 3300005458 | Bacteria | 1378 |
| 65 | Ga0070681_10770927 | 3300005458 | Bacteria | 879 |
| 66 | Ga0068867_100334694 | 3300005459 | Bacteria | 1258 |
| 67 | Ga0070685_10009941 | 3300005466 | Bacteria | 4934 |
| 68 | Ga0070706_100000225 | 3300005467 | Bacteria | 69130 |
| 69 | Ga0070706_100020288 | 3300005467 | Bacteria | 6125 |
| 70 | Ga0070706_100162951 | 3300005467 | Bacteria | 2082 |
| 71 | Ga0070706_100247469 | 3300005467 | Bacteria | 1665 |
| 72 | Ga0070706_100248571 | 3300005467 | Bacteria | 1660 |
| 73 | Ga0070706_100407335 | 3300005467 | Bacteria | 1266 |
| 74 | Ga0070707_100010108 | 3300005468 | Bacteria | 8782 |
| 75 | Ga0070707_100031743 | 3300005468 | Bacteria | 5032 |
| 76 | Ga0070707_100187464 | 3300005468 | Bacteria | 2017 |
| 77 | Ga0070707_100219967 | 3300005468 | Bacteria | 1850 |
| 78 | Ga0070698_100003041 | 3300005471 | Bacteria | 18475 |
| 79 | Ga0070698_100006234 | 3300005471 | Bacteria | 12977 |
| 80 | Ga0070698_100076055 | 3300005471 | Bacteria | 3360 |
| 81 | Ga0070698_100089326 | 3300005471 | Bacteria | 3065 |
| 82 | Ga0070698_100093274 | 3300005471 | Bacteria | 2990 |
| 83 | Ga0070698_100171831 | 3300005471 | Bacteria | 2108 |
| 84 | Ga0070699_100039731 | 3300005518 | Bacteria | 4074 |
| 85 | Ga0070699_100232462 | 3300005518 | Unclassified | 1644 |
| 86 | Ga0070699_100244881 | 3300005518 | Bacteria | 1601 |
| 87 | Ga0070699_100371492 | 3300005518 | Bacteria | 1290 |
| 88 | Ga0070699_100459926 | 3300005518 | Bacteria | 1154 |
| 89 | Ga0070679_100000118 | 3300005530 | Bacteria | 62242 |
| 90 | Ga0070684_100258458 | 3300005535 | Unclassified | 1593 |
| 91 | Ga0070697_100000805 | 3300005536 | Bacteria | 23566 |
| 92 | Ga0070697_100001784 | 3300005536 | Bacteria | 16422 |
| 93 | Ga0070697_100006210 | 3300005536 | Bacteria | 9247 |
| 94 | Ga0070697_100011178 | 3300005536 | Bacteria | 7015 |
| 95 | Ga0070697_100076282 | 3300005536 | Bacteria | 2757 |
| 96 | Ga0070697_100456172 | 3300005536 | Unclassified | 1114 |
| 97 | Ga0068853_100747875 | 3300005539 | Bacteria | 934 |
| 98 | Ga0070672_100001178 | 3300005543 | Bacteria | 15987 |
| 99 | Ga0070672_100006314 | 3300005543 | Bacteria | 7950 |
| 100 | Ga0070672_100211130 | 3300005543 | Bacteria | 1626 |
| 101 | Ga0070686_100071144 | 3300005544 | Bacteria | 2276 |
| 102 | Ga0070686_100085627 | 3300005544 | Bacteria | 2097 |
| 103 | Ga0070686_100282232 | 3300005544 | Unclassified | 1225 |
| 104 | Ga0070695_100018447 | 3300005545 | Unclassified | 4237 |
| 105 | Ga0070695_100318420 | 3300005545 | Bacteria | 1155 |
| 106 | Ga0070696_100041510 | 3300005546 | Bacteria | 3178 |
| 107 | Ga0070696_100054650 | 3300005546 | Bacteria | 2783 |
| 108 | Ga0070696_100353318 | 3300005546 | Bacteria | 1139 |
| 109 | Ga0070696_100394994 | 3300005546 | Bacteria | 1081 |
| 110 | Ga0070693_100063079 | 3300005547 | Bacteria | 2159 |
| 111 | Ga0070704_100652687 | 3300005549 | Unclassified | 929 |
| 112 | Ga0068855_100066070 | 3300005563 | Bacteria | 4216 |
| 113 | Ga0068855_100218639 | 3300005563 | Bacteria | 2138 |
| 114 | Ga0068857_100032762 | 3300005577 | Bacteria | 4593 |
| 115 | Ga0068857_100997100 | 3300005577 | Unclassified | 806 |
| 116 | Ga0068856_100016961 | 3300005614 | Bacteria | 7058 |
| 117 | Ga0070702_100041543 | 3300005615 | Bacteria | 2580 |
| 118 | Ga0070702_100068430 | 3300005615 | Bacteria | 2089 |
| 119 | Ga0070702_100071195 | 3300005615 | Bacteria | 2055 |
| 120 | Ga0068852_100130262 | 3300005616 | Bacteria | 2316 |
| 121 | Ga0068852_100548185 | 3300005616 | Unclassified | 1156 |
| 122 | Ga0068859_100074635 | 3300005617 | Bacteria | 3430 |
| 123 | Ga0068859_100190159 | 3300005617 | Bacteria | 2137 |
| 124 | Ga0068859_101293795 | 3300005617 | Unclassified | 803 |
| 125 | Ga0068864_100269922 | 3300005618 | Bacteria | 1585 |
| 126 | Ga0068866_10024235 | 3300005718 | Bacteria | 2833 |
| 127 | Ga0068866_10134752 | 3300005718 | Bacteria | 1410 |
| 128 | Ga0068851_10009957 | 3300005834 | Unclassified | 4426 |
| 129 | Ga0068863_100012608 | 3300005841 | Bacteria | 8154 |
| 130 | Ga0068863_100409943 | 3300005841 | Bacteria | 1326 |
| 131 | Ga0068858_100038547 | 3300005842 | Bacteria | 4433 |
| 132 | Ga0068860_100025859 | 3300005843 | Bacteria | 5662 |
| 133 | Ga0068862_100007312 | 3300005844 | Bacteria | 9168 |
| 134 | Ga0068862_100060570 | 3300005844 | Unclassified | 3252 |
| 135 | Ga0068862_100158421 | 3300005844 | Bacteria | 2019 |
| 136 | Ga0068862_100530321 | 3300005844 | Bacteria | 1122 |
| 137 | Ga0081455_10000119 | 3300005937 | Bacteria | 90937 |
| 138 | Ga0081455_10002146 | 3300005937 | Bacteria | 23521 |
| 139 | Ga0081455_10004119 | 3300005937 | Bacteria | 16443 |
| 140 | Ga0081455_10007276 | 3300005937 | Bacteria | 11682 |
| 141 | Ga0081455_10010105 | 3300005937 | Bacteria | 9622 |
| 142 | Ga0081455_10035531 | 3300005937 | Bacteria | 4451 |
| 143 | Ga0081455_10048110 | 3300005937 | Bacteria | 3687 |
| 144 | Ga0081455_10070838 | 3300005937 | Unclassified | 2893 |
| 145 | Ga0081538_10000895 | 3300005981 | Bacteria | 32274 |
| 146 | Ga0081538_10001205 | 3300005981 | Bacteria | 27126 |
| 147 | Ga0081538_10004221 | 3300005981 | Bacteria | 13339 |
| 148 | Ga0081538_10008456 | 3300005981 | Bacteria | 8730 |
| 149 | Ga0075365_10004984 | 3300006038 | Bacteria | 7112 |
| 150 | Ga0075365_10011294 | 3300006038 | Bacteria | 5246 |
| 151 | Ga0075365_10321058 | 3300006038 | Bacteria | 1090 |
| 152 | Ga0075364_10006234 | 3300006051 | Bacteria | 6992 |
| 153 | Ga0070715_10005686 | 3300006163 | Bacteria | 4181 |
| 154 | Ga0070716_100032195 | 3300006173 | Bacteria | 2858 |
| 155 | Ga0070716_100104940 | 3300006173 | Bacteria | 1740 |
| 156 | Ga0070712_100032585 | 3300006175 | Bacteria | 3520 |
| 157 | Ga0070712_100060497 | 3300006175 | Bacteria | 2671 |
| 158 | Ga0075362_10006015 | 3300006177 | Bacteria | 4492 |
| 159 | Ga0075367_10000175 | 3300006178 | Bacteria | 20774 |
| 160 | Ga0075367_10030118 | 3300006178 | Bacteria | 3109 |
| 161 | Ga0075367_10053908 | 3300006178 | Bacteria | 2384 |
| 162 | Ga0075366_10007835 | 3300006195 | Bacteria | 5908 |
| 163 | Ga0075366_10508030 | 3300006195 | Bacteria | 745 |
| 164 | Ga0097621_100047709 | 3300006237 | Bacteria | 3471 |
| 165 | Ga0097621_100655105 | 3300006237 | Bacteria | 964 |
| 166 | Ga0068871_100071860 | 3300006358 | Bacteria | 2847 |
| 167 | Ga0068871_101070419 | 3300006358 | Unclassified | 753 |
| 168 | Ga0075428_100001435 | 3300006844 | Bacteria | 25450 |
| 169 | Ga0075428_100006634 | 3300006844 | Bacteria | 12872 |
| 170 | Ga0075428_100023639 | 3300006844 | Bacteria | 6803 |
| 171 | Ga0075428_100027218 | 3300006844 | Bacteria | 6329 |
| 172 | Ga0075428_100037234 | 3300006844 | Bacteria | 5357 |
| 173 | Ga0075428_100039042 | 3300006844 | Bacteria | 5225 |
| 174 | Ga0075428_100173081 | 3300006844 | Bacteria | 2339 |
| 175 | Ga0075428_100428076 | 3300006844 | Unclassified | 1418 |
| 176 | Ga0075428_100434889 | 3300006844 | Bacteria | 1406 |
| 177 | Ga0075430_100002351 | 3300006846 | Bacteria | 15719 |
| 178 | Ga0075430_100003691 | 3300006846 | Bacteria | 12859 |
| 179 | Ga0075430_100014302 | 3300006846 | Bacteria | 6762 |
| 180 | Ga0075430_100384582 | 3300006846 | Bacteria | 1158 |
| 181 | Ga0075431_100023542 | 3300006847 | Bacteria | 6303 |
| 182 | Ga0075431_100030386 | 3300006847 | Bacteria | 5565 |
| 183 | Ga0075431_100083246 | 3300006847 | Bacteria | 3303 |
| 184 | Ga0075431_100087066 | 3300006847 | Unclassified | 3224 |
| 185 | Ga0075431_100212793 | 3300006847 | Bacteria | 1974 |
| 186 | Ga0075431_100510122 | 3300006847 | Bacteria | 1193 |
| 187 | Ga0075433_10021006 | 3300006852 | Bacteria | 5469 |
| 188 | Ga0075433_10199086 | 3300006852 | Unclassified | 1781 |
| 189 | Ga0075433_10367640 | 3300006852 | Bacteria | 1270 |
| 190 | Ga0075434_100029911 | 3300006871 | Bacteria | 5361 |
| 191 | Ga0075434_100242663 | 3300006871 | Bacteria | 1822 |
| 192 | Ga0075434_100253213 | 3300006871 | Bacteria | 1780 |
| 193 | Ga0075434_100935485 | 3300006871 | Unclassified | 881 |
| 194 | Ga0075429_100023013 | 3300006880 | Bacteria | 5401 |
| 195 | Ga0075429_100063054 | 3300006880 | Bacteria | 3229 |
| 196 | Ga0075429_100067925 | 3300006880 | Bacteria | 3103 |
| 197 | Ga0075429_100426980 | 3300006880 | Bacteria | 1161 |
| 198 | Ga0068865_100017966 | 3300006881 | Bacteria | 4557 |
| 199 | Ga0068865_100052498 | 3300006881 | Bacteria | 2825 |
| 200 | Ga0068865_100141463 | 3300006881 | Bacteria | 1815 |
| 201 | Ga0075436_100073048 | 3300006914 | Bacteria | 2374 |
| 202 | Ga0075436_100132523 | 3300006914 | Bacteria | 1748 |
| 203 | Ga0097620_100074636 | 3300006931 | Bacteria | 3430 |
| 204 | Ga0097620_100190159 | 3300006931 | Bacteria | 2137 |
| 205 | Ga0097620_101294176 | 3300006931 | Unclassified | 803 |
| 206 | Ga0075435_100030148 | 3300007076 | Unclassified | 4262 |
| 207 | Ga0075435_100113931 | 3300007076 | Bacteria | 2251 |
| 208 | Ga0075435_100165301 | 3300007076 | Unclassified | 1866 |
| 209 | Ga0099794_10013910 | 3300007265 | Bacteria | 3514 |
| 210 | Ga0105240_10046154 | 3300009093 | Bacteria | 5522 |
| 211 | Ga0111539_10001286 | 3300009094 | Bacteria | 33550 |
| 212 | Ga0111539_10027280 | 3300009094 | Bacteria | 6975 |
| 213 | Ga0111539_10035092 | 3300009094 | Bacteria | 6073 |
| 214 | Ga0111539_10189768 | 3300009094 | Bacteria | 2398 |
| 215 | Ga0111539_10261448 | 3300009094 | Bacteria | 2015 |
| 216 | Ga0111539_11184394 | 3300009094 | Bacteria | 888 |
| 217 | Ga0105245_10372484 | 3300009098 | Bacteria | 1420 |
| 218 | Ga0114129_10000349 | 3300009147 | Bacteria | 53637 |
| 219 | Ga0114129_10041590 | 3300009147 | Bacteria | 6474 |
| 220 | Ga0114129_10045047 | 3300009147 | Bacteria | 6202 |
| 221 | Ga0114129_10059918 | 3300009147 | Bacteria | 5322 |
| 222 | Ga0114129_10061088 | 3300009147 | Bacteria | 5267 |
| 223 | Ga0114129_10102534 | 3300009147 | Bacteria | 3957 |
| 224 | Ga0114129_11150502 | 3300009147 | Bacteria | 969 |
| 225 | Ga0114129_11922851 | 3300009147 | Bacteria | 717 |
| 226 | Ga0105243_10087537 | 3300009148 | Bacteria | 2557 |
| 227 | Ga0105243_10843676 | 3300009148 | Unclassified | 907 |
| 228 | Ga0105241_10007380 | 3300009174 | Bacteria | 8088 |
| 229 | Ga0105241_10597691 | 3300009174 | Bacteria | 996 |
| 230 | Ga0105242_10031232 | 3300009176 | Bacteria | 4252 |
| 231 | Ga0105242_10033049 | 3300009176 | Bacteria | 4140 |
| 232 | Ga0105242_10518696 | 3300009176 | Unclassified | 1137 |
| 233 | Ga0105248_10007418 | 3300009177 | Bacteria | 12032 |
| 234 | Ga0105248_10492252 | 3300009177 | Bacteria | 1382 |
| 235 | Ga0105238_10161886 | 3300009551 | Bacteria | 2213 |
| 236 | Ga0105238_10679940 | 3300009551 | Bacteria | 1041 |
| 237 | Ga0105249_10221378 | 3300009553 | Bacteria | 1862 |
| 238 | Ga0105249_10276919 | 3300009553 | Bacteria | 1674 |
| 239 | Ga0105249_10286120 | 3300009553 | Bacteria | 1648 |
| 240 | Ga0105239_10011375 | 3300010375 | Bacteria | 9927 |
| 241 | Ga0157373_10347301 | 3300013100 | Unclassified | 1058 |
| 242 | Ga0157370_10036601 | 3300013104 | Bacteria | 4761 |
| 243 | Ga0157370_10485695 | 3300013104 | Unclassified | 1135 |
