F474284

General Info

Members Datasets Scaffolds Average Seq Length
673 315 671 218

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100601184|Ga0070714_1006011841
Length 246
Sequence MEGMGSVRCWLRNRAASPRNRAQCHGRARADMIPLKLNPTTGRLRVLCLGAHSDDIEIGCGGTILRLAEEHPDCEFHWVVFSATGVRASEAARAAQLFAGSRLRNALLKPFRDGYMPWLGAEIKSVFEEELKPLSPDLVLTHYGNDAHQDHRLISQLTWNTFRDHLIFEYEIPKYDGDLGCPGLFVPLDQRQYQVKVQHIMEAFPSQHAKHWFKPETFLSLMRLRGLECVAPAGHAEAFYCRKLIL

Samples

Sample ID Description Type Environment
1 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
2 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.04
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 2.82
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10323060 3300003320 Bacteria 1855
2 JGI25405J52794_10000050 3300003911 Bacteria 13151
3 JGI25405J52794_10000986 3300003911 Bacteria 4493
4 JGI25405J52794_10010023 3300003911 Bacteria 1798
5 Ga0058862_12721418 3300004803 Bacteria 820
6 Ga0065712_10241463 3300005290 Unclassified 983
7 Ga0065707_10187006 3300005295 Bacteria 1383
8 Ga0065707_10328279 3300005295 Bacteria 954
9 Ga0070683_100157677 3300005329 Unclassified 2153
10 Ga0070690_100132851 3300005330 Bacteria 1682
11 Ga0068869_100100935 3300005334 Bacteria 2182
12 Ga0068869_100104670 3300005334 Unclassified 2145
13 Ga0070680_100001666 3300005336 Bacteria 16258
14 Ga0070680_100020369 3300005336 Bacteria 5264
15 Ga0070680_100229748 3300005336 Bacteria 1567
16 Ga0070680_100531453 3300005336 Bacteria 1007
17 Ga0070682_100062412 3300005337 Bacteria 2360
18 Ga0068868_100106935 3300005338 Bacteria 2270
19 Ga0070689_100008344 3300005340 Bacteria 7293
20 Ga0070689_100356674 3300005340 Bacteria 1228
21 Ga0070691_10091770 3300005341 Bacteria 1498
22 Ga0070687_100129270 3300005343 Bacteria 1456
23 Ga0070661_100074818 3300005344 Unclassified 2495
24 Ga0070669_100051618 3300005353 Bacteria 3007
25 Ga0070669_100110486 3300005353 Bacteria 2086
26 Ga0070671_100351519 3300005355 Bacteria 1258
27 Ga0070674_100469463 3300005356 Bacteria 1042
28 Ga0070688_100002898 3300005365 Bacteria 8746
29 Ga0070688_100675060 3300005365 Unclassified 798
30 Ga0070667_100048014 3300005367 Bacteria 3592
31 Ga0070667_100491503 3300005367 Bacteria 1124
32 Ga0070703_10021190 3300005406 Bacteria 1898
33 Ga0070709_10011535 3300005434 Bacteria 4929
34 Ga0070709_10019638 3300005434 Bacteria 3910
35 Ga0070709_10083013 3300005434 Bacteria 2095
36 Ga0070714_100000541 3300005435 Bacteria 27233
37 Ga0070714_100002329 3300005435 Bacteria 13963
38 Ga0070714_100168581 3300005435 Bacteria 1986
39 Ga0070714_100601184 3300005435 Bacteria 1056
40 Ga0070713_100019881 3300005436 Bacteria 5139
41 Ga0070713_100050670 3300005436 Bacteria 3430
42 Ga0070713_100261979 3300005436 Unclassified 1580
43 Ga0070713_100342639 3300005436 Bacteria 1385
44 Ga0070713_100564048 3300005436 Bacteria 1079
45 Ga0070710_10018100 3300005437 Bacteria 3619
46 Ga0070710_10055258 3300005437 Bacteria 2243
47 Ga0070701_10005385 3300005438 Bacteria 5279
48 Ga0070701_10009282 3300005438 Bacteria 4302
49 Ga0070711_100049701 3300005439 Bacteria 2872
50 Ga0070711_100545258 3300005439 Unclassified 961
51 Ga0070705_100004605 3300005440 Archaea 6710
52 Ga0070705_100006354 3300005440 Bacteria 5790
53 Ga0070700_100047353 3300005441 Bacteria 2660
54 Ga0070708_100020381 3300005445 Bacteria 5591
55 Ga0070708_100105514 3300005445 Unclassified 2585
56 Ga0070708_100196209 3300005445 Bacteria 1889
57 Ga0070663_100044385 3300005455 Bacteria 3133
58 Ga0070678_100019067 3300005456 Bacteria 4461
59 Ga0070678_100074577 3300005456 Bacteria 2550
60 Ga0070678_100110671 3300005456 Bacteria 2148
61 Ga0070678_100342982 3300005456 Bacteria 1282
62 Ga0070681_10004741 3300005458 Bacteria 13024
63 Ga0070681_10091616 3300005458 Bacteria 2990
64 Ga0070681_10354250 3300005458 Bacteria 1378
65 Ga0070681_10770927 3300005458 Bacteria 879
66 Ga0068867_100334694 3300005459 Bacteria 1258
67 Ga0070685_10009941 3300005466 Bacteria 4934
68 Ga0070706_100000225 3300005467 Bacteria 69130
69 Ga0070706_100020288 3300005467 Bacteria 6125
70 Ga0070706_100162951 3300005467 Bacteria 2082
71 Ga0070706_100247469 3300005467 Bacteria 1665
72 Ga0070706_100248571 3300005467 Bacteria 1660
73 Ga0070706_100407335 3300005467 Bacteria 1266
74 Ga0070707_100010108 3300005468 Bacteria 8782
75 Ga0070707_100031743 3300005468 Bacteria 5032
76 Ga0070707_100187464 3300005468 Bacteria 2017
77 Ga0070707_100219967 3300005468 Bacteria 1850
78 Ga0070698_100003041 3300005471 Bacteria 18475
79 Ga0070698_100006234 3300005471 Bacteria 12977
80 Ga0070698_100076055 3300005471 Bacteria 3360
81 Ga0070698_100089326 3300005471 Bacteria 3065
82 Ga0070698_100093274 3300005471 Bacteria 2990
83 Ga0070698_100171831 3300005471 Bacteria 2108
84 Ga0070699_100039731 3300005518 Bacteria 4074
85 Ga0070699_100232462 3300005518 Unclassified 1644
86 Ga0070699_100244881 3300005518 Bacteria 1601
87 Ga0070699_100371492 3300005518 Bacteria 1290
88 Ga0070699_100459926 3300005518 Bacteria 1154
89 Ga0070679_100000118 3300005530 Bacteria 62242
90 Ga0070684_100258458 3300005535 Unclassified 1593
91 Ga0070697_100000805 3300005536 Bacteria 23566
92 Ga0070697_100001784 3300005536 Bacteria 16422
93 Ga0070697_100006210 3300005536 Bacteria 9247
94 Ga0070697_100011178 3300005536 Bacteria 7015
95 Ga0070697_100076282 3300005536 Bacteria 2757
96 Ga0070697_100456172 3300005536 Unclassified 1114
97 Ga0068853_100747875 3300005539 Bacteria 934
98 Ga0070672_100001178 3300005543 Bacteria 15987
99 Ga0070672_100006314 3300005543 Bacteria 7950
100 Ga0070672_100211130 3300005543 Bacteria 1626
101 Ga0070686_100071144 3300005544 Bacteria 2276
102 Ga0070686_100085627 3300005544 Bacteria 2097
103 Ga0070686_100282232 3300005544 Unclassified 1225
104 Ga0070695_100018447 3300005545 Unclassified 4237
105 Ga0070695_100318420 3300005545 Bacteria 1155
106 Ga0070696_100041510 3300005546 Bacteria 3178
107 Ga0070696_100054650 3300005546 Bacteria 2783
108 Ga0070696_100353318 3300005546 Bacteria 1139
109 Ga0070696_100394994 3300005546 Bacteria 1081
110 Ga0070693_100063079 3300005547 Bacteria 2159
111 Ga0070704_100652687 3300005549 Unclassified 929
112 Ga0068855_100066070 3300005563 Bacteria 4216
113 Ga0068855_100218639 3300005563 Bacteria 2138
114 Ga0068857_100032762 3300005577 Bacteria 4593
115 Ga0068857_100997100 3300005577 Unclassified 806
116 Ga0068856_100016961 3300005614 Bacteria 7058
117 Ga0070702_100041543 3300005615 Bacteria 2580
118 Ga0070702_100068430 3300005615 Bacteria 2089
119 Ga0070702_100071195 3300005615 Bacteria 2055
120 Ga0068852_100130262 3300005616 Bacteria 2316
121 Ga0068852_100548185 3300005616 Unclassified 1156
122 Ga0068859_100074635 3300005617 Bacteria 3430
123 Ga0068859_100190159 3300005617 Bacteria 2137
124 Ga0068859_101293795 3300005617 Unclassified 803
125 Ga0068864_100269922 3300005618 Bacteria 1585
126 Ga0068866_10024235 3300005718 Bacteria 2833
127 Ga0068866_10134752 3300005718 Bacteria 1410
128 Ga0068851_10009957 3300005834 Unclassified 4426
129 Ga0068863_100012608 3300005841 Bacteria 8154
130 Ga0068863_100409943 3300005841 Bacteria 1326
131 Ga0068858_100038547 3300005842 Bacteria 4433
132 Ga0068860_100025859 3300005843 Bacteria 5662
133 Ga0068862_100007312 3300005844 Bacteria 9168
134 Ga0068862_100060570 3300005844 Unclassified 3252
135 Ga0068862_100158421 3300005844 Bacteria 2019
136 Ga0068862_100530321 3300005844 Bacteria 1122
137 Ga0081455_10000119 3300005937 Bacteria 90937
138 Ga0081455_10002146 3300005937 Bacteria 23521
139 Ga0081455_10004119 3300005937 Bacteria 16443
140 Ga0081455_10007276 3300005937 Bacteria 11682
141 Ga0081455_10010105 3300005937 Bacteria 9622
142 Ga0081455_10035531 3300005937 Bacteria 4451
143 Ga0081455_10048110 3300005937 Bacteria 3687
144 Ga0081455_10070838 3300005937 Unclassified 2893
145 Ga0081538_10000895 3300005981 Bacteria 32274
146 Ga0081538_10001205 3300005981 Bacteria 27126
147 Ga0081538_10004221 3300005981 Bacteria 13339
148 Ga0081538_10008456 3300005981 Bacteria 8730
149 Ga0075365_10004984 3300006038 Bacteria 7112
150 Ga0075365_10011294 3300006038 Bacteria 5246
151 Ga0075365_10321058 3300006038 Bacteria 1090
152 Ga0075364_10006234 3300006051 Bacteria 6992
153 Ga0070715_10005686 3300006163 Bacteria 4181
154 Ga0070716_100032195 3300006173 Bacteria 2858
155 Ga0070716_100104940 3300006173 Bacteria 1740
156 Ga0070712_100032585 3300006175 Bacteria 3520
157 Ga0070712_100060497 3300006175 Bacteria 2671
158 Ga0075362_10006015 3300006177 Bacteria 4492
159 Ga0075367_10000175 3300006178 Bacteria 20774
160 Ga0075367_10030118 3300006178 Bacteria 3109
161 Ga0075367_10053908 3300006178 Bacteria 2384
162 Ga0075366_10007835 3300006195 Bacteria 5908
163 Ga0075366_10508030 3300006195 Bacteria 745
164 Ga0097621_100047709 3300006237 Bacteria 3471
165 Ga0097621_100655105 3300006237 Bacteria 964
166 Ga0068871_100071860 3300006358 Bacteria 2847
167 Ga0068871_101070419 3300006358 Unclassified 753
168 Ga0075428_100001435 3300006844 Bacteria 25450
169 Ga0075428_100006634 3300006844 Bacteria 12872
170 Ga0075428_100023639 3300006844 Bacteria 6803
171 Ga0075428_100027218 3300006844 Bacteria 6329
172 Ga0075428_100037234 3300006844 Bacteria 5357
173 Ga0075428_100039042 3300006844 Bacteria 5225
174 Ga0075428_100173081 3300006844 Bacteria 2339
175 Ga0075428_100428076 3300006844 Unclassified 1418
176 Ga0075428_100434889 3300006844 Bacteria 1406
177 Ga0075430_100002351 3300006846 Bacteria 15719
178 Ga0075430_100003691 3300006846 Bacteria 12859
179 Ga0075430_100014302 3300006846 Bacteria 6762
180 Ga0075430_100384582 3300006846 Bacteria 1158