| 244 | Ga0157369_10036658 | 3300013105 | Bacteria | 5372 |
| 245 | Ga0157369_10127553 | 3300013105 | Bacteria | 2696 |
| 246 | Ga0157369_10877711 | 3300013105 | Unclassified | 920 |
| 247 | Ga0157374_10151334 | 3300013296 | Unclassified | 2256 |
| 248 | Ga0157378_10077152 | 3300013297 | Bacteria | 3003 |
| 249 | Ga0157378_10179418 | 3300013297 | Bacteria | 1991 |
| 250 | Ga0157378_10358578 | 3300013297 | Bacteria | 1426 |
| 251 | Ga0157378_10525946 | 3300013297 | Bacteria | 1185 |
| 252 | Ga0157378_10974037 | 3300013297 | Bacteria | 881 |
| 253 | Ga0157372_10081156 | 3300013307 | Bacteria | 3670 |
| 254 | Ga0157372_10113685 | 3300013307 | Bacteria | 3103 |
| 255 | Ga0157372_10128905 | 3300013307 | Unclassified | 2910 |
| 256 | Ga0157372_10366860 | 3300013307 | Bacteria | 1678 |
| 257 | Ga0157372_10647544 | 3300013307 | Bacteria | 1231 |
| 258 | Ga0157375_10044928 | 3300013308 | Bacteria | 4297 |
| 259 | Ga0157375_10383398 | 3300013308 | Bacteria | 1572 |
| 260 | Ga0157375_10458832 | 3300013308 | Bacteria | 1440 |
| 261 | Ga0163163_10044170 | 3300014325 | Unclassified | 4371 |
| 262 | Ga0157380_10029405 | 3300014326 | Bacteria | 4200 |
| 263 | Ga0157380_10303157 | 3300014326 | Bacteria | 1473 |
| 264 | Ga0157380_10566229 | 3300014326 | Bacteria | 1118 |
| 265 | Ga0157377_10027377 | 3300014745 | Bacteria | 3060 |
| 266 | Ga0157379_10083279 | 3300014968 | Bacteria | 2867 |
| 267 | Ga0157376_10044132 | 3300014969 | Bacteria | 3662 |
| 268 | Ga0157376_10150049 | 3300014969 | Bacteria | 2101 |
| 269 | Ga0157376_10272639 | 3300014969 | Bacteria | 1590 |
| 270 | Ga0163161_10026329 | 3300017792 | Bacteria | 4120 |
| 271 | Ga0197907_11462604 | 3300020069 | Bacteria | 1472 |
| 272 | Ga0206355_1501835 | 3300020076 | Bacteria | 906 |
| 273 | Ga0154015_1242848 | 3300020610 | Bacteria | 3736 |
| 274 | Ga0213873_10059918 | 3300021358 | Bacteria | 1028 |
| 275 | Ga0213872_10002845 | 3300021361 | Bacteria | 9886 |
| 276 | Ga0213876_10010195 | 3300021384 | Bacteria | 5048 |
| 277 | Ga0213876_10117308 | 3300021384 | Bacteria | 1413 |
| 278 | Ga0213875_10001697 | 3300021388 | Bacteria | 13865 |
| 279 | Ga0207642_10026825 | 3300025899 | Bacteria | 2350 |
| 280 | Ga0207642_10028295 | 3300025899 | Bacteria | 2306 |
| 281 | Ga0207699_10089416 | 3300025906 | Bacteria | 1930 |
| 282 | Ga0207705_10027676 | 3300025909 | Unclassified | 4044 |
| 283 | Ga0207705_10277283 | 3300025909 | Bacteria | 1283 |
| 284 | Ga0207684_10000430 | 3300025910 | Bacteria | 55766 |
| 285 | Ga0207684_10000991 | 3300025910 | Bacteria | 31839 |
| 286 | Ga0207684_10179772 | 3300025910 | Bacteria | 1824 |
| 287 | Ga0207654_10149309 | 3300025911 | Bacteria | 1499 |
| 288 | Ga0207707_10001675 | 3300025912 | Bacteria | 20429 |
| 289 | Ga0207707_10308148 | 3300025912 | Bacteria | 1368 |
| 290 | Ga0207707_10697024 | 3300025912 | Bacteria | 853 |
| 291 | Ga0207695_10058131 | 3300025913 | Bacteria | 4015 |
| 292 | Ga0207693_10000618 | 3300025915 | Bacteria | 31778 |
| 293 | Ga0207693_10001108 | 3300025915 | Bacteria | 24245 |
| 294 | Ga0207693_10058998 | 3300025915 | Bacteria | 3006 |
| 295 | Ga0207663_10000872 | 3300025916 | Bacteria | 13689 |
| 296 | Ga0207663_10028343 | 3300025916 | Bacteria | 3277 |
| 297 | Ga0207663_10662703 | 3300025916 | Unclassified | 824 |
| 298 | Ga0207660_10006463 | 3300025917 | Bacteria | 7599 |
| 299 | Ga0207660_10206627 | 3300025917 | Bacteria | 1536 |
| 300 | Ga0207660_10231285 | 3300025917 | Bacteria | 1454 |
| 301 | Ga0207660_10638589 | 3300025917 | Bacteria | 868 |
| 302 | Ga0207662_10014902 | 3300025918 | Bacteria | 4367 |
| 303 | Ga0207662_10104548 | 3300025918 | Bacteria | 1759 |
| 304 | Ga0207657_10049169 | 3300025919 | Bacteria | 3677 |
| 305 | Ga0207652_10002549 | 3300025921 | Bacteria | 15298 |
| 306 | Ga0207646_10006236 | 3300025922 | Bacteria | 12392 |
| 307 | Ga0207646_10052302 | 3300025922 | Bacteria | 3655 |
| 308 | Ga0207646_10077784 | 3300025922 | Unclassified | 2964 |
| 309 | Ga0207681_10429899 | 3300025923 | Unclassified | 1071 |
| 310 | Ga0207694_10308190 | 3300025924 | Bacteria | 1305 |
| 311 | Ga0207700_10013878 | 3300025928 | Bacteria | 5261 |
| 312 | Ga0207700_10046593 | 3300025928 | Bacteria | 3207 |
| 313 | Ga0207700_10076359 | 3300025928 | Bacteria | 2599 |
| 314 | Ga0207700_10159708 | 3300025928 | Unclassified | 1871 |
| 315 | Ga0207700_10686366 | 3300025928 | Bacteria | 914 |
| 316 | Ga0207664_10015519 | 3300025929 | Bacteria | 5532 |
| 317 | Ga0207664_10076006 | 3300025929 | Bacteria | 2717 |
| 318 | Ga0207664_10237905 | 3300025929 | Bacteria | 1585 |
| 319 | Ga0207664_10356097 | 3300025929 | Bacteria | 1296 |
| 320 | Ga0207664_10516830 | 3300025929 | Bacteria | 1070 |
| 321 | Ga0207706_10004239 | 3300025933 | Bacteria | 13502 |
| 322 | Ga0207686_10059554 | 3300025934 | Bacteria | 2413 |
| 323 | Ga0207670_10082276 | 3300025936 | Bacteria | 2256 |
| 324 | Ga0207670_10084660 | 3300025936 | Bacteria | 2226 |
| 325 | Ga0207704_10013671 | 3300025938 | Bacteria | 4072 |
| 326 | Ga0207704_10247839 | 3300025938 | Bacteria | 1335 |
| 327 | Ga0207665_10057145 | 3300025939 | Bacteria | 2635 |
| 328 | Ga0207665_10131222 | 3300025939 | Bacteria | 1779 |
| 329 | Ga0207691_10003776 | 3300025940 | Bacteria | 14704 |
| 330 | Ga0207691_10021463 | 3300025940 | Bacteria | 6097 |
| 331 | Ga0207691_10132387 | 3300025940 | Bacteria | 2201 |
| 332 | Ga0207689_10011002 | 3300025942 | Bacteria | 7779 |
| 333 | Ga0207689_10163349 | 3300025942 | Bacteria | 1835 |
| 334 | Ga0207661_10078286 | 3300025944 | Bacteria | 2721 |
| 335 | Ga0207661_10591230 | 3300025944 | Bacteria | 1018 |
| 336 | Ga0207667_10308214 | 3300025949 | Bacteria | 1617 |
| 337 | Ga0207712_10288290 | 3300025961 | Bacteria | 1342 |
| 338 | Ga0207668_10067423 | 3300025972 | Bacteria | 2541 |
| 339 | Ga0207658_10245048 | 3300025986 | Bacteria | 1520 |
| 340 | Ga0207658_10295072 | 3300025986 | Unclassified | 1395 |
| 341 | Ga0207677_10327586 | 3300026023 | Bacteria | 1275 |
| 342 | Ga0207703_10050335 | 3300026035 | Bacteria | 3371 |
| 343 | Ga0207639_10058854 | 3300026041 | Bacteria | 2957 |
| 344 | Ga0207639_10126318 | 3300026041 | Unclassified | 2110 |
| 345 | Ga0207639_10808061 | 3300026041 | Bacteria | 874 |
| 346 | Ga0207678_10033899 | 3300026067 | Bacteria | 4447 |
| 347 | Ga0207708_10012143 | 3300026075 | Bacteria | 6422 |
| 348 | Ga0207708_10018149 | 3300026075 | Bacteria | 5295 |
| 349 | Ga0207702_10007673 | 3300026078 | Bacteria | 9173 |
| 350 | Ga0207641_10054515 | 3300026088 | Bacteria | 3393 |
| 351 | Ga0207641_10984029 | 3300026088 | Unclassified | 840 |
| 352 | Ga0207648_10004275 | 3300026089 | Bacteria | 14729 |
| 353 | Ga0207676_10269118 | 3300026095 | Bacteria | 1542 |
| 354 | Ga0207674_10043569 | 3300026116 | Bacteria | 4627 |
| 355 | Ga0207675_100099239 | 3300026118 | Bacteria | 2743 |
| 356 | Ga0207675_100582759 | 3300026118 | Bacteria | 1120 |
| 357 | Ga0207675_101107951 | 3300026118 | Unclassified | 811 |
| 358 | Ga0207683_10000656 | 3300026121 | Bacteria | 31727 |
| 359 | Ga0207683_10032205 | 3300026121 | Bacteria | 4554 |
| 360 | Ga0207683_10273733 | 3300026121 | Bacteria | 1542 |
| 361 | Ga0207698_10073970 | 3300026142 | Bacteria | 2716 |
| 362 | Ga0207698_10166420 | 3300026142 | Bacteria | 1936 |
| 363 | Ga0207698_10751398 | 3300026142 | Bacteria | 974 |
| 364 | Ga0209588_1062422 | 3300027671 | Bacteria | 1204 |
| 365 | Ga0209813_10146525 | 3300027866 | Bacteria | 842 |
| 366 | Ga0207428_10001146 | 3300027907 | Bacteria | 28682 |
| 367 | Ga0207428_10004867 | 3300027907 | Bacteria | 12660 |
| 368 | Ga0207428_10011561 | 3300027907 | Bacteria | 7795 |
| 369 | Ga0207428_10256538 | 3300027907 | Bacteria | 1303 |
| 370 | Ga0207428_10652174 | 3300027907 | Unclassified | 755 |
| 371 | Ga0265354_1000001 | 3300028016 | Bacteria | 69318 |
| 372 | Ga0268266_10306050 | 3300028379 | Bacteria | 1484 |
| 373 | Ga0268265_10024206 | 3300028380 | Bacteria | 4293 |
| 374 | Ga0268265_10102482 | 3300028380 | Bacteria | 2315 |
| 375 | Ga0268265_10268552 | 3300028380 | Bacteria | 1520 |
| 376 | Ga0268264_10041824 | 3300028381 | Bacteria | 3792 |
| 377 | Ga0268264_10071916 | 3300028381 | Bacteria | 2932 |
| 378 | Ga0265338_10010510 | 3300028800 | Bacteria | 10834 |
| 379 | Ga0265338_10016808 | 3300028800 | Bacteria | 7925 |
| 380 | Ga0265770_1000014 | 3300030878 | Bacteria | 17275 |
| 381 | Ga0265761_100032 | 3300030889 | Bacteria | 4332 |
| 382 | Ga0265760_10000048 | 3300031090 | Bacteria | 34166 |
| 383 | Ga0265328_10011496 | 3300031239 | Bacteria | 3535 |
| 384 | Ga0265329_10005789 | 3300031242 | Bacteria | 4963 |
| 385 | Ga0265340_10020971 | 3300031247 | Bacteria | 3351 |
| 386 | Ga0265340_10098218 | 3300031247 | Bacteria | 1363 |
| 387 | Ga0265339_10013661 | 3300031249 | Unclassified | 4918 |
| 388 | Ga0265339_10018350 | 3300031249 | Unclassified | 4125 |
| 389 | Ga0265339_10022437 | 3300031249 | Bacteria | 3659 |
| 390 | Ga0265339_10112495 | 3300031249 | Bacteria | 1407 |
| 391 | Ga0265331_10000170 | 3300031250 | Bacteria | 80298 |
| 392 | Ga0265327_10113179 | 3300031251 | Bacteria | 1294 |
| 393 | Ga0265316_10026528 | 3300031344 | Bacteria | 4817 |
| 394 | Ga0265316_10056485 | 3300031344 | Bacteria | 3065 |
| 395 | Ga0265316_10078076 | 3300031344 | Bacteria | 2542 |
| 396 | Ga0265314_10000055 | 3300031711 | Bacteria | 172478 |
| 397 | Ga0265314_10000085 | 3300031711 | Bacteria | 141076 |
| 398 | Ga0265342_10017946 | 3300031712 | Bacteria | 4594 |
| 399 | Ga0316576_10016043 | 3300031727 | Bacteria | 5048 |
| 400 | Ga0316576_10360030 | 3300031727 | Bacteria | 1082 |
| 401 | Ga0316576_10660330 | 3300031727 | Bacteria | 760 |
| 402 | Ga0307413_10414467 | 3300031824 | Bacteria | 1059 |
| 403 | Ga0307406_10632276 | 3300031901 | Unclassified | 886 |
| 404 | Ga0307409_100023403 | 3300031995 | Bacteria | 4280 |
| 405 | Ga0307409_100598962 | 3300031995 | Bacteria | 1089 |
| 406 | Ga0307416_100021775 | 3300032002 | Bacteria | 4611 |
| 407 | Ga0307416_100434369 | 3300032002 | Bacteria | 1361 |
| 408 | Ga0307415_100013884 | 3300032126 | Bacteria | 4716 |
| 409 | Ga0307415_100032153 | 3300032126 | Bacteria | 3390 |
| 410 | Ga0316212_1003243 | 3300033547 | Unclassified | 2342 |
| 411 | Ga0373958_0061402 | 3300034819 | Bacteria | 815 |
| 412 | Ga0373959_0010582 | 3300034820 | Bacteria | 1614 |
| 413 | Ga0373926_0015607 | 3300035083 | Bacteria | 2590 |
| 414 | Ga0373928_0022312 | 3300035084 | Bacteria | 1341 |
| 415 | Ga0373934_0008777 | 3300035086 | Bacteria | 3776 |
| 416 | Ga0373934_0045499 | 3300035086 | Bacteria | 1735 |
| 417 | Ga0373952_0027734 | 3300035092 | Bacteria | 1238 |
| 418 | Ga0373923_0004940 | 3300035111 | Bacteria | 4481 |
| 419 | Ga0373923_0020692 | 3300035111 | Bacteria | 2559 |
| 420 | Ga0373932_0015424 | 3300035112 | Bacteria | 1937 |
| 421 | Ga0373939_0122706 | 3300035114 | Bacteria | 918 |
| 422 | Ga0373953_0004717 | 3300035117 | Bacteria | 4368 |
| 423 | Ga0373953_0031399 | 3300035117 | Bacteria | 2065 |
| 424 | Ga0373954_0000185 | 3300035118 | Bacteria | 22479 |
| 425 | Ga0373954_0078116 | 3300035118 | Bacteria | 1579 |
| 426 | Ga0373954_0167604 | 3300035118 | Bacteria | 1075 |
| 427 | Ga0373956_0001065 | 3300035119 | Bacteria | 11292 |
| 428 | Ga0373956_0001883 | 3300035119 | Bacteria | 8649 |
| 429 | Ga0373957_0002263 | 3300035120 | Bacteria | 5455 |
| 430 | Ga0373957_0114902 | 3300035120 | Bacteria | 1086 |
| 431 | Ga0373960_0022358 | 3300035121 | Bacteria | 1692 |
| 432 | Ga0373946_0300866 | 3300035171 | Bacteria | 793 |
| 433 | Ga0373955_0003757 | 3300035172 | Bacteria | 6689 |
| 434 | Ga0373955_0004289 | 3300035172 | Bacteria | 6298 |
| 435 | Ga0373962_0035602 | 3300035242 | Bacteria | 1383 |
| 436 | Ga0373931_0109284 | 3300035691 | Bacteria | 1566 |
| 437 | Ga0373933_0000687 | 3300035724 | Bacteria | 20877 |
| 438 | Ga0373933_0002728 | 3300035724 | Bacteria | 9875 |
| 439 | Ga0373947_0306069 | 3300035725 | Bacteria | 1060 |
| 440 | Ga0373937_0001049 | 3300036401 | Bacteria | 23345 |
| 441 | Ga0373937_0052272 | 3300036401 | Bacteria | 3745 |
| 442 | Ga0373937_0108407 | 3300036401 | Unclassified | 2582 |
| 443 | Ga0316584_0104764 | 3300036712 | Bacteria | 2117 |
| 444 | Ga0373925_0064860 | 3300037068 | Bacteria | 2750 |
| 445 | Ga0395900_0010042 | 3300037418 | Bacteria | 9686 |
| 446 | Ga0395900_0027333 | 3300037418 | Bacteria | 5843 |
| 447 | Ga0395900_0029311 | 3300037418 | Bacteria | 5647 |
| 448 | Ga0395900_0340040 | 3300037418 | Bacteria | 1477 |
| 449 | Ga0395900_0640172 | 3300037418 | Bacteria | 1001 |
| 450 | Ga0395898_0147639 | 3300037466 | Bacteria | 2250 |
| 451 | Ga0395898_0823151 | 3300037466 | Bacteria | 868 |
| 452 | Ga0395905_0142300 | 3300037471 | Bacteria | 2256 |
| 453 | Ga0395905_0848515 | 3300037471 | Bacteria | 816 |
| 454 | Ga0436364_0542426 | 3300037853 | Bacteria | 11995 |
| 455 | Ga0436364_1044171 | 3300037853 | Bacteria | 1710 |
| 456 | Ga0436364_1491832 | 3300037853 | Bacteria | 1124 |
| 457 | Ga0395901_0150424 | 3300038443 | Bacteria | 2446 |
| 458 | Ga0395901_0243773 | 3300038443 | Bacteria | 1874 |
| 459 | Ga0400489_10885 | 3300039093 | Bacteria | 3237 |
| 460 | Ga0436365_0005710 | 3300039437 | Bacteria | 12375 |
| 461 | Ga0436365_1233321 | 3300039437 | Bacteria | 10038 |
| 462 | Ga0436365_1299942 | 3300039437 | Bacteria | 1326 |
| 463 | Ga0436365_1424879 | 3300039437 | Bacteria | 1445 |
| 464 | Ga0436365_1707059 | 3300039437 | Bacteria | 2903 |
| 465 | Ga0436363_0442447 | 3300039450 | Bacteria | 1275 |
| 466 | Ga0436362_0095080 | 3300039453 | Bacteria | 779 |
| 467 | Ga0436362_0849239 | 3300039453 | Bacteria | 1769 |
| 468 | Ga0439448_0053642 | 3300042005 | Bacteria | 1323 |
| 469 | Ga0439448_0079506 | 3300042005 | Bacteria | 1100 |
| 470 | Ga0439456_045324 | 3300042013 | Unclassified | 957 |
| 471 | Ga0451577_0260174 | 3300042876 | Bacteria | 1571 |
| 472 | Ga0439440_0008622 | 3300042993 | Bacteria | 2098 |
| 473 | Ga0466961_0021383 | 3300044693 | Bacteria | 4165 |
| 474 | Ga0466963_0122413 | 3300044694 | Bacteria | 1791 |
| 475 | Ga0453684_0032584 | 3300044712 | Bacteria | 7289 |
| 476 | Ga0466959_0364017 | 3300045049 | Bacteria | 985 |
| 477 | Ga0451576_0022444 | 3300045051 | Bacteria | 6844 |
| 478 | Ga0451576_0029194 | 3300045051 | Bacteria | 5902 |
| 479 | Ga0451576_0282142 | 3300045051 | Unclassified | 1737 |
| 480 | Ga0451576_0560228 | 3300045051 | Bacteria | 1201 |
| 481 | Ga0451576_0919652 | 3300045051 | Unclassified | 917 |
| 482 | Ga0466967_0302536 | 3300045976 | Bacteria | 1539 |
| 483 | Ga0466967_0368936 | 3300045976 | Bacteria | 1392 |
| 484 | Ga0495592_0347272 | 3300046454 | Bacteria | 952 |
| 485 | Ga0495651_0012431 | 3300046462 | Bacteria | 6566 |
| 486 | Ga0495651_0091997 | 3300046462 | Unclassified | 2272 |
| 487 | Ga0495651_0307613 | 3300046462 | Bacteria | 1061 |
| 488 | Ga0495653_0157407 | 3300046463 | Unclassified | 1581 |
| 489 | Ga0495580_0008087 | 3300046472 | Bacteria | 8390 |
| 490 | Ga0495580_0036468 | 3300046472 | Bacteria | 3530 |
| 491 | Ga0495580_0128850 | 3300046472 | Bacteria | 1756 |
| 492 | Ga0495594_0010816 | 3300046499 | Bacteria | 4741 |
| 493 | Ga0495608_0220543 | 3300046511 | Bacteria | 1190 |
| 494 | Ga0495628_0084756 | 3300046516 | Bacteria | 2459 |
| 495 | Ga0495630_0019033 | 3300046517 | Bacteria | 5047 |
| 496 | Ga0495630_0142772 | 3300046517 | Bacteria | 1821 |
| 497 | Ga0495666_0065256 | 3300046526 | Bacteria | 1737 |
| 498 | Ga0495652_0010246 | 3300046529 | Bacteria | 8500 |
| 499 | Ga0495652_0209657 | 3300046529 | Bacteria | 1472 |
| 500 | Ga0495652_0393676 | 3300046529 | Bacteria | 982 |
| 501 | Ga0495640_0289253 | 3300046533 | Bacteria | 1019 |
| 502 | Ga0495586_0002561 | 3300046535 | Bacteria | 9838 |
| 503 | Ga0495587_0001893 | 3300046536 | Bacteria | 13930 |
| 504 | Ga0495587_0020385 | 3300046536 | Unclassified | 4094 |
| 505 | Ga0495667_0001884 | 3300046559 | Bacteria | 13924 |
| 506 | Ga0495667_0093760 | 3300046559 | Bacteria | 1944 |
| 507 | Ga0495634_0085806 | 3300046642 | Bacteria | 2051 |
| 508 | Ga0495635_0277661 | 3300046663 | Bacteria | 1126 |
| 509 | Ga0495635_0497561 | 3300046663 | Bacteria | 803 |
| 510 | Ga0495657_0005095 | 3300046675 | Bacteria | 10437 |
| 511 | Ga0495657_0352757 | 3300046675 | Bacteria | 870 |
| 512 | Ga0495623_0080363 | 3300046679 | Bacteria | 2018 |
| 513 | Ga0495600_0034566 | 3300046809 | Bacteria | 3282 |
| 514 | Ga0495600_0213525 | 3300046809 | Bacteria | 1236 |
| 515 | Ga0495600_0431472 | 3300046809 | Bacteria | 817 |
| 516 | Ga0495604_0000552 | 3300047317 | Bacteria | 32953 |
| 517 | Ga0495604_0011197 | 3300047317 | Bacteria | 7122 |
| 518 | Ga0495680_0021051 | 3300047322 | Bacteria | 5465 |
| 519 | Ga0495680_0266286 | 3300047322 | Bacteria | 1211 |
| 520 | Ga0495680_0351304 | 3300047322 | Bacteria | 1026 |
| 521 | Ga0495675_0068628 | 3300047444 | Bacteria | 2240 |
| 522 | Ga0495675_0247363 | 3300047444 | Unclassified | 1072 |
| 523 | Ga0495684_0010755 | 3300047471 | Bacteria | 7071 |
| 524 | Ga0495684_0600337 | 3300047471 | Bacteria | 743 |
| 525 | Ga0495602_0001143 | 3300048088 | Bacteria | 25941 |
| 526 | Ga0495602_0038015 | 3300048088 | Unclassified | 4457 |
| 527 | Ga0495602_0078862 | 3300048088 | Bacteria | 2780 |
| 528 | Ga0496102_0076882 | 3300048905 | Bacteria | 3071 |
| 529 | Ga0496102_0712418 | 3300048905 | Bacteria | 926 |
| 530 | Ga0496104_0028492 | 3300048907 | Bacteria | 5176 |
| 531 | Ga0496104_0104825 | 3300048907 | Bacteria | 2710 |
| 532 | Ga0496105_0199403 | 3300048908 | Unclassified | 1634 |
| 533 | Ga0496106_0178711 | 3300048909 | Bacteria | 1684 |
| 534 | Ga0496108_0046747 | 3300048911 | Bacteria | 3617 |
| 535 | Ga0496109_0208561 | 3300048912 | Bacteria | 1837 |
| 536 | Ga0496112_0044433 | 3300048915 | Bacteria | 4353 |
| 537 | Ga0496112_0227531 | 3300048915 | Bacteria | 1820 |
| 538 | Ga0496112_0679423 | 3300048915 | Bacteria | 958 |
| 539 | Ga0496113_0223501 | 3300048916 | Unclassified | 1501 |
| 540 | Ga0496114_0034834 | 3300048917 | Bacteria | 4156 |
| 541 | Ga0496114_0119582 | 3300048917 | Bacteria | 2265 |
| 542 | Ga0496115_0008197 | 3300048918 | Bacteria | 7719 |
| 543 | Ga0496115_0276612 | 3300048918 | Bacteria | 1378 |
| 544 | Ga0496115_0450280 | 3300048918 | Bacteria | 1040 |
| 545 | Ga0496115_0473391 | 3300048918 | Unclassified | 1009 |
| 546 | Ga0496115_0724842 | 3300048918 | Bacteria | 780 |
| 547 | Ga0496121_0668939 | 3300048924 | Unclassified | 630 |
| 548 | Ga0496126_0000133 | 3300048929 | Bacteria | 170029 |
| 549 | Ga0501031_0002236 | 3300049568 | Bacteria | 12239 |
| 550 | Ga0501031_0003090 | 3300049568 | Bacteria | 10654 |
| 551 | Ga0501031_0081395 | 3300049568 | Bacteria | 2111 |
| 552 | Ga0501032_0047169 | 3300049569 | Bacteria | 2910 |
| 553 | Ga0501032_0050542 | 3300049569 | Bacteria | 2804 |
| 554 | Ga0501033_0143517 | 3300049570 | Bacteria | 1726 |
| 555 | Ga0501033_0268749 | 3300049570 | Bacteria | 1206 |
| 556 | Ga0501034_0019019 | 3300049571 | Bacteria | 7036 |
| 557 | Ga0501034_0027063 | 3300049571 | Bacteria | 5834 |
| 558 | Ga0501034_0230993 | 3300049571 | Bacteria | 1799 |
| 559 | Ga0501036_0017029 | 3300049572 | Bacteria | 6074 |
| 560 | Ga0501036_0026293 | 3300049572 | Bacteria | 4911 |
| 561 | Ga0501036_0049642 | 3300049572 | Bacteria | 3553 |
| 562 | Ga0501036_0063532 | 3300049572 | Bacteria | 3126 |
| 563 | Ga0501037_0007462 | 3300049573 | Bacteria | 8001 |
| 564 | Ga0501037_0079057 | 3300049573 | Bacteria | 2387 |
| 565 | Ga0501038_0001645 | 3300049574 | Bacteria | 20810 |
| 566 | Ga0501038_0012321 | 3300049574 | Bacteria | 7812 |
| 567 | Ga0501039_0008675 | 3300049575 | Bacteria | 7743 |
| 568 | Ga0501039_0011022 | 3300049575 | Bacteria | 6887 |
| 569 | Ga0501040_0018577 | 3300049576 | Bacteria | 4616 |
| 570 | Ga0501040_0031942 | 3300049576 | Bacteria | 3560 |
| 571 | Ga0501040_0236124 | 3300049576 | Bacteria | 1302 |
| 572 | Ga0501040_0269690 | 3300049576 | Bacteria | 1215 |
| 573 | Ga0501040_0360108 | 3300049576 | Unclassified | 1042 |
| 574 | Ga0501041_0021121 | 3300049577 | Bacteria | 3900 |
| 575 | Ga0501041_0040524 | 3300049577 | Bacteria | 2827 |
| 576 | Ga0501041_0324646 | 3300049577 | Bacteria | 971 |
| 577 | Ga0501041_0328977 | 3300049577 | Bacteria | 964 |
| 578 | Ga0501042_0003579 | 3300049578 | Bacteria | 9791 |
| 579 | Ga0501042_0050164 | 3300049578 | Bacteria | 2976 |
| 580 | Ga0501042_0109903 | 3300049578 | Bacteria | 1985 |
| 581 | Ga0501043_0095693 | 3300049579 | Bacteria | 2334 |
| 582 | Ga0501043_0212506 | 3300049579 | Bacteria | 1499 |
| 583 | Ga0501046_0054405 | 3300049580 | Unclassified | 3148 |
| 584 | Ga0501046_0104574 | 3300049580 | Bacteria | 2170 |
| 585 | Ga0501047_0000952 | 3300049581 | Bacteria | 29324 |
| 586 | Ga0501048_0006741 | 3300049582 | Bacteria | 8725 |
| 587 | Ga0501048_0044618 | 3300049582 | Bacteria | 3169 |
| 588 | Ga0501068_0176836 | 3300049584 | Bacteria | 1349 |
| 589 | Ga0501069_0237568 | 3300049585 | Bacteria | 1062 |
| 590 | Ga0501071_0028786 | 3300049587 | Bacteria | 3917 |
| 591 | Ga0501071_0029623 | 3300049587 | Bacteria | 3865 |
| 592 | Ga0501071_0652720 | 3300049587 | Bacteria | 810 |
| 593 | Ga0501072_0140182 | 3300049588 | Bacteria | 1928 |
| 594 | Ga0501072_0153574 | 3300049588 | Bacteria | 1836 |
| 595 | Ga0501072_0368409 | 3300049588 | Bacteria | 1140 |
| 596 | Ga0501074_0008614 | 3300049590 | Bacteria | 7386 |
| 597 | Ga0501074_0014379 | 3300049590 | Bacteria | 5760 |
| 598 | Ga0501075_0021831 | 3300049591 | Bacteria | 4670 |
| 599 | Ga0501075_0102223 | 3300049591 | Bacteria | 2177 |
| 600 | Ga0501075_0150532 | 3300049591 | Bacteria | 1774 |
| 601 | Ga0501076_0024645 | 3300049592 | Bacteria | 4653 |
| 602 | Ga0501076_0099274 | 3300049592 | Bacteria | 2345 |
| 603 | Ga0501076_0132441 | 3300049592 | Bacteria | 2022 |
| 604 | Ga0501076_0413746 | 3300049592 | Bacteria | 1109 |
| 605 | Ga0501077_0200916 | 3300049593 | Unclassified | 1266 |
| 606 | Ga0501079_0027584 | 3300049741 | Bacteria | 4356 |
| 607 | Ga0501079_0083301 | 3300049741 | Bacteria | 2474 |
| 608 | Ga0501079_0127601 | 3300049741 | Bacteria | 1979 |
| 609 | Ga0501079_0423045 | 3300049741 | Bacteria | 1046 |