181 Ga0075431_100023542 3300006847 Bacteria 6303
182 Ga0075431_100030386 3300006847 Bacteria 5565
183 Ga0075431_100083246 3300006847 Bacteria 3303
184 Ga0075431_100087066 3300006847 Unclassified 3224
185 Ga0075431_100212793 3300006847 Bacteria 1974
186 Ga0075431_100510122 3300006847 Bacteria 1193
187 Ga0075433_10021006 3300006852 Bacteria 5469
188 Ga0075433_10199086 3300006852 Unclassified 1781
189 Ga0075433_10367640 3300006852 Bacteria 1270
190 Ga0075434_100029911 3300006871 Bacteria 5361
191 Ga0075434_100242663 3300006871 Bacteria 1822
192 Ga0075434_100253213 3300006871 Bacteria 1780
193 Ga0075434_100935485 3300006871 Unclassified 881
194 Ga0075429_100023013 3300006880 Bacteria 5401
195 Ga0075429_100063054 3300006880 Bacteria 3229
196 Ga0075429_100067925 3300006880 Bacteria 3103
197 Ga0075429_100426980 3300006880 Bacteria 1161
198 Ga0068865_100017966 3300006881 Bacteria 4557
199 Ga0068865_100052498 3300006881 Bacteria 2825
200 Ga0068865_100141463 3300006881 Bacteria 1815
201 Ga0075436_100073048 3300006914 Bacteria 2374
202 Ga0075436_100132523 3300006914 Bacteria 1748
203 Ga0097620_100074636 3300006931 Bacteria 3430
204 Ga0097620_100190159 3300006931 Bacteria 2137
205 Ga0097620_101294176 3300006931 Unclassified 803
206 Ga0075435_100030148 3300007076 Unclassified 4262
207 Ga0075435_100113931 3300007076 Bacteria 2251
208 Ga0075435_100165301 3300007076 Unclassified 1866
209 Ga0099794_10013910 3300007265 Bacteria 3514
210 Ga0105240_10046154 3300009093 Bacteria 5522
211 Ga0111539_10001286 3300009094 Bacteria 33550
212 Ga0111539_10027280 3300009094 Bacteria 6975
213 Ga0111539_10035092 3300009094 Bacteria 6073
214 Ga0111539_10189768 3300009094 Bacteria 2398
215 Ga0111539_10261448 3300009094 Bacteria 2015
216 Ga0111539_11184394 3300009094 Bacteria 888
217 Ga0105245_10372484 3300009098 Bacteria 1420
218 Ga0114129_10000349 3300009147 Bacteria 53637
219 Ga0114129_10041590 3300009147 Bacteria 6474
220 Ga0114129_10045047 3300009147 Bacteria 6202
221 Ga0114129_10059918 3300009147 Bacteria 5322
222 Ga0114129_10061088 3300009147 Bacteria 5267
223 Ga0114129_10102534 3300009147 Bacteria 3957
224 Ga0114129_11150502 3300009147 Bacteria 969
225 Ga0114129_11922851 3300009147 Bacteria 717
226 Ga0105243_10087537 3300009148 Bacteria 2557
227 Ga0105243_10843676 3300009148 Unclassified 907
228 Ga0105241_10007380 3300009174 Bacteria 8088
229 Ga0105241_10597691 3300009174 Bacteria 996
230 Ga0105242_10031232 3300009176 Bacteria 4252
231 Ga0105242_10033049 3300009176 Bacteria 4140
232 Ga0105242_10518696 3300009176 Unclassified 1137
233 Ga0105248_10007418 3300009177 Bacteria 12032
234 Ga0105248_10492252 3300009177 Bacteria 1382
235 Ga0105238_10161886 3300009551 Bacteria 2213
236 Ga0105238_10679940 3300009551 Bacteria 1041
237 Ga0105249_10221378 3300009553 Bacteria 1862
238 Ga0105249_10276919 3300009553 Bacteria 1674
239 Ga0105249_10286120 3300009553 Bacteria 1648
240 Ga0105239_10011375 3300010375 Bacteria 9927
241 Ga0157373_10347301 3300013100 Unclassified 1058
242 Ga0157370_10036601 3300013104 Bacteria 4761
243 Ga0157370_10485695 3300013104 Unclassified 1135
244 Ga0157369_10036658 3300013105 Bacteria 5372
245 Ga0157369_10127553 3300013105 Bacteria 2696
246 Ga0157369_10877711 3300013105 Unclassified 920
247 Ga0157374_10151334 3300013296 Unclassified 2256
248 Ga0157378_10077152 3300013297 Bacteria 3003
249 Ga0157378_10179418 3300013297 Bacteria 1991
250 Ga0157378_10358578 3300013297 Bacteria 1426
251 Ga0157378_10525946 3300013297 Bacteria 1185
252 Ga0157378_10974037 3300013297 Bacteria 881
253 Ga0157372_10081156 3300013307 Bacteria 3670
254 Ga0157372_10113685 3300013307 Bacteria 3103
255 Ga0157372_10128905 3300013307 Unclassified 2910
256 Ga0157372_10366860 3300013307 Bacteria 1678
257 Ga0157372_10647544 3300013307 Bacteria 1231
258 Ga0157375_10044928 3300013308 Bacteria 4297
259 Ga0157375_10383398 3300013308 Bacteria 1572
260 Ga0157375_10458832 3300013308 Bacteria 1440
261 Ga0163163_10044170 3300014325 Unclassified 4371
262 Ga0157380_10029405 3300014326 Bacteria 4200
263 Ga0157380_10303157 3300014326 Bacteria 1473
264 Ga0157380_10566229 3300014326 Bacteria 1118
265 Ga0157377_10027377 3300014745 Bacteria 3060
266 Ga0157379_10083279 3300014968 Bacteria 2867
267 Ga0157376_10044132 3300014969 Bacteria 3662
268 Ga0157376_10150049 3300014969 Bacteria 2101
269 Ga0157376_10272639 3300014969 Bacteria 1590
270 Ga0163161_10026329 3300017792 Bacteria 4120
271 Ga0197907_11462604 3300020069 Bacteria 1472
272 Ga0206355_1501835 3300020076 Bacteria 906
273 Ga0154015_1242848 3300020610 Bacteria 3736
274 Ga0213873_10059918 3300021358 Bacteria 1028
275 Ga0213872_10002845 3300021361 Bacteria 9886
276 Ga0213876_10010195 3300021384 Bacteria 5048
277 Ga0213876_10117308 3300021384 Bacteria 1413
278 Ga0213875_10001697 3300021388 Bacteria 13865
279 Ga0207642_10026825 3300025899 Bacteria 2350
280 Ga0207642_10028295 3300025899 Bacteria 2306
281 Ga0207699_10089416 3300025906 Bacteria 1930
282 Ga0207705_10027676 3300025909 Unclassified 4044
283 Ga0207705_10277283 3300025909 Bacteria 1283
284 Ga0207684_10000430 3300025910 Bacteria 55766
285 Ga0207684_10000991 3300025910 Bacteria 31839
286 Ga0207684_10179772 3300025910 Bacteria 1824
287 Ga0207654_10149309 3300025911 Bacteria 1499
288 Ga0207707_10001675 3300025912 Bacteria 20429
289 Ga0207707_10308148 3300025912 Bacteria 1368
290 Ga0207707_10697024 3300025912 Bacteria 853
291 Ga0207695_10058131 3300025913 Bacteria 4015
292 Ga0207693_10000618 3300025915 Bacteria 31778
293 Ga0207693_10001108 3300025915 Bacteria 24245
294 Ga0207693_10058998 3300025915 Bacteria 3006
295 Ga0207663_10000872 3300025916 Bacteria 13689
296 Ga0207663_10028343 3300025916 Bacteria 3277
297 Ga0207663_10662703 3300025916 Unclassified 824
298 Ga0207660_10006463 3300025917 Bacteria 7599
299 Ga0207660_10206627 3300025917 Bacteria 1536
300 Ga0207660_10231285 3300025917 Bacteria 1454
301 Ga0207660_10638589 3300025917 Bacteria 868
302 Ga0207662_10014902 3300025918 Bacteria 4367
303 Ga0207662_10104548 3300025918 Bacteria 1759
304 Ga0207657_10049169 3300025919 Bacteria 3677
305 Ga0207652_10002549 3300025921 Bacteria 15298
306 Ga0207646_10006236 3300025922 Bacteria 12392
307 Ga0207646_10052302 3300025922 Bacteria 3655
308 Ga0207646_10077784 3300025922 Unclassified 2964
309 Ga0207681_10429899 3300025923 Unclassified 1071
310 Ga0207694_10308190 3300025924 Bacteria 1305
311 Ga0207700_10013878 3300025928 Bacteria 5261
312 Ga0207700_10046593 3300025928 Bacteria 3207
313 Ga0207700_10076359 3300025928 Bacteria 2599
314 Ga0207700_10159708 3300025928 Unclassified 1871
315 Ga0207700_10686366 3300025928 Bacteria 914
316 Ga0207664_10015519 3300025929 Bacteria 5532
317 Ga0207664_10076006 3300025929 Bacteria 2717
318 Ga0207664_10237905 3300025929 Bacteria 1585
319 Ga0207664_10356097 3300025929 Bacteria 1296
320 Ga0207664_10516830 3300025929 Bacteria 1070
321 Ga0207706_10004239 3300025933 Bacteria 13502
322 Ga0207686_10059554 3300025934 Bacteria 2413
323 Ga0207670_10082276 3300025936 Bacteria 2256
324 Ga0207670_10084660 3300025936 Bacteria 2226
325 Ga0207704_10013671 3300025938 Bacteria 4072
326 Ga0207704_10247839 3300025938 Bacteria 1335
327 Ga0207665_10057145 3300025939 Bacteria 2635
328 Ga0207665_10131222 3300025939 Bacteria 1779
329 Ga0207691_10003776 3300025940 Bacteria 14704
330 Ga0207691_10021463 3300025940 Bacteria 6097
331 Ga0207691_10132387 3300025940 Bacteria 2201
332 Ga0207689_10011002 3300025942 Bacteria 7779
333 Ga0207689_10163349 3300025942 Bacteria 1835
334 Ga0207661_10078286 3300025944 Bacteria 2721
335 Ga0207661_10591230 3300025944 Bacteria 1018
336 Ga0207667_10308214 3300025949 Bacteria 1617
337 Ga0207712_10288290 3300025961 Bacteria 1342
338 Ga0207668_10067423 3300025972 Bacteria 2541
339 Ga0207658_10245048 3300025986 Bacteria 1520
340 Ga0207658_10295072 3300025986 Unclassified 1395
341 Ga0207677_10327586 3300026023 Bacteria 1275
342 Ga0207703_10050335 3300026035 Bacteria 3371
343 Ga0207639_10058854 3300026041 Bacteria 2957
344 Ga0207639_10126318 3300026041 Unclassified 2110
345 Ga0207639_10808061 3300026041 Bacteria 874
346 Ga0207678_10033899 3300026067 Bacteria 4447
347 Ga0207708_10012143 3300026075 Bacteria 6422
348 Ga0207708_10018149 3300026075 Bacteria 5295
349 Ga0207702_10007673 3300026078 Bacteria 9173
350 Ga0207641_10054515 3300026088 Bacteria 3393
351 Ga0207641_10984029 3300026088 Unclassified 840
352 Ga0207648_10004275 3300026089 Bacteria 14729
353 Ga0207676_10269118 3300026095 Bacteria 1542
354 Ga0207674_10043569 3300026116 Bacteria 4627
355 Ga0207675_100099239 3300026118 Bacteria 2743
356 Ga0207675_100582759 3300026118 Bacteria 1120
357 Ga0207675_101107951 3300026118 Unclassified 811
358 Ga0207683_10000656 3300026121 Bacteria 31727
359 Ga0207683_10032205 3300026121 Bacteria 4554
360 Ga0207683_10273733 3300026121 Bacteria 1542
361 Ga0207698_10073970 3300026142 Bacteria 2716
362 Ga0207698_10166420 3300026142 Bacteria 1936
363 Ga0207698_10751398 3300026142 Bacteria 974
364 Ga0209588_1062422 3300027671 Bacteria 1204
365 Ga0209813_10146525 3300027866 Bacteria 842
366 Ga0207428_10001146 3300027907 Bacteria 28682
367 Ga0207428_10004867 3300027907 Bacteria 12660
368 Ga0207428_10011561 3300027907 Bacteria 7795
369 Ga0207428_10256538 3300027907 Bacteria 1303
370 Ga0207428_10652174 3300027907 Unclassified 755
371 Ga0265354_1000001 3300028016 Bacteria 69318
372 Ga0268266_10306050 3300028379 Bacteria 1484
373 Ga0268265_10024206 3300028380 Bacteria 4293
374 Ga0268265_10102482 3300028380 Bacteria 2315
375 Ga0268265_10268552 3300028380 Bacteria 1520
376 Ga0268264_10041824 3300028381 Bacteria 3792
377 Ga0268264_10071916 3300028381 Bacteria 2932
378 Ga0265338_10010510 3300028800 Bacteria 10834
379 Ga0265338_10016808 3300028800 Bacteria 7925
380 Ga0265770_1000014 3300030878 Bacteria 17275
381 Ga0265761_100032 3300030889 Bacteria 4332
382 Ga0265760_10000048 3300031090 Bacteria 34166
383 Ga0265328_10011496 3300031239 Bacteria 3535
384 Ga0265329_10005789 3300031242 Bacteria 4963
385 Ga0265340_10020971 3300031247 Bacteria 3351
386 Ga0265340_10098218 3300031247 Bacteria 1363
387 Ga0265339_10013661 3300031249 Unclassified 4918
388 Ga0265339_10018350 3300031249 Unclassified 4125
389 Ga0265339_10022437 3300031249 Bacteria 3659
390 Ga0265339_10112495 3300031249 Bacteria 1407
391 Ga0265331_10000170 3300031250 Bacteria 80298
392 Ga0265327_10113179 3300031251 Bacteria 1294
393 Ga0265316_10026528 3300031344 Bacteria 4817
394 Ga0265316_10056485 3300031344 Bacteria 3065
395 Ga0265316_10078076 3300031344 Bacteria 2542
396 Ga0265314_10000055 3300031711 Bacteria 172478
397 Ga0265314_10000085 3300031711 Bacteria 141076
398 Ga0265342_10017946 3300031712 Bacteria 4594
399 Ga0316576_10016043 3300031727 Bacteria 5048
400 Ga0316576_10360030 3300031727 Bacteria 1082
401 Ga0316576_10660330 3300031727 Bacteria 760
402 Ga0307413_10414467 3300031824 Bacteria 1059
403 Ga0307406_10632276 3300031901 Unclassified 886
404 Ga0307409_100023403 3300031995 Bacteria 4280
405 Ga0307409_100598962 3300031995 Bacteria 1089
406 Ga0307416_100021775 3300032002 Bacteria 4611
407 Ga0307416_100434369 3300032002 Bacteria 1361
408 Ga0307415_100013884 3300032126 Bacteria 4716
409 Ga0307415_100032153 3300032126 Bacteria 3390
410 Ga0316212_1003243 3300033547 Unclassified 2342
411 Ga0373958_0061402 3300034819 Bacteria 815
412 Ga0373959_0010582 3300034820 Bacteria 1614
413 Ga0373926_0015607 3300035083 Bacteria 2590
414 Ga0373928_0022312 3300035084 Bacteria 1341
415 Ga0373934_0008777 3300035086 Bacteria 3776
416 Ga0373934_0045499 3300035086 Bacteria 1735
417 Ga0373952_0027734 3300035092 Bacteria 1238
418 Ga0373923_0004940 3300035111 Bacteria 4481
419 Ga0373923_0020692 3300035111 Bacteria 2559
420 Ga0373932_0015424 3300035112 Bacteria 1937
421 Ga0373939_0122706 3300035114 Bacteria 918
422 Ga0373953_0004717 3300035117 Bacteria 4368
423 Ga0373953_0031399 3300035117 Bacteria 2065
424 Ga0373954_0000185 3300035118 Bacteria 22479
425 Ga0373954_0078116 3300035118 Bacteria 1579
426 Ga0373954_0167604 3300035118 Bacteria 1075
427 Ga0373956_0001065 3300035119 Bacteria 11292
428 Ga0373956_0001883 3300035119 Bacteria 8649
429 Ga0373957_0002263 3300035120 Bacteria 5455
430 Ga0373957_0114902 3300035120 Bacteria 1086
431 Ga0373960_0022358 3300035121 Bacteria 1692
432 Ga0373946_0300866 3300035171 Bacteria 793
433 Ga0373955_0003757 3300035172 Bacteria 6689
434 Ga0373955_0004289 3300035172 Bacteria 6298
435 Ga0373962_0035602 3300035242 Bacteria 1383
436 Ga0373931_0109284 3300035691 Bacteria 1566
437 Ga0373933_0000687 3300035724 Bacteria 20877
438 Ga0373933_0002728 3300035724 Bacteria 9875
439 Ga0373947_0306069 3300035725 Bacteria 1060
440 Ga0373937_0001049 3300036401 Bacteria 23345
441 Ga0373937_0052272 3300036401 Bacteria 3745
442 Ga0373937_0108407 3300036401 Unclassified 2582
443 Ga0316584_0104764 3300036712 Bacteria 2117
444 Ga0373925_0064860 3300037068 Bacteria 2750
445 Ga0395900_0010042 3300037418 Bacteria 9686
446 Ga0395900_0027333 3300037418 Bacteria 5843
447 Ga0395900_0029311 3300037418 Bacteria 5647
448 Ga0395900_0340040 3300037418 Bacteria 1477
449 Ga0395900_0640172 3300037418 Bacteria 1001
450 Ga0395898_0147639 3300037466 Bacteria 2250
451 Ga0395898_0823151 3300037466 Bacteria 868
452 Ga0395905_0142300 3300037471 Bacteria 2256
453 Ga0395905_0848515 3300037471 Bacteria 816
454 Ga0436364_0542426 3300037853 Bacteria 11995
455 Ga0436364_1044171 3300037853 Bacteria 1710
456 Ga0436364_1491832 3300037853 Bacteria 1124
457 Ga0395901_0150424 3300038443 Bacteria 2446
458 Ga0395901_0243773 3300038443 Bacteria 1874
459 Ga0400489_10885 3300039093 Bacteria 3237
460 Ga0436365_0005710 3300039437 Bacteria 12375
461 Ga0436365_1233321 3300039437 Bacteria 10038
462 Ga0436365_1299942 3300039437 Bacteria 1326
463 Ga0436365_1424879 3300039437 Bacteria 1445
464 Ga0436365_1707059 3300039437 Bacteria 2903
465 Ga0436363_0442447 3300039450 Bacteria 1275
466 Ga0436362_0095080 3300039453 Bacteria 779
467 Ga0436362_0849239 3300039453 Bacteria 1769
468 Ga0439448_0053642 3300042005 Bacteria 1323
469 Ga0439448_0079506 3300042005 Bacteria 1100
470 Ga0439456_045324 3300042013 Unclassified 957
471 Ga0451577_0260174 3300042876 Bacteria 1571
472 Ga0439440_0008622 3300042993 Bacteria 2098
473 Ga0466961_0021383 3300044693 Bacteria 4165
474 Ga0466963_0122413 3300044694 Bacteria 1791
475 Ga0453684_0032584 3300044712 Bacteria 7289
476 Ga0466959_0364017 3300045049 Bacteria 985
477 Ga0451576_0022444 3300045051 Bacteria 6844
478 Ga0451576_0029194 3300045051 Bacteria 5902
479 Ga0451576_0282142 3300045051 Unclassified 1737
480 Ga0451576_0560228 3300045051 Bacteria 1201
481 Ga0451576_0919652 3300045051 Unclassified 917
482 Ga0466967_0302536 3300045976 Bacteria 1539
483 Ga0466967_0368936 3300045976 Bacteria 1392
484 Ga0495592_0347272 3300046454 Bacteria 952
485 Ga0495651_0012431 3300046462 Bacteria 6566
486 Ga0495651_0091997 3300046462 Unclassified 2272
487 Ga0495651_0307613 3300046462 Bacteria 1061
488 Ga0495653_0157407 3300046463 Unclassified 1581
489 Ga0495580_0008087 3300046472 Bacteria 8390
490 Ga0495580_0036468 3300046472 Bacteria 3530
491 Ga0495580_0128850 3300046472 Bacteria 1756
492 Ga0495594_0010816 3300046499 Bacteria 4741
493 Ga0495608_0220543 3300046511 Bacteria 1190
494 Ga0495628_0084756 3300046516 Bacteria 2459
495 Ga0495630_0019033 3300046517 Bacteria 5047
496 Ga0495630_0142772 3300046517 Bacteria 1821
497 Ga0495666_0065256 3300046526 Bacteria 1737
498 Ga0495652_0010246 3300046529 Bacteria 8500
499 Ga0495652_0209657 3300046529 Bacteria 1472
500 Ga0495652_0393676 3300046529 Bacteria 982
501 Ga0495640_0289253 3300046533 Bacteria 1019
502 Ga0495586_0002561 3300046535 Bacteria 9838
503 Ga0495587_0001893 3300046536 Bacteria 13930
504 Ga0495587_0020385 3300046536 Unclassified 4094
505 Ga0495667_0001884 3300046559 Bacteria 13924
506 Ga0495667_0093760 3300046559 Bacteria 1944
507 Ga0495634_0085806 3300046642 Bacteria 2051
508 Ga0495635_0277661 3300046663 Bacteria 1126
509 Ga0495635_0497561 3300046663 Bacteria 803
510 Ga0495657_0005095 3300046675 Bacteria 10437
511 Ga0495657_0352757 3300046675 Bacteria 870
512 Ga0495623_0080363 3300046679 Bacteria 2018
513 Ga0495600_0034566 3300046809 Bacteria 3282
514 Ga0495600_0213525 3300046809 Bacteria 1236
515 Ga0495600_0431472 3300046809 Bacteria 817
516 Ga0495604_0000552 3300047317 Bacteria 32953
517 Ga0495604_0011197 3300047317 Bacteria 7122
518 Ga0495680_0021051 3300047322 Bacteria 5465
519 Ga0495680_0266286 3300047322 Bacteria 1211
520 Ga0495680_0351304 3300047322 Bacteria 1026
521 Ga0495675_0068628 3300047444 Bacteria 2240
522 Ga0495675_0247363 3300047444 Unclassified 1072
523 Ga0495684_0010755 3300047471 Bacteria 7071
524 Ga0495684_0600337 3300047471 Bacteria 743
525 Ga0495602_0001143 3300048088 Bacteria 25941
526 Ga0495602_0038015 3300048088 Unclassified 4457
527 Ga0495602_0078862 3300048088 Bacteria 2780
528 Ga0496102_0076882 3300048905 Bacteria 3071
529 Ga0496102_0712418 3300048905 Bacteria 926
530 Ga0496104_0028492 3300048907 Bacteria 5176
531 Ga0496104_0104825 3300048907 Bacteria 2710
532 Ga0496105_0199403 3300048908 Unclassified 1634
533 Ga0496106_0178711 3300048909 Bacteria 1684
534 Ga0496108_0046747 3300048911 Bacteria 3617
535 Ga0496109_0208561 3300048912 Bacteria 1837
536 Ga0496112_0044433 3300048915 Bacteria 4353
537 Ga0496112_0227531 3300048915 Bacteria 1820
538 Ga0496112_0679423 3300048915 Bacteria 958
539 Ga0496113_0223501 3300048916 Unclassified 1501
540 Ga0496114_0034834 3300048917 Bacteria 4156
541 Ga0496114_0119582 3300048917 Bacteria 2265
542 Ga0496115_0008197 3300048918 Bacteria 7719
543 Ga0496115_0276612 3300048918 Bacteria 1378
544 Ga0496115_0450280 3300048918 Bacteria 1040
545 Ga0496115_0473391 3300048918 Unclassified 1009
546 Ga0496115_0724842 3300048918 Bacteria 780
547 Ga0496121_0668939 3300048924 Unclassified 630
548 Ga0496126_0000133 3300048929 Bacteria 170029
549 Ga0501031_0002236 3300049568 Bacteria 12239
550 Ga0501031_0003090 3300049568 Bacteria 10654
551 Ga0501031_0081395 3300049568 Bacteria 2111
552 Ga0501032_0047169 3300049569 Bacteria 2910
553 Ga0501032_0050542 3300049569 Bacteria 2804
554 Ga0501033_0143517 3300049570 Bacteria 1726
555 Ga0501033_0268749 3300049570 Bacteria 1206
556 Ga0501034_0019019 3300049571 Bacteria 7036
557 Ga0501034_0027063 3300049571 Bacteria 5834
558 Ga0501034_0230993 3300049571 Bacteria 1799
559 Ga0501036_0017029 3300049572 Bacteria 6074
560 Ga0501036_0026293 3300049572 Bacteria 4911
561 Ga0501036_0049642 3300049572 Bacteria 3553
562 Ga0501036_0063532 3300049572 Bacteria 3126
563 Ga0501037_0007462 3300049573 Bacteria 8001
564 Ga0501037_0079057 3300049573 Bacteria 2387
565 Ga0501038_0001645 3300049574 Bacteria 20810
566 Ga0501038_0012321 3300049574 Bacteria 7812
567 Ga0501039_0008675 3300049575 Bacteria 7743
568 Ga0501039_0011022 3300049575 Bacteria 6887
569 Ga0501040_0018577 3300049576 Bacteria 4616
570 Ga0501040_0031942 3300049576 Bacteria 3560
571 Ga0501040_0236124 3300049576 Bacteria 1302
572 Ga0501040_0269690 3300049576 Bacteria 1215
573 Ga0501040_0360108 3300049576 Unclassified 1042
574 Ga0501041_0021121 3300049577 Bacteria 3900