| 610 | Ga0501080_0465860 | 3300049742 | Bacteria | 1132 |
| 611 | Ga0501081_0007740 | 3300049743 | Bacteria | 6966 |
| 612 | Ga0501083_0011798 | 3300049744 | Bacteria | 6123 |
| 613 | Ga0501035_0001026 | 3300049822 | Bacteria | 29397 |
| 614 | Ga0501035_0041891 | 3300049822 | Bacteria | 4132 |
| 615 | Ga0501035_0281263 | 3300049822 | Bacteria | 1406 |
| 616 | Ga0501044_0010581 | 3300049823 | Bacteria | 10008 |
| 617 | Ga0501045_0008684 | 3300049824 | Bacteria | 7084 |
| 618 | Ga0501045_0091910 | 3300049824 | Bacteria | 2244 |
| 619 | Ga0501045_0181144 | 3300049824 | Bacteria | 1570 |
| 620 | nmdc:mga03683_19808_c1 | 3300050489 | Bacteria | 2573 |
| 621 | nmdc:mga03683_9861_c1 | 3300050489 | Bacteria | 3410 |
| 622 | nmdc:mga00v17_4339_c1 | 3300050491 | Bacteria | 7367 |
| 623 | nmdc:mga0yw44_25129_c1 | 3300050492 | Bacteria | 3381 |
| 624 | nmdc:mga0yw44_323603_c1 | 3300050492 | Bacteria | 1036 |
| 625 | nmdc:mga0yw44_40085_c1 | 3300050492 | Bacteria | 2780 |
| 626 | nmdc:mga0yw44_58548_c1 | 3300050492 | Bacteria | 2354 |
| 627 | nmdc:mga0yw44_64381_c2 | 3300050492 | Bacteria | 1299 |
| 628 | nmdc:mga0k408_413156_c1 | 3300050493 | Bacteria | 803 |
| 629 | nmdc:mga06z11_34674_c1 | 3300050494 | Bacteria | 2479 |
| 630 | nmdc:mga06z11_508_c1 | 3300050494 | Bacteria | 14366 |
| 631 | nmdc:mga05p37_2559_c1 | 3300050507 | Bacteria | 21147 |
| 632 | nmdc:mga05p37_40233_c1 | 3300050507 | Bacteria | 5741 |
| 633 | nmdc:mga05p37_461435_c1 | 3300050507 | Unclassified | 1468 |
| 634 | nmdc:mga05p37_726433_c1 | 3300050507 | Bacteria | 1099 |
| 635 | nmdc:mga05p37_83262_c1 | 3300050507 | Bacteria | 3941 |
| 636 | nmdc:mga09592_13661_c1 | 3300050508 | Bacteria | 6636 |
| 637 | nmdc:mga09592_18367_c1 | 3300050508 | Bacteria | 5734 |
| 638 | nmdc:mga09592_545448_c1 | 3300050508 | Bacteria | 996 |
| 639 | nmdc:mga0qj67_7399_c1 | 3300050509 | Bacteria | 8117 |
| 640 | nmdc:mga06r32_130054_c1 | 3300050510 | Unclassified | 2489 |
| 641 | nmdc:mga06r32_16178_c1 | 3300050510 | Bacteria | 6795 |
| 642 | nmdc:mga06r32_304484_c1 | 3300050510 | Bacteria | 1579 |
| 643 | nmdc:mga06r32_40284_c1 | 3300050510 | Bacteria | 4434 |
| 644 | nmdc:mga08y16_12520_c1 | 3300050511 | Bacteria | 8924 |
| 645 | nmdc:mga08y16_14033_c1 | 3300050511 | Bacteria | 8433 |
| 646 | nmdc:mga08y16_1589_c1 | 3300050511 | Bacteria | 22934 |
| 647 | nmdc:mga08y16_673125_c1 | 3300050511 | Bacteria | 1037 |
| 648 | nmdc:mga08y16_844093_c1 | 3300050511 | Bacteria | 906 |
| 649 | nmdc:mga0n895_10616_c1 | 3300050512 | Bacteria | 8153 |
| 650 | nmdc:mga0n895_196578_c1 | 3300050512 | Bacteria | 2048 |
| 651 | nmdc:mga0n895_60836_c1 | 3300050512 | Unclassified | 3727 |
| 652 | nmdc:mga0rr50_130132_c1 | 3300050513 | Unclassified | 2014 |
| 653 | nmdc:mga0rr50_265580_c1 | 3300050513 | Bacteria | 1429 |
| 654 | nmdc:mga0rr50_76521_c1 | 3300050513 | Unclassified | 2569 |
| 655 | nmdc:mga0a205_395321_c1 | 3300050515 | Unclassified | 1246 |
| 656 | nmdc:mga0a205_510004_c1 | 3300050515 | Bacteria | 1059 |
| 657 | Ga0495595_0084999 | 3300053084 | Unclassified | 1512 |
| 658 | Ga0495619_0023907 | 3300053085 | Bacteria | 3918 |
| 659 | Ga0495619_0069045 | 3300053085 | Bacteria | 2361 |
| 660 | Ga0495619_0287256 | 3300053085 | Bacteria | 1140 |
| 661 | Ga0500641_0095845 | 3300053096 | Bacteria | 1269 |
| 662 | Ga0501084_0002580 | 3300054114 | Bacteria | 14598 |
| 663 | Ga0501084_0218783 | 3300054114 | Bacteria | 1607 |
| 664 | Ga0501084_0335295 | 3300054114 | Bacteria | 1277 |
| 665 | Ga0501084_0646121 | 3300054114 | Bacteria | 893 |
| 666 | Ga0501084_0732947 | 3300054114 | Bacteria | 833 |
| 667 | Ga0501082_0026465 | 3300060353 | Bacteria | 4999 |
| 668 | Ga0501082_0359937 | 3300060353 | Bacteria | 1269 |
| 669 | Ga0530510_0085359 | 3300061734 | Unclassified | 2300 |
| 670 | Ga0530510_0397854 | 3300061734 | Bacteria | 1038 |
| 671 | Ga0530510_0465495 | 3300061734 | Unclassified | 957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0668939 | Ga0496121_0668939_21_560 | 178 |
| 2 | 3300045051 | Ga0451576_0919652 | Ga0451576_0919652_11_586 | 183 |
| 3 | 3300005290 | Ga0065712_10241463 | Ga0065712_102414632 | 191 |
| 4 | 3300049569 | Ga0501032_0050542 | Ga0501032_0050542_1792_2409 | 193 |
| 5 | 3300049572 | Ga0501036_0063532 | Ga0501036_0063532_1993_2610 | 193 |
| 6 | 3300049573 | Ga0501037_0079057 | Ga0501037_0079057_1051_1668 | 193 |
| 7 | 3300049575 | Ga0501039_0011022 | Ga0501039_0011022_4369_4986 | 193 |
| 8 | 3300049576 | Ga0501040_0269690 | Ga0501040_0269690_390_1007 | 193 |
| 9 | 3300049577 | Ga0501041_0324646 | Ga0501041_0324646_61_678 | 193 |
| 10 | 3300049578 | Ga0501042_0109903 | Ga0501042_0109903_378_995 | 193 |
| 11 | 3300049587 | Ga0501071_0028786 | Ga0501071_0028786_2352_2969 | 193 |
| 12 | 3300049588 | Ga0501072_0368409 | Ga0501072_0368409_16_633 | 193 |
| 13 | 3300049592 | Ga0501076_0413746 | Ga0501076_0413746_27_644 | 193 |
| 14 | 3300049741 | Ga0501079_0127601 | Ga0501079_0127601_739_1356 | 193 |
| 15 | 3300049824 | Ga0501045_0181144 | Ga0501045_0181144_872_1489 | 193 |
| 16 | 3300045049 | Ga0466959_0364017 | Ga0466959_0364017_17_613 | 197 |
| 17 | 3300039437 | Ga0436365_1233321 | Ga0436365_1233321_7414_8013 | 198 |
| 18 | 3300039450 | Ga0436363_0442447 | Ga0436363_0442447_196_795 | 198 |
| 19 | 3300039453 | Ga0436362_0095080 | Ga0436362_0095080_45_644 | 198 |
| 20 | 3300054114 | Ga0501084_0218783 | Ga0501084_0218783_466_1107 | 199 |
| 21 | 3300060353 | Ga0501082_0359937 | Ga0501082_0359937_287_928 | 199 |
| 22 | 3300005518 | Ga0070699_100371492 | Ga0070699_1003714922 | 200 |
| 23 | 3300045051 | Ga0451576_0029194 | Ga0451576_0029194_5255_5860 | 200 |
| 24 | 3300049591 | Ga0501075_0102223 | Ga0501075_0102223_1264_1959 | 202 |
| 25 | 3300003911 | JGI25405J52794_10010023 | JGI25405J52794_100100232 | 203 |
| 26 | 3300005937 | Ga0081455_10048110 | Ga0081455_100481104 | 203 |
| 27 | 3300049569 | Ga0501032_0047169 | Ga0501032_0047169_2192_2809 | 203 |
| 28 | 3300049570 | Ga0501033_0268749 | Ga0501033_0268749_432_1049 | 203 |
| 29 | 3300049571 | Ga0501034_0230993 | Ga0501034_0230993_553_1170 | 203 |
| 30 | 3300049579 | Ga0501043_0212506 | Ga0501043_0212506_464_1081 | 203 |
| 31 | 3300049581 | Ga0501047_0000952 | Ga0501047_0000952_25817_26434 | 203 |
| 32 | 3300049822 | Ga0501035_0001026 | Ga0501035_0001026_3003_3620 | 203 |
| 33 | 3300049823 | Ga0501044_0010581 | Ga0501044_0010581_1037_1654 | 203 |
| 34 | 3300050511 | nmdc:mga08y16_673125_c1 | nmdc:mga08y16_673125_c1_33_647 | 203 |
| 35 | 3300047471 | Ga0495684_0600337 | Ga0495684_0600337_96_719 | 204 |
| 36 | 3300006844 | Ga0075428_100428076 | Ga0075428_1004280762 | 205 |
| 37 | 3300021384 | Ga0213876_10117308 | Ga0213876_101173082 | 205 |
| 38 | 3300039437 | Ga0436365_1299942 | Ga0436365_1299942_539_1192 | 205 |
| 39 | 3300042005 | Ga0439448_0053642 | Ga0439448_0053642_166_819 | 205 |
| 40 | 3300054114 | Ga0501084_0732947 | Ga0501084_0732947_161_787 | 205 |
| 41 | iso_pu_bacteria | 2687453341 | 2688391510 | 205 |
| 42 | 3300005937 | Ga0081455_10007276 | Ga0081455_100072762 | 206 |
| 43 | 3300005330 | Ga0070690_100132851 | Ga0070690_1001328512 | 207 |
| 44 | 3300005336 | Ga0070680_100229748 | Ga0070680_1002297483 | 207 |
| 45 | 3300005353 | Ga0070669_100051618 | Ga0070669_1000516184 | 207 |
| 46 | 3300005355 | Ga0070671_100351519 | Ga0070671_1003515191 | 207 |
| 47 | 3300005406 | Ga0070703_10021190 | Ga0070703_100211902 | 207 |
| 48 | 3300005438 | Ga0070701_10005385 | Ga0070701_100053854 | 207 |
| 49 | 3300005440 | Ga0070705_100006354 | Ga0070705_1000063542 | 207 |
| 50 | 3300005456 | Ga0070678_100019067 | Ga0070678_1000190673 | 207 |
| 51 | 3300005458 | Ga0070681_10770927 | Ga0070681_107709272 | 207 |
| 52 | 3300005546 | Ga0070696_100041510 | Ga0070696_1000415104 | 207 |
| 53 | 3300005547 | Ga0070693_100063079 | Ga0070693_1000630793 | 207 |
| 54 | 3300005563 | Ga0068855_100218639 | Ga0068855_1002186392 | 207 |
| 55 | 3300005615 | Ga0070702_100041543 | Ga0070702_1000415432 | 207 |
| 56 | 3300005616 | Ga0068852_100130262 | Ga0068852_1001302622 | 207 |
| 57 | 3300005718 | Ga0068866_10024235 | Ga0068866_100242352 | 207 |
| 58 | 3300005844 | Ga0068862_100007312 | Ga0068862_1000073128 | 207 |
| 59 | 3300006237 | Ga0097621_100655105 | Ga0097621_1006551052 | 207 |
| 60 | 3300006881 | Ga0068865_100052498 | Ga0068865_1000524984 | 207 |
| 61 | 3300009174 | Ga0105241_10597691 | Ga0105241_105976912 | 207 |
| 62 | 3300009176 | Ga0105242_10033049 | Ga0105242_100330492 | 207 |
| 63 | 3300009553 | Ga0105249_10221378 | Ga0105249_102213782 | 207 |
| 64 | 3300013297 | Ga0157378_10179418 | Ga0157378_101794182 | 207 |
| 65 | 3300013307 | Ga0157372_10366860 | Ga0157372_103668602 | 207 |
| 66 | 3300013308 | Ga0157375_10044928 | Ga0157375_100449283 | 207 |
| 67 | 3300014326 | Ga0157380_10029405 | Ga0157380_100294053 | 207 |
| 68 | 3300014969 | Ga0157376_10272639 | Ga0157376_102726392 | 207 |
| 69 | 3300017792 | Ga0163161_10026329 | Ga0163161_100263294 | 207 |
| 70 | 3300025899 | Ga0207642_10026825 | Ga0207642_100268252 | 207 |
| 71 | 3300025918 | Ga0207662_10104548 | Ga0207662_101045482 | 207 |
| 72 | 3300025919 | Ga0207657_10049169 | Ga0207657_100491695 | 207 |
| 73 | 3300025933 | Ga0207706_10004239 | Ga0207706_1000423914 | 207 |
| 74 | 3300025934 | Ga0207686_10059554 | Ga0207686_100595542 | 207 |
| 75 | 3300025942 | Ga0207689_10163349 | Ga0207689_101633492 | 207 |
| 76 | 3300025972 | Ga0207668_10067423 | Ga0207668_100674232 | 207 |
| 77 | 3300025986 | Ga0207658_10295072 | Ga0207658_102950722 | 207 |
| 78 | 3300026023 | Ga0207677_10327586 | Ga0207677_103275862 | 207 |
| 79 | 3300026041 | Ga0207639_10058854 | Ga0207639_100588544 | 207 |
| 80 | 3300026075 | Ga0207708_10012143 | Ga0207708_100121434 | 207 |
| 81 | 3300026089 | Ga0207648_10004275 | Ga0207648_100042757 | 207 |
| 82 | 3300026121 | Ga0207683_10032205 | Ga0207683_100322053 | 207 |
| 83 | 3300026142 | Ga0207698_10166420 | Ga0207698_101664202 | 207 |
| 84 | 3300028380 | Ga0268265_10024206 | Ga0268265_100242066 | 207 |
| 85 | 3300048905 | Ga0496102_0712418 | Ga0496102_0712418_72_704 | 207 |
| 86 | 3300048909 | Ga0496106_0178711 | Ga0496106_0178711_468_1100 | 207 |
| 87 | 3300048915 | Ga0496112_0679423 | Ga0496112_0679423_270_902 | 207 |
| 88 | 3300048917 | Ga0496114_0119582 | Ga0496114_0119582_660_1292 | 207 |
| 89 | 3300042013 | Ga0439456_045324 | Ga0439456_045324_93_743 | 208 |
| 90 | 3300046809 | Ga0495600_0431472 | Ga0495600_0431472_131_766 | 208 |
| 91 | 3300005981 | Ga0081538_10001205 | Ga0081538_1000120520 | 209 |
| 92 | 3300005539 | Ga0068853_100747875 | Ga0068853_1007478751 | 210 |
| 93 | 3300006844 | Ga0075428_100027218 | Ga0075428_1000272182 | 210 |
| 94 | 3300026041 | Ga0207639_10126318 | Ga0207639_101263183 | 210 |
| 95 | 3300005337 | Ga0070682_100062412 | Ga0070682_1000624122 | 211 |
| 96 | 3300005434 | Ga0070709_10019638 | Ga0070709_100196382 | 211 |
| 97 | 3300005436 | Ga0070713_100050670 | Ga0070713_1000506702 | 211 |
| 98 | 3300005437 | Ga0070710_10018100 | Ga0070710_100181002 | 211 |
| 99 | 3300005456 | Ga0070678_100074577 | Ga0070678_1000745772 | 211 |