575 Ga0501041_0040524 3300049577 Bacteria 2827
576 Ga0501041_0324646 3300049577 Bacteria 971
577 Ga0501041_0328977 3300049577 Bacteria 964
578 Ga0501042_0003579 3300049578 Bacteria 9791
579 Ga0501042_0050164 3300049578 Bacteria 2976
580 Ga0501042_0109903 3300049578 Bacteria 1985
581 Ga0501043_0095693 3300049579 Bacteria 2334
582 Ga0501043_0212506 3300049579 Bacteria 1499
583 Ga0501046_0054405 3300049580 Unclassified 3148
584 Ga0501046_0104574 3300049580 Bacteria 2170
585 Ga0501047_0000952 3300049581 Bacteria 29324
586 Ga0501048_0006741 3300049582 Bacteria 8725
587 Ga0501048_0044618 3300049582 Bacteria 3169
588 Ga0501068_0176836 3300049584 Bacteria 1349
589 Ga0501069_0237568 3300049585 Bacteria 1062
590 Ga0501071_0028786 3300049587 Bacteria 3917
591 Ga0501071_0029623 3300049587 Bacteria 3865
592 Ga0501071_0652720 3300049587 Bacteria 810
593 Ga0501072_0140182 3300049588 Bacteria 1928
594 Ga0501072_0153574 3300049588 Bacteria 1836
595 Ga0501072_0368409 3300049588 Bacteria 1140
596 Ga0501074_0008614 3300049590 Bacteria 7386
597 Ga0501074_0014379 3300049590 Bacteria 5760
598 Ga0501075_0021831 3300049591 Bacteria 4670
599 Ga0501075_0102223 3300049591 Bacteria 2177
600 Ga0501075_0150532 3300049591 Bacteria 1774
601 Ga0501076_0024645 3300049592 Bacteria 4653
602 Ga0501076_0099274 3300049592 Bacteria 2345
603 Ga0501076_0132441 3300049592 Bacteria 2022
604 Ga0501076_0413746 3300049592 Bacteria 1109
605 Ga0501077_0200916 3300049593 Unclassified 1266
606 Ga0501079_0027584 3300049741 Bacteria 4356
607 Ga0501079_0083301 3300049741 Bacteria 2474
608 Ga0501079_0127601 3300049741 Bacteria 1979
609 Ga0501079_0423045 3300049741 Bacteria 1046
610 Ga0501080_0465860 3300049742 Bacteria 1132
611 Ga0501081_0007740 3300049743 Bacteria 6966
612 Ga0501083_0011798 3300049744 Bacteria 6123
613 Ga0501035_0001026 3300049822 Bacteria 29397
614 Ga0501035_0041891 3300049822 Bacteria 4132
615 Ga0501035_0281263 3300049822 Bacteria 1406
616 Ga0501044_0010581 3300049823 Bacteria 10008
617 Ga0501045_0008684 3300049824 Bacteria 7084
618 Ga0501045_0091910 3300049824 Bacteria 2244
619 Ga0501045_0181144 3300049824 Bacteria 1570
620 nmdc:mga03683_19808_c1 3300050489 Bacteria 2573
621 nmdc:mga03683_9861_c1 3300050489 Bacteria 3410
622 nmdc:mga00v17_4339_c1 3300050491 Bacteria 7367
623 nmdc:mga0yw44_25129_c1 3300050492 Bacteria 3381
624 nmdc:mga0yw44_323603_c1 3300050492 Bacteria 1036
625 nmdc:mga0yw44_40085_c1 3300050492 Bacteria 2780
626 nmdc:mga0yw44_58548_c1 3300050492 Bacteria 2354
627 nmdc:mga0yw44_64381_c2 3300050492 Bacteria 1299
628 nmdc:mga0k408_413156_c1 3300050493 Bacteria 803
629 nmdc:mga06z11_34674_c1 3300050494 Bacteria 2479
630 nmdc:mga06z11_508_c1 3300050494 Bacteria 14366
631 nmdc:mga05p37_2559_c1 3300050507 Bacteria 21147
632 nmdc:mga05p37_40233_c1 3300050507 Bacteria 5741
633 nmdc:mga05p37_461435_c1 3300050507 Unclassified 1468
634 nmdc:mga05p37_726433_c1 3300050507 Bacteria 1099
635 nmdc:mga05p37_83262_c1 3300050507 Bacteria 3941
636 nmdc:mga09592_13661_c1 3300050508 Bacteria 6636
637 nmdc:mga09592_18367_c1 3300050508 Bacteria 5734
638 nmdc:mga09592_545448_c1 3300050508 Bacteria 996
639 nmdc:mga0qj67_7399_c1 3300050509 Bacteria 8117
640 nmdc:mga06r32_130054_c1 3300050510 Unclassified 2489
641 nmdc:mga06r32_16178_c1 3300050510 Bacteria 6795
642 nmdc:mga06r32_304484_c1 3300050510 Bacteria 1579
643 nmdc:mga06r32_40284_c1 3300050510 Bacteria 4434
644 nmdc:mga08y16_12520_c1 3300050511 Bacteria 8924
645 nmdc:mga08y16_14033_c1 3300050511 Bacteria 8433
646 nmdc:mga08y16_1589_c1 3300050511 Bacteria 22934
647 nmdc:mga08y16_673125_c1 3300050511 Bacteria 1037
648 nmdc:mga08y16_844093_c1 3300050511 Bacteria 906
649 nmdc:mga0n895_10616_c1 3300050512 Bacteria 8153
650 nmdc:mga0n895_196578_c1 3300050512 Bacteria 2048
651 nmdc:mga0n895_60836_c1 3300050512 Unclassified 3727
652 nmdc:mga0rr50_130132_c1 3300050513 Unclassified 2014
653 nmdc:mga0rr50_265580_c1 3300050513 Bacteria 1429
654 nmdc:mga0rr50_76521_c1 3300050513 Unclassified 2569
655 nmdc:mga0a205_395321_c1 3300050515 Unclassified 1246
656 nmdc:mga0a205_510004_c1 3300050515 Bacteria 1059
657 Ga0495595_0084999 3300053084 Unclassified 1512
658 Ga0495619_0023907 3300053085 Bacteria 3918
659 Ga0495619_0069045 3300053085 Bacteria 2361
660 Ga0495619_0287256 3300053085 Bacteria 1140
661 Ga0500641_0095845 3300053096 Bacteria 1269
662 Ga0501084_0002580 3300054114 Bacteria 14598
663 Ga0501084_0218783 3300054114 Bacteria 1607
664 Ga0501084_0335295 3300054114 Bacteria 1277
665 Ga0501084_0646121 3300054114 Bacteria 893
666 Ga0501084_0732947 3300054114 Bacteria 833
667 Ga0501082_0026465 3300060353 Bacteria 4999
668 Ga0501082_0359937 3300060353 Bacteria 1269
669 Ga0530510_0085359 3300061734 Unclassified 2300
670 Ga0530510_0397854 3300061734 Bacteria 1038
671 Ga0530510_0465495 3300061734 Unclassified 957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0668939 Ga0496121_0668939_21_560 178
2 3300045051 Ga0451576_0919652 Ga0451576_0919652_11_586 183
3 3300005290 Ga0065712_10241463 Ga0065712_102414632 191
4 3300049569 Ga0501032_0050542 Ga0501032_0050542_1792_2409 193
5 3300049572 Ga0501036_0063532 Ga0501036_0063532_1993_2610 193
6 3300049573 Ga0501037_0079057 Ga0501037_0079057_1051_1668 193
7 3300049575 Ga0501039_0011022 Ga0501039_0011022_4369_4986 193
8 3300049576 Ga0501040_0269690 Ga0501040_0269690_390_1007 193
9 3300049577 Ga0501041_0324646 Ga0501041_0324646_61_678 193
10 3300049578 Ga0501042_0109903 Ga0501042_0109903_378_995 193
11 3300049587 Ga0501071_0028786 Ga0501071_0028786_2352_2969 193
12 3300049588 Ga0501072_0368409 Ga0501072_0368409_16_633 193
13 3300049592 Ga0501076_0413746 Ga0501076_0413746_27_644 193
14 3300049741 Ga0501079_0127601 Ga0501079_0127601_739_1356 193
15 3300049824 Ga0501045_0181144 Ga0501045_0181144_872_1489 193
16 3300045049 Ga0466959_0364017 Ga0466959_0364017_17_613 197
17 3300039437 Ga0436365_1233321 Ga0436365_1233321_7414_8013 198
18 3300039450 Ga0436363_0442447 Ga0436363_0442447_196_795 198
19 3300039453 Ga0436362_0095080 Ga0436362_0095080_45_644 198
20 3300054114 Ga0501084_0218783 Ga0501084_0218783_466_1107 199
21 3300060353 Ga0501082_0359937 Ga0501082_0359937_287_928 199
22 3300005518 Ga0070699_100371492 Ga0070699_1003714922 200
23 3300045051 Ga0451576_0029194 Ga0451576_0029194_5255_5860 200
24 3300049591 Ga0501075_0102223 Ga0501075_0102223_1264_1959 202
25 3300003911 JGI25405J52794_10010023 JGI25405J52794_100100232 203
26 3300005937 Ga0081455_10048110 Ga0081455_100481104 203
27 3300049569 Ga0501032_0047169 Ga0501032_0047169_2192_2809 203
28 3300049570 Ga0501033_0268749 Ga0501033_0268749_432_1049 203
29 3300049571 Ga0501034_0230993 Ga0501034_0230993_553_1170 203
30 3300049579 Ga0501043_0212506 Ga0501043_0212506_464_1081 203
31 3300049581 Ga0501047_0000952 Ga0501047_0000952_25817_26434 203
32 3300049822 Ga0501035_0001026 Ga0501035_0001026_3003_3620 203
33 3300049823 Ga0501044_0010581 Ga0501044_0010581_1037_1654 203
34 3300050511 nmdc:mga08y16_673125_c1 nmdc:mga08y16_673125_c1_33_647 203
35 3300047471 Ga0495684_0600337 Ga0495684_0600337_96_719 204
36 3300006844 Ga0075428_100428076 Ga0075428_1004280762 205
37 3300021384 Ga0213876_10117308 Ga0213876_101173082 205
38 3300039437 Ga0436365_1299942 Ga0436365_1299942_539_1192 205
39 3300042005 Ga0439448_0053642 Ga0439448_0053642_166_819 205
40 3300054114 Ga0501084_0732947 Ga0501084_0732947_161_787 205
41 iso_pu_bacteria 2687453341 2688391510 205
42 3300005937 Ga0081455_10007276 Ga0081455_100072762 206
43 3300005330 Ga0070690_100132851 Ga0070690_1001328512 207
44 3300005336 Ga0070680_100229748 Ga0070680_1002297483 207
45 3300005353 Ga0070669_100051618 Ga0070669_1000516184 207
46 3300005355 Ga0070671_100351519 Ga0070671_1003515191 207
47 3300005406 Ga0070703_10021190 Ga0070703_100211902 207
48 3300005438 Ga0070701_10005385 Ga0070701_100053854 207
49 3300005440 Ga0070705_100006354 Ga0070705_1000063542 207
50 3300005456 Ga0070678_100019067 Ga0070678_1000190673 207
51 3300005458 Ga0070681_10770927 Ga0070681_107709272 207
52 3300005546 Ga0070696_100041510 Ga0070696_1000415104 207
53 3300005547 Ga0070693_100063079 Ga0070693_1000630793 207
54 3300005563 Ga0068855_100218639 Ga0068855_1002186392 207
55 3300005615 Ga0070702_100041543 Ga0070702_1000415432 207
56 3300005616 Ga0068852_100130262 Ga0068852_1001302622 207
57 3300005718 Ga0068866_10024235 Ga0068866_100242352 207
58 3300005844 Ga0068862_100007312 Ga0068862_1000073128 207
59 3300006237 Ga0097621_100655105 Ga0097621_1006551052 207
60 3300006881 Ga0068865_100052498 Ga0068865_1000524984 207
61 3300009174 Ga0105241_10597691 Ga0105241_105976912 207
62 3300009176 Ga0105242_10033049 Ga0105242_100330492 207
63 3300009553 Ga0105249_10221378 Ga0105249_102213782 207
64 3300013297 Ga0157378_10179418 Ga0157378_101794182 207
65 3300013307 Ga0157372_10366860 Ga0157372_103668602 207
66 3300013308 Ga0157375_10044928 Ga0157375_100449283 207
67 3300014326 Ga0157380_10029405 Ga0157380_100294053 207
68 3300014969 Ga0157376_10272639 Ga0157376_102726392 207
69 3300017792 Ga0163161_10026329 Ga0163161_100263294 207
70 3300025899 Ga0207642_10026825 Ga0207642_100268252 207
71 3300025918 Ga0207662_10104548 Ga0207662_101045482 207
72 3300025919 Ga0207657_10049169 Ga0207657_100491695 207
73 3300025933 Ga0207706_10004239 Ga0207706_1000423914 207
74 3300025934 Ga0207686_10059554 Ga0207686_100595542 207
75 3300025942 Ga0207689_10163349 Ga0207689_101633492 207
76 3300025972 Ga0207668_10067423 Ga0207668_100674232 207
77 3300025986 Ga0207658_10295072 Ga0207658_102950722 207