| 100 | 3300005981 | Ga0081538_10004221 | Ga0081538_100042219 | 211 |
| 101 | 3300006163 | Ga0070715_10005686 | Ga0070715_100056862 | 211 |
| 102 | 3300006173 | Ga0070716_100032195 | Ga0070716_1000321952 | 211 |
| 103 | 3300006237 | Ga0097621_100047709 | Ga0097621_1000477092 | 211 |
| 104 | 3300006358 | Ga0068871_100071860 | Ga0068871_1000718602 | 211 |
| 105 | 3300006847 | Ga0075431_100510122 | Ga0075431_1005101222 | 211 |
| 106 | 3300006871 | Ga0075434_100242663 | Ga0075434_1002426632 | 211 |
| 107 | 3300006914 | Ga0075436_100132523 | Ga0075436_1001325231 | 211 |
| 108 | 3300007076 | Ga0075435_100113931 | Ga0075435_1001139312 | 211 |
| 109 | 3300009174 | Ga0105241_10007380 | Ga0105241_100073808 | 211 |
| 110 | 3300014969 | Ga0157376_10044132 | Ga0157376_100441324 | 211 |
| 111 | 3300025906 | Ga0207699_10089416 | Ga0207699_100894162 | 211 |
| 112 | 3300025911 | Ga0207654_10149309 | Ga0207654_101493092 | 211 |
| 113 | 3300025915 | Ga0207693_10058998 | Ga0207693_100589983 | 211 |
| 114 | 3300025916 | Ga0207663_10028343 | Ga0207663_100283432 | 211 |
| 115 | 3300025917 | Ga0207660_10638589 | Ga0207660_106385891 | 211 |
| 116 | 3300025928 | Ga0207700_10076359 | Ga0207700_100763592 | 211 |
| 117 | 3300025929 | Ga0207664_10076006 | Ga0207664_100760063 | 211 |
| 118 | 3300025929 | Ga0207664_10356097 | Ga0207664_103560972 | 211 |
| 119 | 3300025939 | Ga0207665_10057145 | Ga0207665_100571452 | 211 |
| 120 | 3300026121 | Ga0207683_10000656 | Ga0207683_1000065634 | 211 |
| 121 | 3300032002 | Ga0307416_100434369 | Ga0307416_1004343692 | 211 |
| 122 | 3300034819 | Ga0373958_0061402 | Ga0373958_0061402_54_701 | 211 |
| 123 | 3300034820 | Ga0373959_0010582 | Ga0373959_0010582_661_1308 | 211 |
| 124 | 3300035084 | Ga0373928_0022312 | Ga0373928_0022312_557_1204 | 211 |
| 125 | 3300035092 | Ga0373952_0027734 | Ga0373952_0027734_225_872 | 211 |
| 126 | 3300035112 | Ga0373932_0015424 | Ga0373932_0015424_392_1039 | 211 |
| 127 | 3300035114 | Ga0373939_0122706 | Ga0373939_0122706_195_842 | 211 |
| 128 | 3300035121 | Ga0373960_0022358 | Ga0373960_0022358_231_878 | 211 |
| 129 | 3300035242 | Ga0373962_0035602 | Ga0373962_0035602_560_1207 | 211 |
| 130 | 3300035691 | Ga0373931_0109284 | Ga0373931_0109284_40_687 | 211 |
| 131 | 3300046517 | Ga0495630_0142772 | Ga0495630_0142772_78_731 | 211 |
| 132 | 3300048905 | Ga0496102_0076882 | Ga0496102_0076882_1851_2498 | 211 |
| 133 | 3300048907 | Ga0496104_0028492 | Ga0496104_0028492_2371_3018 | 211 |
| 134 | 3300048912 | Ga0496109_0208561 | Ga0496109_0208561_252_899 | 211 |
| 135 | 3300048918 | Ga0496115_0276612 | Ga0496115_0276612_83_730 | 211 |
| 136 | 3300049568 | Ga0501031_0081395 | Ga0501031_0081395_13_708 | 211 |
| 137 | 3300049570 | Ga0501033_0143517 | Ga0501033_0143517_618_1313 | 211 |
| 138 | 3300049572 | Ga0501036_0017029 | Ga0501036_0017029_1985_2680 | 211 |
| 139 | 3300049574 | Ga0501038_0001645 | Ga0501038_0001645_12220_12915 | 211 |
| 140 | 3300049576 | Ga0501040_0018577 | Ga0501040_0018577_3206_3901 | 211 |
| 141 | 3300049577 | Ga0501041_0040524 | Ga0501041_0040524_1802_2497 | 211 |
| 142 | 3300049578 | Ga0501042_0050164 | Ga0501042_0050164_294_989 | 211 |
| 143 | 3300049585 | Ga0501069_0237568 | Ga0501069_0237568_208_846 | 211 |
| 144 | 3300049587 | Ga0501071_0029623 | Ga0501071_0029623_3109_3804 | 211 |
| 145 | 3300049588 | Ga0501072_0153574 | Ga0501072_0153574_319_1014 | 211 |
| 146 | 3300049590 | Ga0501074_0008614 | Ga0501074_0008614_6001_6696 | 211 |
| 147 | 3300049592 | Ga0501076_0024645 | Ga0501076_0024645_3481_4176 | 211 |
| 148 | 3300049741 | Ga0501079_0083301 | Ga0501079_0083301_1548_2243 | 211 |
| 149 | 3300049744 | Ga0501083_0011798 | Ga0501083_0011798_1294_1932 | 211 |
| 150 | 3300049824 | Ga0501045_0008684 | Ga0501045_0008684_1196_1891 | 211 |
| 151 | 3300050512 | nmdc:mga0n895_196578_c1 | nmdc:mga0n895_196578_c1_832_1479 | 211 |
| 152 | 3300060353 | Ga0501082_0026465 | Ga0501082_0026465_1751_2446 | 211 |
| 153 | 3300005295 | Ga0065707_10328279 | Ga0065707_103282791 | 212 |
| 154 | 3300005545 | Ga0070695_100018447 | Ga0070695_1000184473 | 212 |
| 155 | 3300005577 | Ga0068857_100032762 | Ga0068857_1000327623 | 212 |
| 156 | 3300006051 | Ga0075364_10006234 | Ga0075364_100062343 | 212 |
| 157 | 3300006844 | Ga0075428_100001435 | Ga0075428_10000143515 | 212 |
| 158 | 3300006871 | Ga0075434_100253213 | Ga0075434_1002532132 | 212 |
| 159 | 3300006871 | Ga0075434_100935485 | Ga0075434_1009354852 | 212 |
| 160 | 3300007076 | Ga0075435_100030148 | Ga0075435_1000301484 | 212 |
| 161 | 3300009147 | Ga0114129_11922851 | Ga0114129_119228511 | 212 |
| 162 | 3300009148 | Ga0105243_10843676 | Ga0105243_108436761 | 212 |
| 163 | 3300009551 | Ga0105238_10161886 | Ga0105238_101618862 | 212 |
| 164 | 3300009553 | Ga0105249_10276919 | Ga0105249_102769192 | 212 |
| 165 | 3300013307 | Ga0157372_10081156 | Ga0157372_100811563 | 212 |
| 166 | 3300025909 | Ga0207705_10277283 | Ga0207705_102772832 | 212 |
| 167 | 3300026116 | Ga0207674_10043569 | Ga0207674_100435693 | 212 |
| 168 | 3300026118 | Ga0207675_101107951 | Ga0207675_1011079512 | 212 |
| 169 | 3300026142 | Ga0207698_10751398 | Ga0207698_107513982 | 212 |
| 170 | 3300031242 | Ga0265329_10005789 | Ga0265329_100057894 | 212 |
| 171 | 3300031344 | Ga0265316_10026528 | Ga0265316_100265284 | 212 |
| 172 | 3300031711 | Ga0265314_10000085 | Ga0265314_1000008565 | 212 |
| 173 | 3300035083 | Ga0373926_0015607 | Ga0373926_0015607_1079_1810 | 212 |
| 174 | 3300035725 | Ga0373947_0306069 | Ga0373947_0306069_133_786 | 212 |
| 175 | 3300045051 | Ga0451576_0282142 | Ga0451576_0282142_192_923 | 212 |
| 176 | 3300048908 | Ga0496105_0199403 | Ga0496105_0199403_880_1530 | 212 |
| 177 | 3300048911 | Ga0496108_0046747 | Ga0496108_0046747_294_944 | 212 |
| 178 | 3300048915 | Ga0496112_0044433 | Ga0496112_0044433_2145_2795 | 212 |
| 179 | 3300048916 | Ga0496113_0223501 | Ga0496113_0223501_183_833 | 212 |
| 180 | 3300050489 | nmdc:mga03683_9861_c1 | nmdc:mga03683_9861_c1_560_1210 | 212 |
| 181 | 3300050491 | nmdc:mga00v17_4339_c1 | nmdc:mga00v17_4339_c1_4981_5631 | 212 |
| 182 | 3300050492 | nmdc:mga0yw44_40085_c1 | nmdc:mga0yw44_40085_c1_1198_1848 | 212 |
| 183 | 3300050512 | nmdc:mga0n895_10616_c1 | nmdc:mga0n895_10616_c1_138_788 | 212 |
| 184 | 3300050513 | nmdc:mga0rr50_265580_c1 | nmdc:mga0rr50_265580_c1_436_1086 | 212 |
| 185 | 3300053096 | Ga0500641_0095845 | Ga0500641_0095845_438_1085 | 212 |
| 186 | iso_pu_bacteria | 2913844669 | 2913850642 | 212 |
| 187 | 3300005295 | Ga0065707_10187006 | Ga0065707_101870062 | 213 |
| 188 | 3300005334 | Ga0068869_100100935 | Ga0068869_1001009351 | 213 |
| 189 | 3300005338 | Ga0068868_100106935 | Ga0068868_1001069353 | 213 |
| 190 | 3300005340 | Ga0070689_100008344 | Ga0070689_1000083448 | 213 |
| 191 | 3300005353 | Ga0070669_100110486 | Ga0070669_1001104861 | 213 |
| 192 | 3300005365 | Ga0070688_100002898 | Ga0070688_1000028987 | 213 |
| 193 | 3300005367 | Ga0070667_100048014 | Ga0070667_1000480142 | 213 |
| 194 | 3300005435 | Ga0070714_100002329 | Ga0070714_1000023294 | 213 |
| 195 | 3300005436 | Ga0070713_100342639 | Ga0070713_1003426392 | 213 |
| 196 | 3300005436 | Ga0070713_100564048 | Ga0070713_1005640482 | 213 |
| 197 | 3300005438 | Ga0070701_10009282 | Ga0070701_100092824 | 213 |
| 198 | 3300005441 | Ga0070700_100047353 | Ga0070700_1000473532 | 213 |
| 199 | 3300005455 | Ga0070663_100044385 | Ga0070663_1000443852 | 213 |
| 200 | 3300005456 | Ga0070678_100342982 | Ga0070678_1003429822 | 213 |
| 201 | 3300005458 | Ga0070681_10354250 | Ga0070681_103542502 | 213 |
| 202 | 3300005466 | Ga0070685_10009941 | Ga0070685_100099412 | 213 |
| 203 | 3300005467 | Ga0070706_100247469 | Ga0070706_1002474692 | 213 |
| 204 | 3300005518 | Ga0070699_100459926 | Ga0070699_1004599261 | 213 |
| 205 | 3300005536 | Ga0070697_100011178 | Ga0070697_1000111783 | 213 |
| 206 | 3300005543 | Ga0070672_100211130 | Ga0070672_1002111301 | 213 |
| 207 | 3300005544 | Ga0070686_100085627 | Ga0070686_1000856271 | 213 |
| 208 | 3300005546 | Ga0070696_100353318 | Ga0070696_1003533182 | 213 |
| 209 | 3300005614 | Ga0068856_100016961 | Ga0068856_1000169613 | 213 |
| 210 | 3300005615 | Ga0070702_100068430 | Ga0070702_1000684302 | 213 |
| 211 | 3300005615 | Ga0070702_100071195 | Ga0070702_1000711953 | 213 |
| 212 | 3300005617 | Ga0068859_100074635 | Ga0068859_1000746352 | 213 |
| 213 | 3300005617 | Ga0068859_101293795 | Ga0068859_1012937952 | 213 |
| 214 | 3300005618 | Ga0068864_100269922 | Ga0068864_1002699222 | 213 |
| 215 | 3300005718 | Ga0068866_10134752 | Ga0068866_101347521 | 213 |
| 216 | 3300005841 | Ga0068863_100012608 | Ga0068863_1000126082 | 213 |
| 217 | 3300005841 | Ga0068863_100409943 | Ga0068863_1004099432 | 213 |
| 218 | 3300005842 | Ga0068858_100038547 | Ga0068858_1000385472 | 213 |
| 219 | 3300005844 | Ga0068862_100158421 | Ga0068862_1001584212 | 213 |
| 220 | 3300005844 | Ga0068862_100530321 | Ga0068862_1005303212 | 213 |
| 221 | 3300005937 | Ga0081455_10002146 | Ga0081455_1000214619 | 213 |
| 222 | 3300005981 | Ga0081538_10008456 | Ga0081538_100084563 | 213 |
| 223 | 3300006038 | Ga0075365_10004984 | Ga0075365_100049847 | 213 |
| 224 | 3300006038 | Ga0075365_10011294 | Ga0075365_100112944 | 213 |
| 225 | 3300006038 | Ga0075365_10321058 | Ga0075365_103210581 | 213 |
| 226 | 3300006175 | Ga0070712_100060497 | Ga0070712_1000604972 | 213 |
| 227 | 3300006177 | Ga0075362_10006015 | Ga0075362_100060152 | 213 |
| 228 | 3300006178 | Ga0075367_10000175 | Ga0075367_100001756 | 213 |
| 229 | 3300006178 | Ga0075367_10030118 | Ga0075367_100301184 | 213 |
| 230 | 3300006178 | Ga0075367_10053908 | Ga0075367_100539082 | 213 |
| 231 | 3300006195 | Ga0075366_10007835 | Ga0075366_100078351 | 213 |
| 232 | 3300006844 | Ga0075428_100006634 | Ga0075428_1000066349 | 213 |
| 233 | 3300006844 | Ga0075428_100039042 | Ga0075428_1000390422 | 213 |
| 234 | 3300006846 | Ga0075430_100014302 | Ga0075430_1000143024 | 213 |
| 235 | 3300006846 | Ga0075430_100384582 | Ga0075430_1003845822 | 213 |
| 236 | 3300006847 | Ga0075431_100212793 | Ga0075431_1002127932 | 213 |
| 237 | 3300006852 | Ga0075433_10367640 | Ga0075433_103676402 | 213 |
| 238 | 3300006880 | Ga0075429_100067925 | Ga0075429_1000679254 | 213 |
| 239 | 3300006881 | Ga0068865_100017966 | Ga0068865_1000179662 | 213 |
| 240 | 3300006931 | Ga0097620_100074636 | Ga0097620_1000746363 | 213 |
| 241 | 3300006931 | Ga0097620_101294176 | Ga0097620_1012941762 | 213 |
| 242 | 3300009094 | Ga0111539_10001286 | Ga0111539_100012866 | 213 |
| 243 | 3300009094 | Ga0111539_10261448 | Ga0111539_102614482 | 213 |
| 244 | 3300009098 | Ga0105245_10372484 | Ga0105245_103724841 | 213 |
| 245 | 3300009147 | Ga0114129_10045047 | Ga0114129_100450474 | 213 |
| 246 | 3300009148 | Ga0105243_10087537 | Ga0105243_100875372 | 213 |
| 247 | 3300009176 | Ga0105242_10031232 | Ga0105242_100312322 | 213 |
| 248 | 3300009177 | Ga0105248_10007418 | Ga0105248_100074182 | 213 |
| 249 | 3300009553 | Ga0105249_10286120 | Ga0105249_102861202 | 213 |