78 3300026023 Ga0207677_10327586 Ga0207677_103275862 207
79 3300026041 Ga0207639_10058854 Ga0207639_100588544 207
80 3300026075 Ga0207708_10012143 Ga0207708_100121434 207
81 3300026089 Ga0207648_10004275 Ga0207648_100042757 207
82 3300026121 Ga0207683_10032205 Ga0207683_100322053 207
83 3300026142 Ga0207698_10166420 Ga0207698_101664202 207
84 3300028380 Ga0268265_10024206 Ga0268265_100242066 207
85 3300048905 Ga0496102_0712418 Ga0496102_0712418_72_704 207
86 3300048909 Ga0496106_0178711 Ga0496106_0178711_468_1100 207
87 3300048915 Ga0496112_0679423 Ga0496112_0679423_270_902 207
88 3300048917 Ga0496114_0119582 Ga0496114_0119582_660_1292 207
89 3300042013 Ga0439456_045324 Ga0439456_045324_93_743 208
90 3300046809 Ga0495600_0431472 Ga0495600_0431472_131_766 208
91 3300005981 Ga0081538_10001205 Ga0081538_1000120520 209
92 3300005539 Ga0068853_100747875 Ga0068853_1007478751 210
93 3300006844 Ga0075428_100027218 Ga0075428_1000272182 210
94 3300026041 Ga0207639_10126318 Ga0207639_101263183 210
95 3300005337 Ga0070682_100062412 Ga0070682_1000624122 211
96 3300005434 Ga0070709_10019638 Ga0070709_100196382 211
97 3300005436 Ga0070713_100050670 Ga0070713_1000506702 211
98 3300005437 Ga0070710_10018100 Ga0070710_100181002 211
99 3300005456 Ga0070678_100074577 Ga0070678_1000745772 211
100 3300005981 Ga0081538_10004221 Ga0081538_100042219 211
101 3300006163 Ga0070715_10005686 Ga0070715_100056862 211
102 3300006173 Ga0070716_100032195 Ga0070716_1000321952 211
103 3300006237 Ga0097621_100047709 Ga0097621_1000477092 211
104 3300006358 Ga0068871_100071860 Ga0068871_1000718602 211
105 3300006847 Ga0075431_100510122 Ga0075431_1005101222 211
106 3300006871 Ga0075434_100242663 Ga0075434_1002426632 211
107 3300006914 Ga0075436_100132523 Ga0075436_1001325231 211
108 3300007076 Ga0075435_100113931 Ga0075435_1001139312 211
109 3300009174 Ga0105241_10007380 Ga0105241_100073808 211
110 3300014969 Ga0157376_10044132 Ga0157376_100441324 211
111 3300025906 Ga0207699_10089416 Ga0207699_100894162 211
112 3300025911 Ga0207654_10149309 Ga0207654_101493092 211
113 3300025915 Ga0207693_10058998 Ga0207693_100589983 211
114 3300025916 Ga0207663_10028343 Ga0207663_100283432 211
115 3300025917 Ga0207660_10638589 Ga0207660_106385891 211
116 3300025928 Ga0207700_10076359 Ga0207700_100763592 211
117 3300025929 Ga0207664_10076006 Ga0207664_100760063 211
118 3300025929 Ga0207664_10356097 Ga0207664_103560972 211
119 3300025939 Ga0207665_10057145 Ga0207665_100571452 211
120 3300026121 Ga0207683_10000656 Ga0207683_1000065634 211
121 3300032002 Ga0307416_100434369 Ga0307416_1004343692 211
122 3300034819 Ga0373958_0061402 Ga0373958_0061402_54_701 211
123 3300034820 Ga0373959_0010582 Ga0373959_0010582_661_1308 211
124 3300035084 Ga0373928_0022312 Ga0373928_0022312_557_1204 211
125 3300035092 Ga0373952_0027734 Ga0373952_0027734_225_872 211
126 3300035112 Ga0373932_0015424 Ga0373932_0015424_392_1039 211
127 3300035114 Ga0373939_0122706 Ga0373939_0122706_195_842 211
128 3300035121 Ga0373960_0022358 Ga0373960_0022358_231_878 211
129 3300035242 Ga0373962_0035602 Ga0373962_0035602_560_1207 211
130 3300035691 Ga0373931_0109284 Ga0373931_0109284_40_687 211
131 3300046517 Ga0495630_0142772 Ga0495630_0142772_78_731 211
132 3300048905 Ga0496102_0076882 Ga0496102_0076882_1851_2498 211
133 3300048907 Ga0496104_0028492 Ga0496104_0028492_2371_3018 211
134 3300048912 Ga0496109_0208561 Ga0496109_0208561_252_899 211
135 3300048918 Ga0496115_0276612 Ga0496115_0276612_83_730 211
136 3300049568 Ga0501031_0081395 Ga0501031_0081395_13_708 211
137 3300049570 Ga0501033_0143517 Ga0501033_0143517_618_1313 211
138 3300049572 Ga0501036_0017029 Ga0501036_0017029_1985_2680 211
139 3300049574 Ga0501038_0001645 Ga0501038_0001645_12220_12915 211
140 3300049576 Ga0501040_0018577 Ga0501040_0018577_3206_3901 211
141 3300049577 Ga0501041_0040524 Ga0501041_0040524_1802_2497 211
142 3300049578 Ga0501042_0050164 Ga0501042_0050164_294_989 211
143 3300049585 Ga0501069_0237568 Ga0501069_0237568_208_846 211
144 3300049587 Ga0501071_0029623 Ga0501071_0029623_3109_3804 211
145 3300049588 Ga0501072_0153574 Ga0501072_0153574_319_1014 211
146 3300049590 Ga0501074_0008614 Ga0501074_0008614_6001_6696 211
147 3300049592 Ga0501076_0024645 Ga0501076_0024645_3481_4176 211
148 3300049741 Ga0501079_0083301 Ga0501079_0083301_1548_2243 211
149 3300049744 Ga0501083_0011798 Ga0501083_0011798_1294_1932 211
150 3300049824 Ga0501045_0008684 Ga0501045_0008684_1196_1891 211
151 3300050512 nmdc:mga0n895_196578_c1 nmdc:mga0n895_196578_c1_832_1479 211
152 3300060353 Ga0501082_0026465 Ga0501082_0026465_1751_2446 211
153 3300005295 Ga0065707_10328279 Ga0065707_103282791 212
154 3300005545 Ga0070695_100018447 Ga0070695_1000184473 212
155 3300005577 Ga0068857_100032762 Ga0068857_1000327623 212
156 3300006051 Ga0075364_10006234 Ga0075364_100062343 212
157 3300006844 Ga0075428_100001435 Ga0075428_10000143515 212
158 3300006871 Ga0075434_100253213 Ga0075434_1002532132 212
159 3300006871 Ga0075434_100935485 Ga0075434_1009354852 212
160 3300007076 Ga0075435_100030148 Ga0075435_1000301484 212
161 3300009147 Ga0114129_11922851 Ga0114129_119228511 212
162 3300009148 Ga0105243_10843676 Ga0105243_108436761 212
163 3300009551 Ga0105238_10161886 Ga0105238_101618862 212
164 3300009553 Ga0105249_10276919 Ga0105249_102769192 212
165 3300013307 Ga0157372_10081156 Ga0157372_100811563 212
166 3300025909 Ga0207705_10277283 Ga0207705_102772832 212
167 3300026116 Ga0207674_10043569 Ga0207674_100435693 212
168 3300026118 Ga0207675_101107951 Ga0207675_1011079512 212
169 3300026142 Ga0207698_10751398 Ga0207698_107513982 212
170 3300031242 Ga0265329_10005789 Ga0265329_100057894 212
171 3300031344 Ga0265316_10026528 Ga0265316_100265284 212
172 3300031711 Ga0265314_10000085 Ga0265314_1000008565 212
173 3300035083 Ga0373926_0015607 Ga0373926_0015607_1079_1810 212
174 3300035725 Ga0373947_0306069 Ga0373947_0306069_133_786 212
175 3300045051 Ga0451576_0282142 Ga0451576_0282142_192_923 212
176 3300048908 Ga0496105_0199403 Ga0496105_0199403_880_1530 212
177 3300048911 Ga0496108_0046747 Ga0496108_0046747_294_944 212
178 3300048915 Ga0496112_0044433 Ga0496112_0044433_2145_2795 212
179 3300048916 Ga0496113_0223501 Ga0496113_0223501_183_833 212
180 3300050489 nmdc:mga03683_9861_c1 nmdc:mga03683_9861_c1_560_1210 212
181 3300050491 nmdc:mga00v17_4339_c1 nmdc:mga00v17_4339_c1_4981_5631 212
182 3300050492 nmdc:mga0yw44_40085_c1 nmdc:mga0yw44_40085_c1_1198_1848 212
183 3300050512 nmdc:mga0n895_10616_c1 nmdc:mga0n895_10616_c1_138_788 212
184 3300050513 nmdc:mga0rr50_265580_c1 nmdc:mga0rr50_265580_c1_436_1086 212
185 3300053096 Ga0500641_0095845 Ga0500641_0095845_438_1085 212
186 iso_pu_bacteria 2913844669 2913850642 212
187 3300005295 Ga0065707_10187006 Ga0065707_101870062 213
188 3300005334 Ga0068869_100100935 Ga0068869_1001009351 213
189 3300005338 Ga0068868_100106935 Ga0068868_1001069353 213
190 3300005340 Ga0070689_100008344 Ga0070689_1000083448 213
191 3300005353 Ga0070669_100110486 Ga0070669_1001104861 213
192 3300005365 Ga0070688_100002898 Ga0070688_1000028987 213
193 3300005367 Ga0070667_100048014 Ga0070667_1000480142 213
194 3300005435 Ga0070714_100002329 Ga0070714_1000023294 213
195 3300005436 Ga0070713_100342639 Ga0070713_1003426392 213
196 3300005436 Ga0070713_100564048 Ga0070713_1005640482 213
197 3300005438 Ga0070701_10009282 Ga0070701_100092824 213
198 3300005441 Ga0070700_100047353 Ga0070700_1000473532 213
199 3300005455 Ga0070663_100044385 Ga0070663_1000443852 213
200 3300005456 Ga0070678_100342982 Ga0070678_1003429822 213
201 3300005458 Ga0070681_10354250 Ga0070681_103542502 213
202 3300005466 Ga0070685_10009941 Ga0070685_100099412 213
203 3300005467 Ga0070706_100247469 Ga0070706_1002474692 213
204 3300005518 Ga0070699_100459926 Ga0070699_1004599261 213
205 3300005536 Ga0070697_100011178 Ga0070697_1000111783 213
206 3300005543 Ga0070672_100211130 Ga0070672_1002111301 213
207 3300005544 Ga0070686_100085627 Ga0070686_1000856271 213
208 3300005546 Ga0070696_100353318 Ga0070696_1003533182 213
209 3300005614 Ga0068856_100016961 Ga0068856_1000169613 213
210 3300005615 Ga0070702_100068430 Ga0070702_1000684302 213
211 3300005615 Ga0070702_100071195 Ga0070702_1000711953 213
212 3300005617 Ga0068859_100074635 Ga0068859_1000746352 213
213 3300005617 Ga0068859_101293795 Ga0068859_1012937952 213
214 3300005618 Ga0068864_100269922 Ga0068864_1002699222 213
215 3300005718 Ga0068866_10134752 Ga0068866_101347521 213
216 3300005841 Ga0068863_100012608 Ga0068863_1000126082 213
217 3300005841 Ga0068863_100409943 Ga0068863_1004099432 213
218 3300005842 Ga0068858_100038547 Ga0068858_1000385472 213
219 3300005844 Ga0068862_100158421 Ga0068862_1001584212 213
220 3300005844 Ga0068862_100530321 Ga0068862_1005303212 213
221 3300005937 Ga0081455_10002146 Ga0081455_1000214619 213
222 3300005981 Ga0081538_10008456 Ga0081538_100084563 213
223 3300006038 Ga0075365_10004984 Ga0075365_100049847 213
224 3300006038 Ga0075365_10011294 Ga0075365_100112944 213
225 3300006038 Ga0075365_10321058 Ga0075365_103210581 213
226 3300006175 Ga0070712_100060497 Ga0070712_1000604972 213
227 3300006177 Ga0075362_10006015 Ga0075362_100060152 213
228 3300006178 Ga0075367_10000175 Ga0075367_100001756 213
229 3300006178 Ga0075367_10030118 Ga0075367_100301184 213
230 3300006178 Ga0075367_10053908 Ga0075367_100539082 213
231 3300006195 Ga0075366_10007835 Ga0075366_100078351 213
232 3300006844 Ga0075428_100006634 Ga0075428_1000066349 213
233 3300006844 Ga0075428_100039042 Ga0075428_1000390422 213
234 3300006846 Ga0075430_100014302 Ga0075430_1000143024 213
235 3300006846 Ga0075430_100384582 Ga0075430_1003845822 213
236 3300006847 Ga0075431_100212793 Ga0075431_1002127932 213
237 3300006852 Ga0075433_10367640 Ga0075433_103676402 213
238 3300006880 Ga0075429_100067925 Ga0075429_1000679254 213
239 3300006881 Ga0068865_100017966 Ga0068865_1000179662 213
240 3300006931 Ga0097620_100074636 Ga0097620_1000746363 213
241 3300006931 Ga0097620_101294176 Ga0097620_1012941762 213
242 3300009094 Ga0111539_10001286 Ga0111539_100012866 213
243 3300009094 Ga0111539_10261448 Ga0111539_102614482 213
244 3300009098 Ga0105245_10372484 Ga0105245_103724841 213
245 3300009147 Ga0114129_10045047 Ga0114129_100450474 213
246 3300009148 Ga0105243_10087537 Ga0105243_100875372 213
247 3300009176 Ga0105242_10031232 Ga0105242_100312322 213
248 3300009177 Ga0105248_10007418 Ga0105248_100074182 213
249 3300009553 Ga0105249_10286120 Ga0105249_102861202 213
250 3300013308 Ga0157375_10383398 Ga0157375_103833982 213
251 3300013308 Ga0157375_10458832 Ga0157375_104588322 213
252 3300014745 Ga0157377_10027377 Ga0157377_100273773 213
253 3300014968 Ga0157379_10083279 Ga0157379_100832792 213
254 3300025899 Ga0207642_10028295 Ga0207642_100282952 213
255 3300025915 Ga0207693_10000618 Ga0207693_1000061813 213
256 3300025916 Ga0207663_10000872 Ga0207663_100008722 213
257 3300025918 Ga0207662_10014902 Ga0207662_100149024 213
258 3300025928 Ga0207700_10686366 Ga0207700_106863662 213
259 3300025929 Ga0207664_10015519 Ga0207664_100155192 213
260 3300025936 Ga0207670_10084660 Ga0207670_100846603 213
261 3300025938 Ga0207704_10013671 Ga0207704_100136714 213
262 3300025940 Ga0207691_10132387 Ga0207691_101323872 213
263 3300025942 Ga0207689_10011002 Ga0207689_100110022 213
264 3300025961 Ga0207712_10288290 Ga0207712_102882902 213
265 3300026035 Ga0207703_10050335 Ga0207703_100503351 213
266 3300026041 Ga0207639_10808061 Ga0207639_108080612 213
267 3300026067 Ga0207678_10033899 Ga0207678_100338994 213
268 3300026075 Ga0207708_10018149 Ga0207708_100181495 213
269 3300026078 Ga0207702_10007673 Ga0207702_100076735 213
270 3300026088 Ga0207641_10054515 Ga0207641_100545152 213
271 3300026088 Ga0207641_10984029 Ga0207641_109840291 213
272 3300026095 Ga0207676_10269118 Ga0207676_102691182 213
273 3300026118 Ga0207675_100099239 Ga0207675_1000992392 213
274 3300026118 Ga0207675_100582759 Ga0207675_1005827591 213
275 3300026121 Ga0207683_10273733 Ga0207683_102737332 213
276 3300027866 Ga0209813_10146525 Ga0209813_101465251 213
277 3300027907 Ga0207428_10001146 Ga0207428_100011462 213
278 3300028380 Ga0268265_10102482 Ga0268265_101024822 213
279 3300028380 Ga0268265_10268552 Ga0268265_102685522 213
280 3300028381 Ga0268264_10041824 Ga0268264_100418242 213
281 3300031251 Ga0265327_10113179 Ga0265327_101131792 213
282 3300036401 Ga0373937_0108407 Ga0373937_0108407_1336_1986 213
283 3300037418 Ga0395900_0029311 Ga0395900_0029311_1559_2218 213
284 3300037471 Ga0395905_0142300 Ga0395905_0142300_1088_1747 213
285 3300038443 Ga0395901_0150424 Ga0395901_0150424_696_1355 213
286 3300044693 Ga0466961_0021383 Ga0466961_0021383_3472_4116 213
287 3300045976 Ga0466967_0302536 Ga0466967_0302536_45_695 213
288 3300046462 Ga0495651_0091997 Ga0495651_0091997_944_1594 213
289 3300046462 Ga0495651_0307613 Ga0495651_0307613_39_689 213
290 3300046463 Ga0495653_0157407 Ga0495653_0157407_829_1479 213
291 3300046529 Ga0495652_0010246 Ga0495652_0010246_2888_3538 213
292 3300046529 Ga0495652_0209657 Ga0495652_0209657_789_1439 213
293 3300046536 Ga0495587_0020385 Ga0495587_0020385_1383_2033 213
294 3300046675 Ga0495657_0005095 Ga0495657_0005095_5155_5805 213
295 3300046809 Ga0495600_0213525 Ga0495600_0213525_558_1208 213
296 3300047322 Ga0495680_0021051 Ga0495680_0021051_397_1047 213
297 3300047444 Ga0495675_0247363 Ga0495675_0247363_163_813 213
298 3300048088 Ga0495602_0038015 Ga0495602_0038015_3767_4417 213
299 3300048907 Ga0496104_0104825 Ga0496104_0104825_1178_1834 213
300 3300048917 Ga0496114_0034834 Ga0496114_0034834_1001_1651 213
301 3300048918 Ga0496115_0008197 Ga0496115_0008197_5731_6381 213
302 3300048918 Ga0496115_0450280 Ga0496115_0450280_26_676 213
303 3300048918 Ga0496115_0724842 Ga0496115_0724842_73_729 213
304 3300050489 nmdc:mga03683_19808_c1 nmdc:mga03683_19808_c1_694_1347 213
305 3300050492 nmdc:mga0yw44_25129_c1 nmdc:mga0yw44_25129_c1_2701_3354 213
306 3300050492 nmdc:mga0yw44_323603_c1 nmdc:mga0yw44_323603_c1_157_810 213
307 3300050492 nmdc:mga0yw44_58548_c1 nmdc:mga0yw44_58548_c1_1557_2210 213
308 3300050492 nmdc:mga0yw44_64381_c2 nmdc:mga0yw44_64381_c2_544_1197 213
309 3300050493 nmdc:mga0k408_413156_c1 nmdc:mga0k408_413156_c1_21_674 213
310 3300050494 nmdc:mga06z11_34674_c1 nmdc:mga06z11_34674_c1_336_989 213
311 3300050494 nmdc:mga06z11_508_c1 nmdc:mga06z11_508_c1_581_1234 213
312 3300050508 nmdc:mga09592_545448_c1 nmdc:mga09592_545448_c1_268_921 213
313 3300050510 nmdc:mga06r32_304484_c1 nmdc:mga06r32_304484_c1_288_980 213
314 3300050511 nmdc:mga08y16_14033_c1 nmdc:mga08y16_14033_c1_3373_4026 213
315 3300050515 nmdc:mga0a205_395321_c1 nmdc:mga0a205_395321_c1_351_1013 213
316 3300053084 Ga0495595_0084999 Ga0495595_0084999_355_1005 213
317 3300061734 Ga0530510_0465495 Ga0530510_0465495_56_709 213
318 3300005341 Ga0070691_10091770 Ga0070691_100917702 214
319 3300005434 Ga0070709_10011535 Ga0070709_100115353 214
320 3300005435 Ga0070714_100168581 Ga0070714_1001685812 214
321 3300005435 Ga0070714_100601184 Ga0070714_1006011841 214
322 3300005436 Ga0070713_100019881 Ga0070713_1000198813 214
323 3300005467 Ga0070706_100020288 Ga0070706_1000202882 214
324 3300005471 Ga0070698_100006234 Ga0070698_1000062345 214
325 3300005471 Ga0070698_100089326 Ga0070698_1000893262 214
326 3300005536 Ga0070697_100001784 Ga0070697_1000017845 214
327 3300005543 Ga0070672_100006314 Ga0070672_1000063144 214
328 3300005937 Ga0081455_10035531 Ga0081455_100355312 214
329 3300006195 Ga0075366_10508030 Ga0075366_105080302 214
330 3300006914 Ga0075436_100073048 Ga0075436_1000730482 214
331 3300013297 Ga0157378_10974037 Ga0157378_109740371 214
332 3300013307 Ga0157372_10647544 Ga0157372_106475441 214
333 3300014969 Ga0157376_10150049 Ga0157376_101500492 214
334 3300025910 Ga0207684_10000991 Ga0207684_1000099112 214
335 3300025928 Ga0207700_10013878 Ga0207700_100138782 214
336 3300025929 Ga0207664_10237905 Ga0207664_102379052 214
337 3300025929 Ga0207664_10516830 Ga0207664_105168302 214
338 3300025940 Ga0207691_10003776 Ga0207691_100037769 214
339 3300036712 Ga0316584_0104764 Ga0316584_0104764_1065_1724 214
340 3300037418 Ga0395900_0640172 Ga0395900_0640172_71_775 214
341 3300037466 Ga0395898_0823151 Ga0395898_0823151_152_805 214
342 3300037471 Ga0395905_0848515 Ga0395905_0848515_134_781 214
343 3300038443 Ga0395901_0243773 Ga0395901_0243773_771_1424 214
344 3300044712 Ga0453684_0032584 Ga0453684_0032584_1828_2475 214
345 3300045051 Ga0451576_0022444 Ga0451576_0022444_5433_6080 214
346 3300045051 Ga0451576_0560228 Ga0451576_0560228_484_1143 214
347 3300045976 Ga0466967_0368936 Ga0466967_0368936_555_1202 214
348 3300046454 Ga0495592_0347272 Ga0495592_0347272_138_833 214
349 3300046516 Ga0495628_0084756 Ga0495628_0084756_97_792 214
350 3300049568 Ga0501031_0002236 Ga0501031_0002236_8469_9125 214
351 3300049568 Ga0501031_0003090 Ga0501031_0003090_9257_9910 214
352 3300049572 Ga0501036_0026293 Ga0501036_0026293_3572_4225 214
353 3300049572 Ga0501036_0049642 Ga0501036_0049642_1091_1747 214
354 3300049573 Ga0501037_0007462 Ga0501037_0007462_2035_2691 214
355 3300049574 Ga0501038_0012321 Ga0501038_0012321_676_1332 214
356 3300049575 Ga0501039_0008675 Ga0501039_0008675_3113_3769 214
357 3300049576 Ga0501040_0031942 Ga0501040_0031942_737_1390 214
358 3300049576 Ga0501040_0236124 Ga0501040_0236124_218_871 214
359 3300049576 Ga0501040_0360108 Ga0501040_0360108_176_880 214
360 3300049577 Ga0501041_0021121 Ga0501041_0021121_3067_3723 214
361 3300049577 Ga0501041_0328977 Ga0501041_0328977_41_694 214
362 3300049578 Ga0501042_0003579 Ga0501042_0003579_2345_3001 214
363 3300049579 Ga0501043_0095693 Ga0501043_0095693_1278_1931 214
364 3300049580 Ga0501046_0054405 Ga0501046_0054405_772_1428 214
365 3300049580 Ga0501046_0104574 Ga0501046_0104574_1348_2001 214
366 3300049582 Ga0501048_0006741 Ga0501048_0006741_5853_6509 214
367 3300049582 Ga0501048_0044618 Ga0501048_0044618_2502_3155 214
368 3300049584 Ga0501068_0176836 Ga0501068_0176836_292_945 214
369 3300049587 Ga0501071_0652720 Ga0501071_0652720_103_756 214
370 3300049588 Ga0501072_0140182 Ga0501072_0140182_25_678 214
371 3300049590 Ga0501074_0014379 Ga0501074_0014379_5005_5658 214
372 3300049591 Ga0501075_0021831 Ga0501075_0021831_3022_3675 214
373 3300049592 Ga0501076_0099274 Ga0501076_0099274_103_756 214
374 3300049592 Ga0501076_0132441 Ga0501076_0132441_1097_1753 214
375 3300049593 Ga0501077_0200916 Ga0501077_0200916_324_1028 214
376 3300049741 Ga0501079_0423045 Ga0501079_0423045_116_769 214
377 3300049743 Ga0501081_0007740 Ga0501081_0007740_692_1345 214
378 3300049822 Ga0501035_0041891 Ga0501035_0041891_180_836 214
379 3300049822 Ga0501035_0281263 Ga0501035_0281263_558_1211 214
380 3300049824 Ga0501045_0091910 Ga0501045_0091910_1171_1827 214
381 3300053085 Ga0495619_0023907 Ga0495619_0023907_3027_3722 214
382 3300054114 Ga0501084_0002580 Ga0501084_0002580_1049_1702 214
383 3300054114 Ga0501084_0335295 Ga0501084_0335295_220_873 214
384 3300061734 Ga0530510_0085359 Ga0530510_0085359_716_1372 214
385 3300061734 Ga0530510_0397854 Ga0530510_0397854_109_762 214