| 250 | 3300013308 | Ga0157375_10383398 | Ga0157375_103833982 | 213 |
| 251 | 3300013308 | Ga0157375_10458832 | Ga0157375_104588322 | 213 |
| 252 | 3300014745 | Ga0157377_10027377 | Ga0157377_100273773 | 213 |
| 253 | 3300014968 | Ga0157379_10083279 | Ga0157379_100832792 | 213 |
| 254 | 3300025899 | Ga0207642_10028295 | Ga0207642_100282952 | 213 |
| 255 | 3300025915 | Ga0207693_10000618 | Ga0207693_1000061813 | 213 |
| 256 | 3300025916 | Ga0207663_10000872 | Ga0207663_100008722 | 213 |
| 257 | 3300025918 | Ga0207662_10014902 | Ga0207662_100149024 | 213 |
| 258 | 3300025928 | Ga0207700_10686366 | Ga0207700_106863662 | 213 |
| 259 | 3300025929 | Ga0207664_10015519 | Ga0207664_100155192 | 213 |
| 260 | 3300025936 | Ga0207670_10084660 | Ga0207670_100846603 | 213 |
| 261 | 3300025938 | Ga0207704_10013671 | Ga0207704_100136714 | 213 |
| 262 | 3300025940 | Ga0207691_10132387 | Ga0207691_101323872 | 213 |
| 263 | 3300025942 | Ga0207689_10011002 | Ga0207689_100110022 | 213 |
| 264 | 3300025961 | Ga0207712_10288290 | Ga0207712_102882902 | 213 |
| 265 | 3300026035 | Ga0207703_10050335 | Ga0207703_100503351 | 213 |
| 266 | 3300026041 | Ga0207639_10808061 | Ga0207639_108080612 | 213 |
| 267 | 3300026067 | Ga0207678_10033899 | Ga0207678_100338994 | 213 |
| 268 | 3300026075 | Ga0207708_10018149 | Ga0207708_100181495 | 213 |
| 269 | 3300026078 | Ga0207702_10007673 | Ga0207702_100076735 | 213 |
| 270 | 3300026088 | Ga0207641_10054515 | Ga0207641_100545152 | 213 |
| 271 | 3300026088 | Ga0207641_10984029 | Ga0207641_109840291 | 213 |
| 272 | 3300026095 | Ga0207676_10269118 | Ga0207676_102691182 | 213 |
| 273 | 3300026118 | Ga0207675_100099239 | Ga0207675_1000992392 | 213 |
| 274 | 3300026118 | Ga0207675_100582759 | Ga0207675_1005827591 | 213 |
| 275 | 3300026121 | Ga0207683_10273733 | Ga0207683_102737332 | 213 |
| 276 | 3300027866 | Ga0209813_10146525 | Ga0209813_101465251 | 213 |
| 277 | 3300027907 | Ga0207428_10001146 | Ga0207428_100011462 | 213 |
| 278 | 3300028380 | Ga0268265_10102482 | Ga0268265_101024822 | 213 |
| 279 | 3300028380 | Ga0268265_10268552 | Ga0268265_102685522 | 213 |
| 280 | 3300028381 | Ga0268264_10041824 | Ga0268264_100418242 | 213 |
| 281 | 3300031251 | Ga0265327_10113179 | Ga0265327_101131792 | 213 |
| 282 | 3300036401 | Ga0373937_0108407 | Ga0373937_0108407_1336_1986 | 213 |
| 283 | 3300037418 | Ga0395900_0029311 | Ga0395900_0029311_1559_2218 | 213 |
| 284 | 3300037471 | Ga0395905_0142300 | Ga0395905_0142300_1088_1747 | 213 |
| 285 | 3300038443 | Ga0395901_0150424 | Ga0395901_0150424_696_1355 | 213 |
| 286 | 3300044693 | Ga0466961_0021383 | Ga0466961_0021383_3472_4116 | 213 |
| 287 | 3300045976 | Ga0466967_0302536 | Ga0466967_0302536_45_695 | 213 |
| 288 | 3300046462 | Ga0495651_0091997 | Ga0495651_0091997_944_1594 | 213 |
| 289 | 3300046462 | Ga0495651_0307613 | Ga0495651_0307613_39_689 | 213 |
| 290 | 3300046463 | Ga0495653_0157407 | Ga0495653_0157407_829_1479 | 213 |
| 291 | 3300046529 | Ga0495652_0010246 | Ga0495652_0010246_2888_3538 | 213 |
| 292 | 3300046529 | Ga0495652_0209657 | Ga0495652_0209657_789_1439 | 213 |
| 293 | 3300046536 | Ga0495587_0020385 | Ga0495587_0020385_1383_2033 | 213 |
| 294 | 3300046675 | Ga0495657_0005095 | Ga0495657_0005095_5155_5805 | 213 |
| 295 | 3300046809 | Ga0495600_0213525 | Ga0495600_0213525_558_1208 | 213 |
| 296 | 3300047322 | Ga0495680_0021051 | Ga0495680_0021051_397_1047 | 213 |
| 297 | 3300047444 | Ga0495675_0247363 | Ga0495675_0247363_163_813 | 213 |
| 298 | 3300048088 | Ga0495602_0038015 | Ga0495602_0038015_3767_4417 | 213 |
| 299 | 3300048907 | Ga0496104_0104825 | Ga0496104_0104825_1178_1834 | 213 |
| 300 | 3300048917 | Ga0496114_0034834 | Ga0496114_0034834_1001_1651 | 213 |
| 301 | 3300048918 | Ga0496115_0008197 | Ga0496115_0008197_5731_6381 | 213 |
| 302 | 3300048918 | Ga0496115_0450280 | Ga0496115_0450280_26_676 | 213 |
| 303 | 3300048918 | Ga0496115_0724842 | Ga0496115_0724842_73_729 | 213 |
| 304 | 3300050489 | nmdc:mga03683_19808_c1 | nmdc:mga03683_19808_c1_694_1347 | 213 |
| 305 | 3300050492 | nmdc:mga0yw44_25129_c1 | nmdc:mga0yw44_25129_c1_2701_3354 | 213 |
| 306 | 3300050492 | nmdc:mga0yw44_323603_c1 | nmdc:mga0yw44_323603_c1_157_810 | 213 |
| 307 | 3300050492 | nmdc:mga0yw44_58548_c1 | nmdc:mga0yw44_58548_c1_1557_2210 | 213 |
| 308 | 3300050492 | nmdc:mga0yw44_64381_c2 | nmdc:mga0yw44_64381_c2_544_1197 | 213 |
| 309 | 3300050493 | nmdc:mga0k408_413156_c1 | nmdc:mga0k408_413156_c1_21_674 | 213 |
| 310 | 3300050494 | nmdc:mga06z11_34674_c1 | nmdc:mga06z11_34674_c1_336_989 | 213 |
| 311 | 3300050494 | nmdc:mga06z11_508_c1 | nmdc:mga06z11_508_c1_581_1234 | 213 |
| 312 | 3300050508 | nmdc:mga09592_545448_c1 | nmdc:mga09592_545448_c1_268_921 | 213 |
| 313 | 3300050510 | nmdc:mga06r32_304484_c1 | nmdc:mga06r32_304484_c1_288_980 | 213 |
| 314 | 3300050511 | nmdc:mga08y16_14033_c1 | nmdc:mga08y16_14033_c1_3373_4026 | 213 |
| 315 | 3300050515 | nmdc:mga0a205_395321_c1 | nmdc:mga0a205_395321_c1_351_1013 | 213 |
| 316 | 3300053084 | Ga0495595_0084999 | Ga0495595_0084999_355_1005 | 213 |
| 317 | 3300061734 | Ga0530510_0465495 | Ga0530510_0465495_56_709 | 213 |
| 318 | 3300005341 | Ga0070691_10091770 | Ga0070691_100917702 | 214 |
| 319 | 3300005434 | Ga0070709_10011535 | Ga0070709_100115353 | 214 |
| 320 | 3300005435 | Ga0070714_100168581 | Ga0070714_1001685812 | 214 |
| 321 | 3300005435 | Ga0070714_100601184 | Ga0070714_1006011841 | 214 |
| 322 | 3300005436 | Ga0070713_100019881 | Ga0070713_1000198813 | 214 |
| 323 | 3300005467 | Ga0070706_100020288 | Ga0070706_1000202882 | 214 |
| 324 | 3300005471 | Ga0070698_100006234 | Ga0070698_1000062345 | 214 |
| 325 | 3300005471 | Ga0070698_100089326 | Ga0070698_1000893262 | 214 |
| 326 | 3300005536 | Ga0070697_100001784 | Ga0070697_1000017845 | 214 |
| 327 | 3300005543 | Ga0070672_100006314 | Ga0070672_1000063144 | 214 |
| 328 | 3300005937 | Ga0081455_10035531 | Ga0081455_100355312 | 214 |
| 329 | 3300006195 | Ga0075366_10508030 | Ga0075366_105080302 | 214 |
| 330 | 3300006914 | Ga0075436_100073048 | Ga0075436_1000730482 | 214 |
| 331 | 3300013297 | Ga0157378_10974037 | Ga0157378_109740371 | 214 |
| 332 | 3300013307 | Ga0157372_10647544 | Ga0157372_106475441 | 214 |
| 333 | 3300014969 | Ga0157376_10150049 | Ga0157376_101500492 | 214 |
| 334 | 3300025910 | Ga0207684_10000991 | Ga0207684_1000099112 | 214 |
| 335 | 3300025928 | Ga0207700_10013878 | Ga0207700_100138782 | 214 |
| 336 | 3300025929 | Ga0207664_10237905 | Ga0207664_102379052 | 214 |
| 337 | 3300025929 | Ga0207664_10516830 | Ga0207664_105168302 | 214 |
| 338 | 3300025940 | Ga0207691_10003776 | Ga0207691_100037769 | 214 |
| 339 | 3300036712 | Ga0316584_0104764 | Ga0316584_0104764_1065_1724 | 214 |
| 340 | 3300037418 | Ga0395900_0640172 | Ga0395900_0640172_71_775 | 214 |
| 341 | 3300037466 | Ga0395898_0823151 | Ga0395898_0823151_152_805 | 214 |
| 342 | 3300037471 | Ga0395905_0848515 | Ga0395905_0848515_134_781 | 214 |
| 343 | 3300038443 | Ga0395901_0243773 | Ga0395901_0243773_771_1424 | 214 |
| 344 | 3300044712 | Ga0453684_0032584 | Ga0453684_0032584_1828_2475 | 214 |
| 345 | 3300045051 | Ga0451576_0022444 | Ga0451576_0022444_5433_6080 | 214 |
| 346 | 3300045051 | Ga0451576_0560228 | Ga0451576_0560228_484_1143 | 214 |
| 347 | 3300045976 | Ga0466967_0368936 | Ga0466967_0368936_555_1202 | 214 |
| 348 | 3300046454 | Ga0495592_0347272 | Ga0495592_0347272_138_833 | 214 |
| 349 | 3300046516 | Ga0495628_0084756 | Ga0495628_0084756_97_792 | 214 |
| 350 | 3300049568 | Ga0501031_0002236 | Ga0501031_0002236_8469_9125 | 214 |
| 351 | 3300049568 | Ga0501031_0003090 | Ga0501031_0003090_9257_9910 | 214 |
| 352 | 3300049572 | Ga0501036_0026293 | Ga0501036_0026293_3572_4225 | 214 |
| 353 | 3300049572 | Ga0501036_0049642 | Ga0501036_0049642_1091_1747 | 214 |
| 354 | 3300049573 | Ga0501037_0007462 | Ga0501037_0007462_2035_2691 | 214 |
| 355 | 3300049574 | Ga0501038_0012321 | Ga0501038_0012321_676_1332 | 214 |
| 356 | 3300049575 | Ga0501039_0008675 | Ga0501039_0008675_3113_3769 | 214 |
| 357 | 3300049576 | Ga0501040_0031942 | Ga0501040_0031942_737_1390 | 214 |
| 358 | 3300049576 | Ga0501040_0236124 | Ga0501040_0236124_218_871 | 214 |
| 359 | 3300049576 | Ga0501040_0360108 | Ga0501040_0360108_176_880 | 214 |
| 360 | 3300049577 | Ga0501041_0021121 | Ga0501041_0021121_3067_3723 | 214 |
| 361 | 3300049577 | Ga0501041_0328977 | Ga0501041_0328977_41_694 | 214 |
| 362 | 3300049578 | Ga0501042_0003579 | Ga0501042_0003579_2345_3001 | 214 |
| 363 | 3300049579 | Ga0501043_0095693 | Ga0501043_0095693_1278_1931 | 214 |
| 364 | 3300049580 | Ga0501046_0054405 | Ga0501046_0054405_772_1428 | 214 |
| 365 | 3300049580 | Ga0501046_0104574 | Ga0501046_0104574_1348_2001 | 214 |
| 366 | 3300049582 | Ga0501048_0006741 | Ga0501048_0006741_5853_6509 | 214 |
| 367 | 3300049582 | Ga0501048_0044618 | Ga0501048_0044618_2502_3155 | 214 |
| 368 | 3300049584 | Ga0501068_0176836 | Ga0501068_0176836_292_945 | 214 |
| 369 | 3300049587 | Ga0501071_0652720 | Ga0501071_0652720_103_756 | 214 |
| 370 | 3300049588 | Ga0501072_0140182 | Ga0501072_0140182_25_678 | 214 |
| 371 | 3300049590 | Ga0501074_0014379 | Ga0501074_0014379_5005_5658 | 214 |
| 372 | 3300049591 | Ga0501075_0021831 | Ga0501075_0021831_3022_3675 | 214 |
| 373 | 3300049592 | Ga0501076_0099274 | Ga0501076_0099274_103_756 | 214 |
| 374 | 3300049592 | Ga0501076_0132441 | Ga0501076_0132441_1097_1753 | 214 |
| 375 | 3300049593 | Ga0501077_0200916 | Ga0501077_0200916_324_1028 | 214 |
| 376 | 3300049741 | Ga0501079_0423045 | Ga0501079_0423045_116_769 | 214 |
| 377 | 3300049743 | Ga0501081_0007740 | Ga0501081_0007740_692_1345 | 214 |
| 378 | 3300049822 | Ga0501035_0041891 | Ga0501035_0041891_180_836 | 214 |
| 379 | 3300049822 | Ga0501035_0281263 | Ga0501035_0281263_558_1211 | 214 |
| 380 | 3300049824 | Ga0501045_0091910 | Ga0501045_0091910_1171_1827 | 214 |
| 381 | 3300053085 | Ga0495619_0023907 | Ga0495619_0023907_3027_3722 | 214 |
| 382 | 3300054114 | Ga0501084_0002580 | Ga0501084_0002580_1049_1702 | 214 |
| 383 | 3300054114 | Ga0501084_0335295 | Ga0501084_0335295_220_873 | 214 |
| 384 | 3300061734 | Ga0530510_0085359 | Ga0530510_0085359_716_1372 | 214 |
| 385 | 3300061734 | Ga0530510_0397854 | Ga0530510_0397854_109_762 | 214 |
| 386 | 3300004803 | Ga0058862_12721418 | Ga0058862_127214181 | 215 |
| 387 | 3300005336 | Ga0070680_100020369 | Ga0070680_1000203692 | 215 |
| 388 | 3300005436 | Ga0070713_100261979 | Ga0070713_1002619792 | 215 |
| 389 | 3300005468 | Ga0070707_100031743 | Ga0070707_1000317432 | 215 |
| 390 | 3300005468 | Ga0070707_100219967 | Ga0070707_1002199672 | 215 |
| 391 | 3300005471 | Ga0070698_100171831 | Ga0070698_1001718312 | 215 |
| 392 | 3300005518 | Ga0070699_100039731 | Ga0070699_1000397314 | 215 |
| 393 | 3300005518 | Ga0070699_100244881 | Ga0070699_1002448812 | 215 |
| 394 | 3300005536 | Ga0070697_100006210 | Ga0070697_1000062107 | 215 |
| 395 | 3300005543 | Ga0070672_100001178 | Ga0070672_1000011782 | 215 |
| 396 | 3300005545 | Ga0070695_100318420 | Ga0070695_1003184203 | 215 |
| 397 | 3300005617 | Ga0068859_100190159 | Ga0068859_1001901591 | 215 |
| 398 | 3300006844 | Ga0075428_100037234 | Ga0075428_1000372344 | 215 |
| 399 | 3300006846 | Ga0075430_100002351 | Ga0075430_1000023517 | 215 |
| 400 | 3300006852 | Ga0075433_10199086 | Ga0075433_101990862 | 215 |
| 401 | 3300006931 | Ga0097620_100190159 | Ga0097620_1001901593 | 215 |
| 402 | 3300007265 | Ga0099794_10013910 | Ga0099794_100139103 | 215 |
| 403 | 3300009094 | Ga0111539_10027280 | Ga0111539_100272802 | 215 |
| 404 | 3300009094 | Ga0111539_10035092 | Ga0111539_100350922 | 215 |
| 405 | 3300009094 | Ga0111539_11184394 | Ga0111539_111843942 | 215 |
| 406 | 3300009147 | Ga0114129_10059918 | Ga0114129_100599182 | 215 |
| 407 | 3300009177 | Ga0105248_10492252 | Ga0105248_104922521 | 215 |
| 408 | 3300013105 | Ga0157369_10877711 | Ga0157369_108777112 | 215 |
| 409 | 3300013297 | Ga0157378_10525946 | Ga0157378_105259462 | 215 |
| 410 | 3300013307 | Ga0157372_10113685 | Ga0157372_101136853 | 215 |
| 411 | 3300013307 | Ga0157372_10128905 | Ga0157372_101289052 | 215 |
| 412 | 3300014326 | Ga0157380_10303157 | Ga0157380_103031572 | 215 |
| 413 | 3300020069 | Ga0197907_11462604 | Ga0197907_114626042 | 215 |
| 414 | 3300020076 | Ga0206355_1501835 | Ga0206355_15018352 | 215 |
| 415 | 3300020610 | Ga0154015_1242848 | Ga0154015_12428482 | 215 |
| 416 | 3300021361 | Ga0213872_10002845 | Ga0213872_100028457 | 215 |
| 417 | 3300025912 | Ga0207707_10308148 | Ga0207707_103081481 | 215 |
| 418 | 3300025922 | Ga0207646_10006236 | Ga0207646_100062367 | 215 |
| 419 | 3300025922 | Ga0207646_10052302 | Ga0207646_100523022 | 215 |
| 420 | 3300025928 | Ga0207700_10046593 | Ga0207700_100465933 | 215 |
| 421 | 3300025928 | Ga0207700_10159708 | Ga0207700_101597082 | 215 |
| 422 | 3300025940 | Ga0207691_10021463 | Ga0207691_100214632 | 215 |
| 423 | 3300027671 | Ga0209588_1062422 | Ga0209588_10624221 | 215 |
| 424 | 3300027907 | Ga0207428_10004867 | Ga0207428_100048678 | 215 |
| 425 | 3300027907 | Ga0207428_10011561 | Ga0207428_100115613 | 215 |
| 426 | 3300027907 | Ga0207428_10652174 | Ga0207428_106521741 | 215 |
| 427 | 3300028016 | Ga0265354_1000001 | Ga0265354_10000019 | 215 |
| 428 | 3300028800 | Ga0265338_10010510 | Ga0265338_100105102 | 215 |
| 429 | 3300028800 | Ga0265338_10016808 | Ga0265338_100168087 | 215 |
| 430 | 3300030878 | Ga0265770_1000014 | Ga0265770_100001411 | 215 |
| 431 | 3300031090 | Ga0265760_10000048 | Ga0265760_1000004823 | 215 |
| 432 | 3300031247 | Ga0265340_10020971 | Ga0265340_100209713 | 215 |
| 433 | 3300031247 | Ga0265340_10098218 | Ga0265340_100982181 | 215 |
| 434 | 3300031249 | Ga0265339_10013661 | Ga0265339_100136616 | 215 |
| 435 | 3300031249 | Ga0265339_10018350 | Ga0265339_100183503 | 215 |
| 436 | 3300031249 | Ga0265339_10022437 | Ga0265339_100224373 | 215 |
| 437 | 3300031249 | Ga0265339_10112495 | Ga0265339_101124951 | 215 |
| 438 | 3300031344 | Ga0265316_10056485 | Ga0265316_100564852 | 215 |
| 439 | 3300031344 | Ga0265316_10078076 | Ga0265316_100780762 | 215 |
| 440 | 3300031711 | Ga0265314_10000055 | Ga0265314_1000005590 | 215 |
| 441 | 3300031712 | Ga0265342_10017946 | Ga0265342_100179463 | 215 |
| 442 | 3300033547 | Ga0316212_1003243 | Ga0316212_10032432 | 215 |
| 443 | 3300035118 | Ga0373954_0167604 | Ga0373954_0167604_164_814 | 215 |
| 444 | 3300037418 | Ga0395900_0010042 | Ga0395900_0010042_51_701 | 215 |
| 445 | 3300037466 | Ga0395898_0147639 | Ga0395898_0147639_1256_1906 | 215 |
| 446 | 3300037853 | Ga0436364_1044171 | Ga0436364_1044171_323_973 | 215 |
| 447 | 3300039093 | Ga0400489_10885 | Ga0400489_10885_1101_1757 | 215 |
| 448 | 3300044694 | Ga0466963_0122413 | Ga0466963_0122413_1083_1733 | 215 |
| 449 | 3300046472 | Ga0495580_0036468 | Ga0495580_0036468_1621_2271 | 215 |
| 450 | 3300046499 | Ga0495594_0010816 | Ga0495594_0010816_2854_3546 | 215 |
| 451 | 3300048088 | Ga0495602_0078862 | Ga0495602_0078862_650_1300 | 215 |
| 452 | 3300048915 | Ga0496112_0227531 | Ga0496112_0227531_382_1032 | 215 |
| 453 | 3300048918 | Ga0496115_0473391 | Ga0496115_0473391_127_777 | 215 |
| 454 | 3300049571 | Ga0501034_0019019 | Ga0501034_0019019_161_811 | 215 |
| 455 | 3300049571 | Ga0501034_0027063 | Ga0501034_0027063_3796_4446 | 215 |
| 456 | 3300049741 | Ga0501079_0027584 | Ga0501079_0027584_1405_2058 | 215 |
| 457 | 3300049742 | Ga0501080_0465860 | Ga0501080_0465860_271_924 | 215 |
| 458 | 3300050507 | nmdc:mga05p37_40233_c1 | nmdc:mga05p37_40233_c1_3371_4021 | 215 |
| 459 | 3300050508 | nmdc:mga09592_13661_c1 | nmdc:mga09592_13661_c1_1477_2127 | 215 |
| 460 | 3300050510 | nmdc:mga06r32_16178_c1 | nmdc:mga06r32_16178_c1_1757_2407 | 215 |
| 461 | 3300050511 | nmdc:mga08y16_12520_c1 | nmdc:mga08y16_12520_c1_3408_4058 | 215 |
| 462 | 3300050511 | nmdc:mga08y16_1589_c1 | nmdc:mga08y16_1589_c1_21237_21887 | 215 |
| 463 | 3300050511 | nmdc:mga08y16_844093_c1 | nmdc:mga08y16_844093_c1_88_738 | 215 |
| 464 | 3300050512 | nmdc:mga0n895_60836_c1 | nmdc:mga0n895_60836_c1_2178_2828 | 215 |
| 465 | 3300050513 | nmdc:mga0rr50_76521_c1 | nmdc:mga0rr50_76521_c1_50_700 | 215 |
| 466 | 3300054114 | Ga0501084_0646121 | Ga0501084_0646121_28_681 | 215 |
| 467 | 3300003320 | rootH2_10323060 | rootH2_103230601 | 216 |
| 468 | 3300003911 | JGI25405J52794_10000050 | JGI25405J52794_1000005011 | 216 |
| 469 | 3300003911 | JGI25405J52794_10000986 | JGI25405J52794_100009862 | 216 |
| 470 | 3300005329 | Ga0070683_100157677 | Ga0070683_1001576772 | 216 |
| 471 | 3300005334 | Ga0068869_100104670 | Ga0068869_1001046701 | 216 |
| 472 | 3300005336 | Ga0070680_100001666 | Ga0070680_1000016668 | 216 |
| 473 | 3300005336 | Ga0070680_100531453 | Ga0070680_1005314532 | 216 |
| 474 | 3300005340 | Ga0070689_100356674 | Ga0070689_1003566742 | 216 |
| 475 | 3300005343 | Ga0070687_100129270 | Ga0070687_1001292702 | 216 |
| 476 | 3300005344 | Ga0070661_100074818 | Ga0070661_1000748181 | 216 |
| 477 | 3300005356 | Ga0070674_100469463 | Ga0070674_1004694631 | 216 |
| 478 | 3300005365 | Ga0070688_100675060 | Ga0070688_1006750601 | 216 |
| 479 | 3300005367 | Ga0070667_100491503 | Ga0070667_1004915031 | 216 |
| 480 | 3300005434 | Ga0070709_10083013 | Ga0070709_100830132 | 216 |
| 481 | 3300005435 | Ga0070714_100000541 | Ga0070714_1000005413 | 216 |
| 482 | 3300005437 | Ga0070710_10055258 | Ga0070710_100552582 | 216 |
| 483 | 3300005439 | Ga0070711_100049701 | Ga0070711_1000497013 | 216 |
| 484 | 3300005439 | Ga0070711_100545258 | Ga0070711_1005452581 | 216 |
| 485 | 3300005440 | Ga0070705_100004605 | Ga0070705_1000046055 | 216 |
| 486 | 3300005445 | Ga0070708_100020381 | Ga0070708_1000203814 | 216 |
| 487 | 3300005445 | Ga0070708_100105514 | Ga0070708_1001055142 | 216 |
| 488 | 3300005445 | Ga0070708_100196209 | Ga0070708_1001962092 | 216 |
| 489 | 3300005456 | Ga0070678_100110671 | Ga0070678_1001106712 | 216 |
| 490 | 3300005458 | Ga0070681_10004741 | Ga0070681_100047415 | 216 |
| 491 | 3300005458 | Ga0070681_10091616 | Ga0070681_100916164 | 216 |
| 492 | 3300005459 | Ga0068867_100334694 | Ga0068867_1003346942 | 216 |
| 493 | 3300005467 | Ga0070706_100000225 | Ga0070706_10000022537 | 216 |
| 494 | 3300005467 | Ga0070706_100162951 | Ga0070706_1001629512 | 216 |
| 495 | 3300005467 | Ga0070706_100248571 | Ga0070706_1002485712 | 216 |
| 496 | 3300005467 | Ga0070706_100407335 | Ga0070706_1004073352 | 216 |
| 497 | 3300005468 | Ga0070707_100010108 | Ga0070707_1000101082 | 216 |
| 498 | 3300005468 | Ga0070707_100187464 | Ga0070707_1001874642 | 216 |
| 499 | 3300005471 | Ga0070698_100003041 | Ga0070698_1000030412 | 216 |
| 500 | 3300005471 | Ga0070698_100076055 | Ga0070698_1000760555 | 216 |
| 501 | 3300005471 | Ga0070698_100093274 | Ga0070698_1000932744 | 216 |
| 502 | 3300005518 | Ga0070699_100232462 | Ga0070699_1002324622 | 216 |
| 503 | 3300005530 | Ga0070679_100000118 | Ga0070679_10000011844 | 216 |
| 504 | 3300005535 | Ga0070684_100258458 | Ga0070684_1002584582 | 216 |
| 505 | 3300005536 | Ga0070697_100000805 | Ga0070697_1000008052 | 216 |
| 506 | 3300005536 | Ga0070697_100076282 | Ga0070697_1000762823 | 216 |
| 507 | 3300005536 | Ga0070697_100456172 | Ga0070697_1004561722 | 216 |
| 508 | 3300005544 | Ga0070686_100071144 | Ga0070686_1000711443 | 216 |
| 509 | 3300005544 | Ga0070686_100282232 | Ga0070686_1002822322 | 216 |
| 510 | 3300005546 | Ga0070696_100054650 | Ga0070696_1000546503 | 216 |
| 511 | 3300005546 | Ga0070696_100394994 | Ga0070696_1003949942 | 216 |
| 512 | 3300005549 | Ga0070704_100652687 | Ga0070704_1006526871 | 216 |
| 513 | 3300005563 | Ga0068855_100066070 | Ga0068855_1000660704 | 216 |
| 514 | 3300005577 | Ga0068857_100997100 | Ga0068857_1009971002 | 216 |
| 515 | 3300005616 | Ga0068852_100548185 | Ga0068852_1005481852 | 216 |
| 516 | 3300005834 | Ga0068851_10009957 | Ga0068851_100099573 | 216 |
| 517 | 3300005843 | Ga0068860_100025859 | Ga0068860_1000258592 | 216 |
| 518 | 3300005844 | Ga0068862_100060570 | Ga0068862_1000605702 | 216 |
| 519 | 3300005937 | Ga0081455_10000119 | Ga0081455_1000011950 | 216 |
| 520 | 3300005937 | Ga0081455_10004119 | Ga0081455_1000411911 | 216 |
| 521 | 3300005937 | Ga0081455_10010105 | Ga0081455_100101054 | 216 |
| 522 | 3300005937 | Ga0081455_10070838 | Ga0081455_100708382 | 216 |
| 523 | 3300005981 | Ga0081538_10000895 | Ga0081538_100008953 | 216 |
| 524 | 3300006173 | Ga0070716_100104940 | Ga0070716_1001049402 | 216 |
| 525 | 3300006175 | Ga0070712_100032585 | Ga0070712_1000325853 | 216 |
| 526 | 3300006358 | Ga0068871_101070419 | Ga0068871_1010704191 | 216 |
| 527 | 3300006844 | Ga0075428_100023639 | Ga0075428_1000236395 | 216 |
| 528 | 3300006844 | Ga0075428_100173081 | Ga0075428_1001730812 | 216 |
| 529 | 3300006844 | Ga0075428_100434889 | Ga0075428_1004348892 | 216 |
| 530 | 3300006846 | Ga0075430_100003691 | Ga0075430_10000369112 | 216 |
| 531 | 3300006847 | Ga0075431_100023542 | Ga0075431_1000235423 | 216 |
| 532 | 3300006847 | Ga0075431_100030386 | Ga0075431_1000303865 | 216 |
| 533 | 3300006847 | Ga0075431_100083246 | Ga0075431_1000832463 | 216 |
| 534 | 3300006847 | Ga0075431_100087066 | Ga0075431_1000870662 | 216 |
| 535 | 3300006852 | Ga0075433_10021006 | Ga0075433_100210064 | 216 |
| 536 | 3300006871 | Ga0075434_100029911 | Ga0075434_1000299114 | 216 |
| 537 | 3300006880 | Ga0075429_100023013 | Ga0075429_1000230132 | 216 |
| 538 | 3300006880 | Ga0075429_100063054 | Ga0075429_1000630543 | 216 |
| 539 | 3300006880 | Ga0075429_100426980 | Ga0075429_1004269802 | 216 |
| 540 | 3300006881 | Ga0068865_100141463 | Ga0068865_1001414632 | 216 |
| 541 | 3300007076 | Ga0075435_100165301 | Ga0075435_1001653012 | 216 |
| 542 | 3300009093 | Ga0105240_10046154 | Ga0105240_100461545 | 216 |
| 543 | 3300009094 | Ga0111539_10189768 | Ga0111539_101897684 | 216 |
| 544 | 3300009147 | Ga0114129_10000349 | Ga0114129_1000034919 | 216 |
| 545 | 3300009147 | Ga0114129_10041590 | Ga0114129_100415907 | 216 |
| 546 | 3300009147 | Ga0114129_10061088 | Ga0114129_100610882 | 216 |
| 547 | 3300009147 | Ga0114129_10102534 | Ga0114129_101025343 | 216 |
| 548 | 3300009147 | Ga0114129_11150502 | Ga0114129_111505022 | 216 |