386 3300004803 Ga0058862_12721418 Ga0058862_127214181 215
387 3300005336 Ga0070680_100020369 Ga0070680_1000203692 215
388 3300005436 Ga0070713_100261979 Ga0070713_1002619792 215
389 3300005468 Ga0070707_100031743 Ga0070707_1000317432 215
390 3300005468 Ga0070707_100219967 Ga0070707_1002199672 215
391 3300005471 Ga0070698_100171831 Ga0070698_1001718312 215
392 3300005518 Ga0070699_100039731 Ga0070699_1000397314 215
393 3300005518 Ga0070699_100244881 Ga0070699_1002448812 215
394 3300005536 Ga0070697_100006210 Ga0070697_1000062107 215
395 3300005543 Ga0070672_100001178 Ga0070672_1000011782 215
396 3300005545 Ga0070695_100318420 Ga0070695_1003184203 215
397 3300005617 Ga0068859_100190159 Ga0068859_1001901591 215
398 3300006844 Ga0075428_100037234 Ga0075428_1000372344 215
399 3300006846 Ga0075430_100002351 Ga0075430_1000023517 215
400 3300006852 Ga0075433_10199086 Ga0075433_101990862 215
401 3300006931 Ga0097620_100190159 Ga0097620_1001901593 215
402 3300007265 Ga0099794_10013910 Ga0099794_100139103 215
403 3300009094 Ga0111539_10027280 Ga0111539_100272802 215
404 3300009094 Ga0111539_10035092 Ga0111539_100350922 215
405 3300009094 Ga0111539_11184394 Ga0111539_111843942 215
406 3300009147 Ga0114129_10059918 Ga0114129_100599182 215
407 3300009177 Ga0105248_10492252 Ga0105248_104922521 215
408 3300013105 Ga0157369_10877711 Ga0157369_108777112 215
409 3300013297 Ga0157378_10525946 Ga0157378_105259462 215
410 3300013307 Ga0157372_10113685 Ga0157372_101136853 215
411 3300013307 Ga0157372_10128905 Ga0157372_101289052 215
412 3300014326 Ga0157380_10303157 Ga0157380_103031572 215
413 3300020069 Ga0197907_11462604 Ga0197907_114626042 215
414 3300020076 Ga0206355_1501835 Ga0206355_15018352 215
415 3300020610 Ga0154015_1242848 Ga0154015_12428482 215
416 3300021361 Ga0213872_10002845 Ga0213872_100028457 215
417 3300025912 Ga0207707_10308148 Ga0207707_103081481 215
418 3300025922 Ga0207646_10006236 Ga0207646_100062367 215
419 3300025922 Ga0207646_10052302 Ga0207646_100523022 215
420 3300025928 Ga0207700_10046593 Ga0207700_100465933 215
421 3300025928 Ga0207700_10159708 Ga0207700_101597082 215
422 3300025940 Ga0207691_10021463 Ga0207691_100214632 215
423 3300027671 Ga0209588_1062422 Ga0209588_10624221 215
424 3300027907 Ga0207428_10004867 Ga0207428_100048678 215
425 3300027907 Ga0207428_10011561 Ga0207428_100115613 215
426 3300027907 Ga0207428_10652174 Ga0207428_106521741 215
427 3300028016 Ga0265354_1000001 Ga0265354_10000019 215
428 3300028800 Ga0265338_10010510 Ga0265338_100105102 215
429 3300028800 Ga0265338_10016808 Ga0265338_100168087 215
430 3300030878 Ga0265770_1000014 Ga0265770_100001411 215
431 3300031090 Ga0265760_10000048 Ga0265760_1000004823 215
432 3300031247 Ga0265340_10020971 Ga0265340_100209713 215
433 3300031247 Ga0265340_10098218 Ga0265340_100982181 215
434 3300031249 Ga0265339_10013661 Ga0265339_100136616 215
435 3300031249 Ga0265339_10018350 Ga0265339_100183503 215
436 3300031249 Ga0265339_10022437 Ga0265339_100224373 215
437 3300031249 Ga0265339_10112495 Ga0265339_101124951 215
438 3300031344 Ga0265316_10056485 Ga0265316_100564852 215
439 3300031344 Ga0265316_10078076 Ga0265316_100780762 215
440 3300031711 Ga0265314_10000055 Ga0265314_1000005590 215
441 3300031712 Ga0265342_10017946 Ga0265342_100179463 215
442 3300033547 Ga0316212_1003243 Ga0316212_10032432 215
443 3300035118 Ga0373954_0167604 Ga0373954_0167604_164_814 215
444 3300037418 Ga0395900_0010042 Ga0395900_0010042_51_701 215
445 3300037466 Ga0395898_0147639 Ga0395898_0147639_1256_1906 215
446 3300037853 Ga0436364_1044171 Ga0436364_1044171_323_973 215
447 3300039093 Ga0400489_10885 Ga0400489_10885_1101_1757 215
448 3300044694 Ga0466963_0122413 Ga0466963_0122413_1083_1733 215
449 3300046472 Ga0495580_0036468 Ga0495580_0036468_1621_2271 215
450 3300046499 Ga0495594_0010816 Ga0495594_0010816_2854_3546 215
451 3300048088 Ga0495602_0078862 Ga0495602_0078862_650_1300 215
452 3300048915 Ga0496112_0227531 Ga0496112_0227531_382_1032 215
453 3300048918 Ga0496115_0473391 Ga0496115_0473391_127_777 215
454 3300049571 Ga0501034_0019019 Ga0501034_0019019_161_811 215
455 3300049571 Ga0501034_0027063 Ga0501034_0027063_3796_4446 215
456 3300049741 Ga0501079_0027584 Ga0501079_0027584_1405_2058 215
457 3300049742 Ga0501080_0465860 Ga0501080_0465860_271_924 215
458 3300050507 nmdc:mga05p37_40233_c1 nmdc:mga05p37_40233_c1_3371_4021 215
459 3300050508 nmdc:mga09592_13661_c1 nmdc:mga09592_13661_c1_1477_2127 215
460 3300050510 nmdc:mga06r32_16178_c1 nmdc:mga06r32_16178_c1_1757_2407 215
461 3300050511 nmdc:mga08y16_12520_c1 nmdc:mga08y16_12520_c1_3408_4058 215
462 3300050511 nmdc:mga08y16_1589_c1 nmdc:mga08y16_1589_c1_21237_21887 215
463 3300050511 nmdc:mga08y16_844093_c1 nmdc:mga08y16_844093_c1_88_738 215
464 3300050512 nmdc:mga0n895_60836_c1 nmdc:mga0n895_60836_c1_2178_2828 215
465 3300050513 nmdc:mga0rr50_76521_c1 nmdc:mga0rr50_76521_c1_50_700 215
466 3300054114 Ga0501084_0646121 Ga0501084_0646121_28_681 215
467 3300003320 rootH2_10323060 rootH2_103230601 216
468 3300003911 JGI25405J52794_10000050 JGI25405J52794_1000005011 216
469 3300003911 JGI25405J52794_10000986 JGI25405J52794_100009862 216
470 3300005329 Ga0070683_100157677 Ga0070683_1001576772 216
471 3300005334 Ga0068869_100104670 Ga0068869_1001046701 216
472 3300005336 Ga0070680_100001666 Ga0070680_1000016668 216
473 3300005336 Ga0070680_100531453 Ga0070680_1005314532 216
474 3300005340 Ga0070689_100356674 Ga0070689_1003566742 216
475 3300005343 Ga0070687_100129270 Ga0070687_1001292702 216
476 3300005344 Ga0070661_100074818 Ga0070661_1000748181 216
477 3300005356 Ga0070674_100469463 Ga0070674_1004694631 216
478 3300005365 Ga0070688_100675060 Ga0070688_1006750601 216
479 3300005367 Ga0070667_100491503 Ga0070667_1004915031 216
480 3300005434 Ga0070709_10083013 Ga0070709_100830132 216
481 3300005435 Ga0070714_100000541 Ga0070714_1000005413 216
482 3300005437 Ga0070710_10055258 Ga0070710_100552582 216
483 3300005439 Ga0070711_100049701 Ga0070711_1000497013 216
484 3300005439 Ga0070711_100545258 Ga0070711_1005452581 216
485 3300005440 Ga0070705_100004605 Ga0070705_1000046055 216
486 3300005445 Ga0070708_100020381 Ga0070708_1000203814 216
487 3300005445 Ga0070708_100105514 Ga0070708_1001055142 216
488 3300005445 Ga0070708_100196209 Ga0070708_1001962092 216
489 3300005456 Ga0070678_100110671 Ga0070678_1001106712 216
490 3300005458 Ga0070681_10004741 Ga0070681_100047415 216
491 3300005458 Ga0070681_10091616 Ga0070681_100916164 216
492 3300005459 Ga0068867_100334694 Ga0068867_1003346942 216
493 3300005467 Ga0070706_100000225 Ga0070706_10000022537 216
494 3300005467 Ga0070706_100162951 Ga0070706_1001629512 216
495 3300005467 Ga0070706_100248571 Ga0070706_1002485712 216
496 3300005467 Ga0070706_100407335 Ga0070706_1004073352 216
497 3300005468 Ga0070707_100010108 Ga0070707_1000101082 216
498 3300005468 Ga0070707_100187464 Ga0070707_1001874642 216
499 3300005471 Ga0070698_100003041 Ga0070698_1000030412 216
500 3300005471 Ga0070698_100076055 Ga0070698_1000760555 216
501 3300005471 Ga0070698_100093274 Ga0070698_1000932744 216
502 3300005518 Ga0070699_100232462 Ga0070699_1002324622 216
503 3300005530 Ga0070679_100000118 Ga0070679_10000011844 216
504 3300005535 Ga0070684_100258458 Ga0070684_1002584582 216
505 3300005536 Ga0070697_100000805 Ga0070697_1000008052 216
506 3300005536 Ga0070697_100076282 Ga0070697_1000762823 216
507 3300005536 Ga0070697_100456172 Ga0070697_1004561722 216
508 3300005544 Ga0070686_100071144 Ga0070686_1000711443 216
509 3300005544 Ga0070686_100282232 Ga0070686_1002822322 216
510 3300005546 Ga0070696_100054650 Ga0070696_1000546503 216
511 3300005546 Ga0070696_100394994 Ga0070696_1003949942 216
512 3300005549 Ga0070704_100652687 Ga0070704_1006526871 216
513 3300005563 Ga0068855_100066070 Ga0068855_1000660704 216
514 3300005577 Ga0068857_100997100 Ga0068857_1009971002 216
515 3300005616 Ga0068852_100548185 Ga0068852_1005481852 216
516 3300005834 Ga0068851_10009957 Ga0068851_100099573 216
517 3300005843 Ga0068860_100025859 Ga0068860_1000258592 216
518 3300005844 Ga0068862_100060570 Ga0068862_1000605702 216
519 3300005937 Ga0081455_10000119 Ga0081455_1000011950 216
520 3300005937 Ga0081455_10004119 Ga0081455_1000411911 216
521 3300005937 Ga0081455_10010105 Ga0081455_100101054 216
522 3300005937 Ga0081455_10070838 Ga0081455_100708382 216
523 3300005981 Ga0081538_10000895 Ga0081538_100008953 216
524 3300006173 Ga0070716_100104940 Ga0070716_1001049402 216
525 3300006175 Ga0070712_100032585 Ga0070712_1000325853 216
526 3300006358 Ga0068871_101070419 Ga0068871_1010704191 216
527 3300006844 Ga0075428_100023639 Ga0075428_1000236395 216
528 3300006844 Ga0075428_100173081 Ga0075428_1001730812 216
529 3300006844 Ga0075428_100434889 Ga0075428_1004348892 216
530 3300006846 Ga0075430_100003691 Ga0075430_10000369112 216
531 3300006847 Ga0075431_100023542 Ga0075431_1000235423 216
532 3300006847 Ga0075431_100030386 Ga0075431_1000303865 216
533 3300006847 Ga0075431_100083246 Ga0075431_1000832463 216
534 3300006847 Ga0075431_100087066 Ga0075431_1000870662 216
535 3300006852 Ga0075433_10021006 Ga0075433_100210064 216
536 3300006871 Ga0075434_100029911 Ga0075434_1000299114 216
537 3300006880 Ga0075429_100023013 Ga0075429_1000230132 216
538 3300006880 Ga0075429_100063054 Ga0075429_1000630543 216
539 3300006880 Ga0075429_100426980 Ga0075429_1004269802 216
540 3300006881 Ga0068865_100141463 Ga0068865_1001414632 216
541 3300007076 Ga0075435_100165301 Ga0075435_1001653012 216
542 3300009093 Ga0105240_10046154 Ga0105240_100461545 216
543 3300009094 Ga0111539_10189768 Ga0111539_101897684 216
544 3300009147 Ga0114129_10000349 Ga0114129_1000034919 216
545 3300009147 Ga0114129_10041590 Ga0114129_100415907 216
546 3300009147 Ga0114129_10061088 Ga0114129_100610882 216
547 3300009147 Ga0114129_10102534 Ga0114129_101025343 216
548 3300009147 Ga0114129_11150502 Ga0114129_111505022 216
549 3300009176 Ga0105242_10518696 Ga0105242_105186962 216
550 3300009551 Ga0105238_10679940 Ga0105238_106799401 216
551 3300010375 Ga0105239_10011375 Ga0105239_100113759 216
552 3300013100 Ga0157373_10347301 Ga0157373_103473011 216
553 3300013104 Ga0157370_10036601 Ga0157370_100366015 216
554 3300013104 Ga0157370_10485695 Ga0157370_104856952 216
555 3300013105 Ga0157369_10036658 Ga0157369_100366583 216
556 3300013105 Ga0157369_10127553 Ga0157369_101275532 216
557 3300013296 Ga0157374_10151334 Ga0157374_101513343 216
558 3300013297 Ga0157378_10077152 Ga0157378_100771524 216
559 3300013297 Ga0157378_10358578 Ga0157378_103585781 216
560 3300014325 Ga0163163_10044170 Ga0163163_100441704 216
561 3300014326 Ga0157380_10566229 Ga0157380_105662291 216
562 3300021358 Ga0213873_10059918 Ga0213873_100599182 216
563 3300021384 Ga0213876_10010195 Ga0213876_100101954 216
564 3300021388 Ga0213875_10001697 Ga0213875_100016974 216
565 3300025909 Ga0207705_10027676 Ga0207705_100276762 216
566 3300025910 Ga0207684_10000430 Ga0207684_1000043038 216
567 3300025910 Ga0207684_10179772 Ga0207684_101797722 216
568 3300025912 Ga0207707_10001675 Ga0207707_100016759 216
569 3300025912 Ga0207707_10697024 Ga0207707_106970241 216
570 3300025913 Ga0207695_10058131 Ga0207695_100581313 216
571 3300025915 Ga0207693_10001108 Ga0207693_100011088 216
572 3300025916 Ga0207663_10662703 Ga0207663_106627031 216
573 3300025917 Ga0207660_10006463 Ga0207660_100064637 216
574 3300025917 Ga0207660_10206627 Ga0207660_102066271 216
575 3300025917 Ga0207660_10231285 Ga0207660_102312852 216
576 3300025921 Ga0207652_10002549 Ga0207652_100025499 216
577 3300025922 Ga0207646_10077784 Ga0207646_100777842 216
578 3300025923 Ga0207681_10429899 Ga0207681_104298992 216
579 3300025924 Ga0207694_10308190 Ga0207694_103081902 216
580 3300025936 Ga0207670_10082276 Ga0207670_100822762 216
581 3300025938 Ga0207704_10247839 Ga0207704_102478391 216
582 3300025939 Ga0207665_10131222 Ga0207665_101312222 216
583 3300025944 Ga0207661_10078286 Ga0207661_100782862 216
584 3300025944 Ga0207661_10591230 Ga0207661_105912302 216
585 3300025949 Ga0207667_10308214 Ga0207667_103082142 216
586 3300025986 Ga0207658_10245048 Ga0207658_102450482 216
587 3300026142 Ga0207698_10073970 Ga0207698_100739703 216
588 3300027907 Ga0207428_10256538 Ga0207428_102565382 216
589 3300028379 Ga0268266_10306050 Ga0268266_103060502 216
590 3300028381 Ga0268264_10071916 Ga0268264_100719161 216
591 3300030889 Ga0265761_100032 Ga0265761_1000322 216
592 3300031239 Ga0265328_10011496 Ga0265328_100114962 216
593 3300031250 Ga0265331_10000170 Ga0265331_1000017012 216
594 3300031727 Ga0316576_10016043 Ga0316576_100160432 216
595 3300031727 Ga0316576_10360030 Ga0316576_103600302 216
596 3300031727 Ga0316576_10660330 Ga0316576_106603301 216
597 3300031824 Ga0307413_10414467 Ga0307413_104144672 216
598 3300031901 Ga0307406_10632276 Ga0307406_106322762 216
599 3300031995 Ga0307409_100023403 Ga0307409_1000234032 216
600 3300031995 Ga0307409_100598962 Ga0307409_1005989622 216
601 3300032002 Ga0307416_100021775 Ga0307416_1000217752 216
602 3300032126 Ga0307415_100013884 Ga0307415_1000138844 216
603 3300032126 Ga0307415_100032153 Ga0307415_1000321532 216
604 3300035086 Ga0373934_0008777 Ga0373934_0008777_2355_3056 216
605 3300035086 Ga0373934_0045499 Ga0373934_0045499_417_1106 216
606 3300035111 Ga0373923_0004940 Ga0373923_0004940_276_929 216
607 3300035111 Ga0373923_0020692 Ga0373923_0020692_273_962 216
608 3300035117 Ga0373953_0004717 Ga0373953_0004717_2979_3632 216
609 3300035117 Ga0373953_0031399 Ga0373953_0031399_1207_1860 216
610 3300035118 Ga0373954_0000185 Ga0373954_0000185_6786_7475 216
611 3300035118 Ga0373954_0078116 Ga0373954_0078116_460_1113 216
612 3300035119 Ga0373956_0001065 Ga0373956_0001065_6633_7286 216
613 3300035119 Ga0373956_0001883 Ga0373956_0001883_3675_4364 216
614 3300035120 Ga0373957_0002263 Ga0373957_0002263_2223_2912 216
615 3300035120 Ga0373957_0114902 Ga0373957_0114902_254_907 216
616 3300035171 Ga0373946_0300866 Ga0373946_0300866_38_691 216
617 3300035172 Ga0373955_0003757 Ga0373955_0003757_2615_3304 216
618 3300035172 Ga0373955_0004289 Ga0373955_0004289_5159_5812 216
619 3300035724 Ga0373933_0000687 Ga0373933_0000687_14938_15627 216
620 3300035724 Ga0373933_0002728 Ga0373933_0002728_738_1439 216
621 3300036401 Ga0373937_0001049 Ga0373937_0001049_16604_17293 216
622 3300036401 Ga0373937_0052272 Ga0373937_0052272_2558_3211 216
623 3300037068 Ga0373925_0064860 Ga0373925_0064860_17_670 216
624 3300037418 Ga0395900_0027333 Ga0395900_0027333_880_1536 216
625 3300037418 Ga0395900_0340040 Ga0395900_0340040_708_1361 216
626 3300037853 Ga0436364_0542426 Ga0436364_0542426_10596_11249 216
627 3300037853 Ga0436364_1491832 Ga0436364_1491832_210_863 216
628 3300039437 Ga0436365_0005710 Ga0436365_0005710_11185_11838 216
629 3300039437 Ga0436365_1424879 Ga0436365_1424879_686_1339 216
630 3300039437 Ga0436365_1707059 Ga0436365_1707059_570_1223 216
631 3300039453 Ga0436362_0849239 Ga0436362_0849239_359_1012 216
632 3300042005 Ga0439448_0079506 Ga0439448_0079506_238_918 216
633 3300042876 Ga0451577_0260174 Ga0451577_0260174_690_1343 216
634 3300042993 Ga0439440_0008622 Ga0439440_0008622_1143_1820 216
635 3300046462 Ga0495651_0012431 Ga0495651_0012431_1898_2551 216
636 3300046472 Ga0495580_0008087 Ga0495580_0008087_1551_2225 216
637 3300046472 Ga0495580_0128850 Ga0495580_0128850_186_839 216
638 3300046511 Ga0495608_0220543 Ga0495608_0220543_390_1079 216
639 3300046517 Ga0495630_0019033 Ga0495630_0019033_612_1313 216
640 3300046526 Ga0495666_0065256 Ga0495666_0065256_141_794 216
641 3300046529 Ga0495652_0393676 Ga0495652_0393676_181_870 216
642 3300046533 Ga0495640_0289253 Ga0495640_0289253_14_715 216
643 3300046535 Ga0495586_0002561 Ga0495586_0002561_464_1165 216
644 3300046536 Ga0495587_0001893 Ga0495587_0001893_9571_10260 216
645 3300046559 Ga0495667_0001884 Ga0495667_0001884_6587_7240 216
646 3300046559 Ga0495667_0093760 Ga0495667_0093760_251_940 216
647 3300046642 Ga0495634_0085806 Ga0495634_0085806_421_1122 216
648 3300046663 Ga0495635_0277661 Ga0495635_0277661_417_1076 216
649 3300046663 Ga0495635_0497561 Ga0495635_0497561_46_747 216
650 3300046675 Ga0495657_0352757 Ga0495657_0352757_24_683 216
651 3300046679 Ga0495623_0080363 Ga0495623_0080363_463_1152 216
652 3300046809 Ga0495600_0034566 Ga0495600_0034566_98_787 216
653 3300047317 Ga0495604_0000552 Ga0495604_0000552_21425_22114 216
654 3300047317 Ga0495604_0011197 Ga0495604_0011197_182_835 216
655 3300047322 Ga0495680_0266286 Ga0495680_0266286_137_790 216
656 3300047322 Ga0495680_0351304 Ga0495680_0351304_30_683 216
657 3300047444 Ga0495675_0068628 Ga0495675_0068628_1561_2220 216
658 3300047471 Ga0495684_0010755 Ga0495684_0010755_287_940 216
659 3300048088 Ga0495602_0001143 Ga0495602_0001143_8562_9251 216
660 3300048929 Ga0496126_0000133 Ga0496126_0000133_125065_125718 216
661 3300049591 Ga0501075_0150532 Ga0501075_0150532_100_783 216
662 3300050507 nmdc:mga05p37_2559_c1 nmdc:mga05p37_2559_c1_14615_15268 216
663 3300050507 nmdc:mga05p37_461435_c1 nmdc:mga05p37_461435_c1_173_829 216
664 3300050507 nmdc:mga05p37_726433_c1 nmdc:mga05p37_726433_c1_273_926 216
665 3300050507 nmdc:mga05p37_83262_c1 nmdc:mga05p37_83262_c1_1230_1883 216
666 3300050508 nmdc:mga09592_18367_c1 nmdc:mga09592_18367_c1_2997_3665 216
667 3300050509 nmdc:mga0qj67_7399_c1 nmdc:mga0qj67_7399_c1_4635_5303 216
668 3300050510 nmdc:mga06r32_130054_c1 nmdc:mga06r32_130054_c1_650_1303 216
669 3300050510 nmdc:mga06r32_40284_c1 nmdc:mga06r32_40284_c1_432_1121 216
670 3300050513 nmdc:mga0rr50_130132_c1 nmdc:mga0rr50_130132_c1_1243_1944 216
671 3300050515 nmdc:mga0a205_510004_c1 nmdc:mga0a205_510004_c1_391_1044 216
672 3300053085 Ga0495619_0069045 Ga0495619_0069045_375_1076 216
673 3300053085 Ga0495619_0287256 Ga0495619_0287256_159_812 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

47

162

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.7825 16 216
4ewl-assembly2.cif.gz_A crystal structure of mshb with glycerol and acetate bound in the active site 0.7675 10 171
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.7672 14 216
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.767 14 216
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.7667 4 213
ID Description Score Start End Superfamily
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8623 9 169 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.767 14 216 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.76 12 216 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7559 6 211 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7523 9 169 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7C5B062-F1-model_v4 PIG-L family deacetylase 0.9842 24 216
AF-A0A0S8ESC3-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9815 14 216 GO:0016811
AF-A0A7K2MV46-F1-model_v4 PIG-L family deacetylase 0.9782 64 216 GO:0016137
AF-A0A536HLR8-F1-model_v4 PIG-L family deacetylase 0.9778 48 216
AF-A0A2V5QTJ2-F1-model_v4 PIG-L domain-containing protein 0.9763 68 216

Feature Viewer

pLDDT pTM Quality
94.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map