| 549 | 3300009176 | Ga0105242_10518696 | Ga0105242_105186962 | 216 |
| 550 | 3300009551 | Ga0105238_10679940 | Ga0105238_106799401 | 216 |
| 551 | 3300010375 | Ga0105239_10011375 | Ga0105239_100113759 | 216 |
| 552 | 3300013100 | Ga0157373_10347301 | Ga0157373_103473011 | 216 |
| 553 | 3300013104 | Ga0157370_10036601 | Ga0157370_100366015 | 216 |
| 554 | 3300013104 | Ga0157370_10485695 | Ga0157370_104856952 | 216 |
| 555 | 3300013105 | Ga0157369_10036658 | Ga0157369_100366583 | 216 |
| 556 | 3300013105 | Ga0157369_10127553 | Ga0157369_101275532 | 216 |
| 557 | 3300013296 | Ga0157374_10151334 | Ga0157374_101513343 | 216 |
| 558 | 3300013297 | Ga0157378_10077152 | Ga0157378_100771524 | 216 |
| 559 | 3300013297 | Ga0157378_10358578 | Ga0157378_103585781 | 216 |
| 560 | 3300014325 | Ga0163163_10044170 | Ga0163163_100441704 | 216 |
| 561 | 3300014326 | Ga0157380_10566229 | Ga0157380_105662291 | 216 |
| 562 | 3300021358 | Ga0213873_10059918 | Ga0213873_100599182 | 216 |
| 563 | 3300021384 | Ga0213876_10010195 | Ga0213876_100101954 | 216 |
| 564 | 3300021388 | Ga0213875_10001697 | Ga0213875_100016974 | 216 |
| 565 | 3300025909 | Ga0207705_10027676 | Ga0207705_100276762 | 216 |
| 566 | 3300025910 | Ga0207684_10000430 | Ga0207684_1000043038 | 216 |
| 567 | 3300025910 | Ga0207684_10179772 | Ga0207684_101797722 | 216 |
| 568 | 3300025912 | Ga0207707_10001675 | Ga0207707_100016759 | 216 |
| 569 | 3300025912 | Ga0207707_10697024 | Ga0207707_106970241 | 216 |
| 570 | 3300025913 | Ga0207695_10058131 | Ga0207695_100581313 | 216 |
| 571 | 3300025915 | Ga0207693_10001108 | Ga0207693_100011088 | 216 |
| 572 | 3300025916 | Ga0207663_10662703 | Ga0207663_106627031 | 216 |
| 573 | 3300025917 | Ga0207660_10006463 | Ga0207660_100064637 | 216 |
| 574 | 3300025917 | Ga0207660_10206627 | Ga0207660_102066271 | 216 |
| 575 | 3300025917 | Ga0207660_10231285 | Ga0207660_102312852 | 216 |
| 576 | 3300025921 | Ga0207652_10002549 | Ga0207652_100025499 | 216 |
| 577 | 3300025922 | Ga0207646_10077784 | Ga0207646_100777842 | 216 |
| 578 | 3300025923 | Ga0207681_10429899 | Ga0207681_104298992 | 216 |
| 579 | 3300025924 | Ga0207694_10308190 | Ga0207694_103081902 | 216 |
| 580 | 3300025936 | Ga0207670_10082276 | Ga0207670_100822762 | 216 |
| 581 | 3300025938 | Ga0207704_10247839 | Ga0207704_102478391 | 216 |
| 582 | 3300025939 | Ga0207665_10131222 | Ga0207665_101312222 | 216 |
| 583 | 3300025944 | Ga0207661_10078286 | Ga0207661_100782862 | 216 |
| 584 | 3300025944 | Ga0207661_10591230 | Ga0207661_105912302 | 216 |
| 585 | 3300025949 | Ga0207667_10308214 | Ga0207667_103082142 | 216 |
| 586 | 3300025986 | Ga0207658_10245048 | Ga0207658_102450482 | 216 |
| 587 | 3300026142 | Ga0207698_10073970 | Ga0207698_100739703 | 216 |
| 588 | 3300027907 | Ga0207428_10256538 | Ga0207428_102565382 | 216 |
| 589 | 3300028379 | Ga0268266_10306050 | Ga0268266_103060502 | 216 |
| 590 | 3300028381 | Ga0268264_10071916 | Ga0268264_100719161 | 216 |
| 591 | 3300030889 | Ga0265761_100032 | Ga0265761_1000322 | 216 |
| 592 | 3300031239 | Ga0265328_10011496 | Ga0265328_100114962 | 216 |
| 593 | 3300031250 | Ga0265331_10000170 | Ga0265331_1000017012 | 216 |
| 594 | 3300031727 | Ga0316576_10016043 | Ga0316576_100160432 | 216 |
| 595 | 3300031727 | Ga0316576_10360030 | Ga0316576_103600302 | 216 |
| 596 | 3300031727 | Ga0316576_10660330 | Ga0316576_106603301 | 216 |
| 597 | 3300031824 | Ga0307413_10414467 | Ga0307413_104144672 | 216 |
| 598 | 3300031901 | Ga0307406_10632276 | Ga0307406_106322762 | 216 |
| 599 | 3300031995 | Ga0307409_100023403 | Ga0307409_1000234032 | 216 |
| 600 | 3300031995 | Ga0307409_100598962 | Ga0307409_1005989622 | 216 |
| 601 | 3300032002 | Ga0307416_100021775 | Ga0307416_1000217752 | 216 |
| 602 | 3300032126 | Ga0307415_100013884 | Ga0307415_1000138844 | 216 |
| 603 | 3300032126 | Ga0307415_100032153 | Ga0307415_1000321532 | 216 |
| 604 | 3300035086 | Ga0373934_0008777 | Ga0373934_0008777_2355_3056 | 216 |
| 605 | 3300035086 | Ga0373934_0045499 | Ga0373934_0045499_417_1106 | 216 |
| 606 | 3300035111 | Ga0373923_0004940 | Ga0373923_0004940_276_929 | 216 |
| 607 | 3300035111 | Ga0373923_0020692 | Ga0373923_0020692_273_962 | 216 |
| 608 | 3300035117 | Ga0373953_0004717 | Ga0373953_0004717_2979_3632 | 216 |
| 609 | 3300035117 | Ga0373953_0031399 | Ga0373953_0031399_1207_1860 | 216 |
| 610 | 3300035118 | Ga0373954_0000185 | Ga0373954_0000185_6786_7475 | 216 |
| 611 | 3300035118 | Ga0373954_0078116 | Ga0373954_0078116_460_1113 | 216 |
| 612 | 3300035119 | Ga0373956_0001065 | Ga0373956_0001065_6633_7286 | 216 |
| 613 | 3300035119 | Ga0373956_0001883 | Ga0373956_0001883_3675_4364 | 216 |
| 614 | 3300035120 | Ga0373957_0002263 | Ga0373957_0002263_2223_2912 | 216 |
| 615 | 3300035120 | Ga0373957_0114902 | Ga0373957_0114902_254_907 | 216 |
| 616 | 3300035171 | Ga0373946_0300866 | Ga0373946_0300866_38_691 | 216 |
| 617 | 3300035172 | Ga0373955_0003757 | Ga0373955_0003757_2615_3304 | 216 |
| 618 | 3300035172 | Ga0373955_0004289 | Ga0373955_0004289_5159_5812 | 216 |
| 619 | 3300035724 | Ga0373933_0000687 | Ga0373933_0000687_14938_15627 | 216 |
| 620 | 3300035724 | Ga0373933_0002728 | Ga0373933_0002728_738_1439 | 216 |
| 621 | 3300036401 | Ga0373937_0001049 | Ga0373937_0001049_16604_17293 | 216 |
| 622 | 3300036401 | Ga0373937_0052272 | Ga0373937_0052272_2558_3211 | 216 |
| 623 | 3300037068 | Ga0373925_0064860 | Ga0373925_0064860_17_670 | 216 |
| 624 | 3300037418 | Ga0395900_0027333 | Ga0395900_0027333_880_1536 | 216 |
| 625 | 3300037418 | Ga0395900_0340040 | Ga0395900_0340040_708_1361 | 216 |
| 626 | 3300037853 | Ga0436364_0542426 | Ga0436364_0542426_10596_11249 | 216 |
| 627 | 3300037853 | Ga0436364_1491832 | Ga0436364_1491832_210_863 | 216 |
| 628 | 3300039437 | Ga0436365_0005710 | Ga0436365_0005710_11185_11838 | 216 |
| 629 | 3300039437 | Ga0436365_1424879 | Ga0436365_1424879_686_1339 | 216 |
| 630 | 3300039437 | Ga0436365_1707059 | Ga0436365_1707059_570_1223 | 216 |
| 631 | 3300039453 | Ga0436362_0849239 | Ga0436362_0849239_359_1012 | 216 |
| 632 | 3300042005 | Ga0439448_0079506 | Ga0439448_0079506_238_918 | 216 |
| 633 | 3300042876 | Ga0451577_0260174 | Ga0451577_0260174_690_1343 | 216 |
| 634 | 3300042993 | Ga0439440_0008622 | Ga0439440_0008622_1143_1820 | 216 |
| 635 | 3300046462 | Ga0495651_0012431 | Ga0495651_0012431_1898_2551 | 216 |
| 636 | 3300046472 | Ga0495580_0008087 | Ga0495580_0008087_1551_2225 | 216 |
| 637 | 3300046472 | Ga0495580_0128850 | Ga0495580_0128850_186_839 | 216 |
| 638 | 3300046511 | Ga0495608_0220543 | Ga0495608_0220543_390_1079 | 216 |
| 639 | 3300046517 | Ga0495630_0019033 | Ga0495630_0019033_612_1313 | 216 |
| 640 | 3300046526 | Ga0495666_0065256 | Ga0495666_0065256_141_794 | 216 |
| 641 | 3300046529 | Ga0495652_0393676 | Ga0495652_0393676_181_870 | 216 |
| 642 | 3300046533 | Ga0495640_0289253 | Ga0495640_0289253_14_715 | 216 |
| 643 | 3300046535 | Ga0495586_0002561 | Ga0495586_0002561_464_1165 | 216 |
| 644 | 3300046536 | Ga0495587_0001893 | Ga0495587_0001893_9571_10260 | 216 |
| 645 | 3300046559 | Ga0495667_0001884 | Ga0495667_0001884_6587_7240 | 216 |
| 646 | 3300046559 | Ga0495667_0093760 | Ga0495667_0093760_251_940 | 216 |
| 647 | 3300046642 | Ga0495634_0085806 | Ga0495634_0085806_421_1122 | 216 |
| 648 | 3300046663 | Ga0495635_0277661 | Ga0495635_0277661_417_1076 | 216 |
| 649 | 3300046663 | Ga0495635_0497561 | Ga0495635_0497561_46_747 | 216 |
| 650 | 3300046675 | Ga0495657_0352757 | Ga0495657_0352757_24_683 | 216 |
| 651 | 3300046679 | Ga0495623_0080363 | Ga0495623_0080363_463_1152 | 216 |
| 652 | 3300046809 | Ga0495600_0034566 | Ga0495600_0034566_98_787 | 216 |
| 653 | 3300047317 | Ga0495604_0000552 | Ga0495604_0000552_21425_22114 | 216 |
| 654 | 3300047317 | Ga0495604_0011197 | Ga0495604_0011197_182_835 | 216 |
| 655 | 3300047322 | Ga0495680_0266286 | Ga0495680_0266286_137_790 | 216 |
| 656 | 3300047322 | Ga0495680_0351304 | Ga0495680_0351304_30_683 | 216 |
| 657 | 3300047444 | Ga0495675_0068628 | Ga0495675_0068628_1561_2220 | 216 |
| 658 | 3300047471 | Ga0495684_0010755 | Ga0495684_0010755_287_940 | 216 |
| 659 | 3300048088 | Ga0495602_0001143 | Ga0495602_0001143_8562_9251 | 216 |
| 660 | 3300048929 | Ga0496126_0000133 | Ga0496126_0000133_125065_125718 | 216 |
| 661 | 3300049591 | Ga0501075_0150532 | Ga0501075_0150532_100_783 | 216 |
| 662 | 3300050507 | nmdc:mga05p37_2559_c1 | nmdc:mga05p37_2559_c1_14615_15268 | 216 |
| 663 | 3300050507 | nmdc:mga05p37_461435_c1 | nmdc:mga05p37_461435_c1_173_829 | 216 |
| 664 | 3300050507 | nmdc:mga05p37_726433_c1 | nmdc:mga05p37_726433_c1_273_926 | 216 |
| 665 | 3300050507 | nmdc:mga05p37_83262_c1 | nmdc:mga05p37_83262_c1_1230_1883 | 216 |
| 666 | 3300050508 | nmdc:mga09592_18367_c1 | nmdc:mga09592_18367_c1_2997_3665 | 216 |
| 667 | 3300050509 | nmdc:mga0qj67_7399_c1 | nmdc:mga0qj67_7399_c1_4635_5303 | 216 |
| 668 | 3300050510 | nmdc:mga06r32_130054_c1 | nmdc:mga06r32_130054_c1_650_1303 | 216 |
| 669 | 3300050510 | nmdc:mga06r32_40284_c1 | nmdc:mga06r32_40284_c1_432_1121 | 216 |
| 670 | 3300050513 | nmdc:mga0rr50_130132_c1 | nmdc:mga0rr50_130132_c1_1243_1944 | 216 |
| 671 | 3300050515 | nmdc:mga0a205_510004_c1 | nmdc:mga0a205_510004_c1_391_1044 | 216 |
| 672 | 3300053085 | Ga0495619_0069045 | Ga0495619_0069045_375_1076 | 216 |
| 673 | 3300053085 | Ga0495619_0287256 | Ga0495619_0287256_159_812 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p2t-assembly1.cif.gz_A | bshb from bacillus subtilis complexed with citrate | 0.7825 | 16 | 216 |
| 4ewl-assembly2.cif.gz_A | crystal structure of mshb with glycerol and acetate bound in the active site | 0.7675 | 10 | 171 |
| 1uan-assembly1.cif.gz_A | crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 | 0.7672 | 14 | 216 |
| 1uan-assembly1.cif.gz_B | crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 | 0.767 | 14 | 216 |
| 4xm0-assembly1.cif.gz_C | n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium | 0.7667 | 4 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71311_1_185_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.8623 | 9 | 169 | 3.40.50.10320 |
| 1uanB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.767 | 14 | 216 | 3.40.50.10320 |
| 2ixdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.76 | 12 | 216 | 3.40.50.10320 |
| 3we7B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.7559 | 6 | 211 | 3.40.50.10320 |
| af_P71311_1_185_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.7523 | 9 | 169 | 3.40.50.10320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5B062-F1-model_v4 | PIG-L family deacetylase | 0.9842 | 24 | 216 |
|
| AF-A0A0S8ESC3-F1-model_v4 | GlcNAc-PI de-N-acetylase | 0.9815 | 14 | 216 |
GO:0016811
|
| AF-A0A7K2MV46-F1-model_v4 | PIG-L family deacetylase | 0.9782 | 64 | 216 |
GO:0016137
|
| AF-A0A536HLR8-F1-model_v4 | PIG-L family deacetylase | 0.9778 | 48 | 216 |
|
| AF-A0A2V5QTJ2-F1-model_v4 | PIG-L domain-containing protein | 0.9763 | 68 | 216 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar