F474267

General Info

Members Datasets Scaffolds Average Seq Length
672 505 330 327

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919119836|2919124820
Length 376
Sequence RHLLLASTVAVAFGSFGLARADDLKITIGYQTVVEPSKIPQADGTYETATGSKIDWRKFDSGADVIAAVASGSVDIGYVGSSPLAAAASRELPIQTIFVVGLIGESEALVARNGANVTTIADLAGKKVAVPFVSTTHYSLLAALKHEKVDPKTVEILNLRPPEIAAAWERGDIDAAYVWDPALGQIRTSGKIIADSARVAAWGPPTFDAWIVRTQFAEAHPDAVRDFVKVTGKAYADYLDEPDAWSASSVQAETISRLTGAKVEEVPALLKGYVFPTLNEQASSKFLGGDTVKAIAATSEFLKEQGKIDGVLTDYSKYVPHIAIEADLGRFKEAQRQGHTIVHGDAAHRRILSAAGLAKARLVIITFDGTPPSKES

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
13 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
16 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
17 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
18 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
19 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
20 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
21 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
22 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
23 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
24 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
25 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
26 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
27 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
28 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
29 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
30 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
31 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
32 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
33 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
34 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
35 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
36 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
37 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
38 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
39 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
40 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
41 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
42 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
43 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
44 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
45 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
46 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
47 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
48 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
49 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
50 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
51 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
52 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
53 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
54 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
55 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
56 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
57 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
58 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
59 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
60 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
61 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
62 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
63 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
64 2636415599 Klebsiella variicola DX120E Isolate Unclassified
65 2643221557 Ensifer sp. Root558 Isolate Unclassified
66 2643221568 Rhizobium sp. Root564 Isolate Unclassified
67 2643221607 Rhizobium sp. Root73 Isolate Unclassified
68 2643221610 Ensifer sp. Root74 Isolate Unclassified
69 2643221618 Ensifer sp. Root231 Isolate Unclassified
70 2643221626 Ensifer sp. Root31 Isolate Unclassified
71 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
72 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
73 2643221655 Ensifer sp. Root1252 Isolate Unclassified
74 2643221659 Ensifer sp. Root127 Isolate Unclassified
75 2643221668 Ensifer sp. Root423 Isolate Unclassified
76 2643221675 Ensifer sp. Root1298 Isolate Unclassified
77 2643221680 Ensifer sp. Root1312 Isolate Unclassified
78 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
79 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
80 2643221698 Ensifer sp. Root142 Isolate Unclassified
81 2643221712 Ensifer sp. Root258 Isolate Unclassified
82 2643221718 Rhizobium sp. Root268 Isolate Unclassified
83 2643221723 Ensifer sp. Root278 Isolate Unclassified
84 2643221726 Ensifer sp. Root954 Isolate Unclassified
85 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
86 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
87 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
88 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
89 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
90 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
91 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
92 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
93 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
94 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
95 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
96 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
97 2751185917 Enterobacter sp. HK169 Isolate Unclassified
98 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
99 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
100 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
101 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
102 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
103 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
104 2775507074 Klebsiella sp. D5A Isolate Unclassified
105 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
106 2821118458 Enterobacter asburiae 609 Isolate Unclassified
107 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
108 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
109 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
110 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
111 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
112 2844163670 Ensifer sp. 1H6 Isolate Unclassified
113 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
114 2847085930 Erwinia persicina B64 Isolate Bulb
115 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
116 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
117 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
118 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
119 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
120 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
121 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
122 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
123 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
124 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
125 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
126 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
127 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
128 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
129 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
130 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
131 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
132 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
133 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
134 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
135 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
136 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
137 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
138 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
139 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
140 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
141 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
142 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
143 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
144 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
145 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
146 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
147 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
148 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
149 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
150 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
151 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
152 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
153 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
154 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
155 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
156 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
157 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
158 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
159 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
160 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
161 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
162 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
163 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
164 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
165 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
166 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
167 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
168 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
169 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
170 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
171 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
172 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
173 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
174 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
175 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
176 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
177 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
178 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
179 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
180 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
181 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
182 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
183 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
184 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
185 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
186 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
187 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
188 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
189 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
190 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
191 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
192 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
193 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
194 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
195 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
196 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
197 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
198 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
199 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
200 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
201 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
202 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
203 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
204 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
205 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
206 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
207 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
208 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
209 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
210 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
211 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
212 2932401849 Devosia sp. 2618 Isolate Rhizosphere
213 2937539931 Pantoea sp. LS15 Isolate Unclassified
214 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
215 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
216 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
217 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
218 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
219 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
220 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
221 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
222 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
223 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
224 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
225 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
226 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
227 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
228 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
229 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
230 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
231 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
232 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
233 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
234 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
235 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
236 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
237 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
238 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
239 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
240 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
241 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
242 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
243 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
244 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
245 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
246 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
247 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
248 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
249 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
250 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
251 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
252 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
253 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
254 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
255 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
256 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
257 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
258 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
259 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
260 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
261 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
262 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
263 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
264 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
265 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
266 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
267 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
268 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
269 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
270 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
271 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
272 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
273 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
274 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
275 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
276 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
277 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
278 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
279 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
280 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
281 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
282 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
283 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
284 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
285 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
286 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
287 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
288 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
289 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
290 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
291 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
292 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
293 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
294 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
295 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
296 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
297 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
298 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
299 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
300 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
301 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
302 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
303 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
304 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
305 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
306 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
307 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
308 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
309 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
310 3004167301 Mesorhizobium loti 582 Isolate Unclassified
311 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
312 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
313 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
314 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
315 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
316 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
317 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
318 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
319 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
320 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
321 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
322 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
323 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
324 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
325 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
326 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
327 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
328 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
329 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
330 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
331 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
332 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
333 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
334 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
335 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
336 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
337 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
338 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
339 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
340 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
341 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
342 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
343 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
344 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
345 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
346 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
347 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
348 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
349 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
350 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
351 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
352 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
353 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
354 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
355 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
356 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
357 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
358 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
359 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
360 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
361 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
362 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
363 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
364 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
365 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
366 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
367 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
368 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
369 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
370 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
371 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
372 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
374 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
375 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
378 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
380 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
382 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
384 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
385 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
400 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
403 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
404 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
405 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
406 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
407 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
408 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
409 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
410 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
411 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
412 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
413 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
414 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
415 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
416 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
419 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
420 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
421 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
422 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
423 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
424 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
425 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
426 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
427 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
428 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
429 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
430 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
431 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
432 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
433 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
434 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
435 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
436 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
437 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
438 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
439 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
440 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
451 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
452 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
453 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
454 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
455 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
456 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
463 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
464 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
465 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
466 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
471 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
472 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
475 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
476 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
477 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
478 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
479 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
483 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
484 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
485 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
486 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
487 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
488 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
489 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
490 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
491 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
492 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
493 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
494 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
495 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
496 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
497 8018221730 Enterobacter sp. CM29 Isolate Unclassified
498 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
499 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
500 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
501 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
502 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
503 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
504 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
505 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 49.11
Metatranscriptomes 0
Isolates 50.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0.15
Endosphere 11.31
Nodule 30.51
Rhizoplane 7.74
Rhizosphere 27.68
Stem 0
Stem Tuber 0
Unclassified 22.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004068 3300002705 Bacteria 4567
2 JGI25158J39367_1000423 3300002739 Bacteria 8794
3 JGI25158J39367_1006431 3300002739 Bacteria 1682
4 JGI25157J39369_1000879 3300002741 Bacteria 14505
5 JGI25152J39213_1003426 3300002773 Bacteria 5422
6 JGI25150J39212_1001197 3300002774 Bacteria 7688
7 JGI25159J45721_1000563 3300002987 Bacteria 16655
8 JGI25159J45721_1006968 3300002987 Bacteria 3303
9 JGI25151J46595_10003579 3300003187 Bacteria 8518
10 JGI25151J46595_10051658 3300003187 Bacteria 1389
11 JGI25153J46596_10006515 3300003215 Bacteria 5891
12 JGI25153J46596_10007864 3300003215 Bacteria 5175
13 rootH2_10002720 3300003320 Bacteria 4955
14 JGI25160J50197_1000820 3300003354 Bacteria 16655
15 JGI25160J50197_1008401 3300003354 Bacteria 3938
16 JGI25161J50226_1000289 3300003374 Bacteria 28340
17 JGI25161J50226_1004440 3300003374 Bacteria 2935
18 Ga0055542_1001704 3300003762 Bacteria 9531
19 Ga0055526_1001598 3300003771 Bacteria 15895
20 Ga0055526_1004357 3300003771 Bacteria 8548
21 Ga0055524_1002668 3300003775 Bacteria 9035
22 Ga0055536_1001086 3300003781 Bacteria 17117
23 Ga0055528_1018754 3300003790 Bacteria 2330
24 Ga0055530_10012188 3300003791 Bacteria 3017
25 Ga0055540_1009751 3300003792 Bacteria 3277
26 Ga0058692_1000969 3300003856 Bacteria 11289
27 Ga0058692_1017495 3300003856 Bacteria 1572
28 Ga0055543_1000023 3300004625 Bacteria 140513
29 Ga0055543_1000727 3300004625 Bacteria 16693
30 Ga0065165_1002311 3300005262 Bacteria 16693
31 Ga0065165_1014205 3300005262 Bacteria 3106
32 Ga0065704_10000245 3300005289 Bacteria 54286
33 Ga0065704_10001510 3300005289 Bacteria 8367
34 Ga0065704_10005294 3300005289 Bacteria 3190
35 Ga0070659_100037902 3300005366 Bacteria 3759
36 Ga0070707_100308219 3300005468 Bacteria 1539
37 Ga0068853_100011643 3300005539 Bacteria 7149
38 Ga0070665_100000224 3300005548 Bacteria 94266
39 Ga0070665_100235387 3300005548 Bacteria 1832
40 Ga0068857_100001374 3300005577 Bacteria 19191
41 Ga0075365_10020247 3300006038 Bacteria 4121
42 Ga0075365_10027717 3300006038 Bacteria 3607
43 Ga0075363_100040104 3300006048 Bacteria 2467
44 Ga0075363_100204517 3300006048 Bacteria 1129
45 Ga0075364_10001237 3300006051 Bacteria 13698
46 Ga0075364_10003120 3300006051 Bacteria 9376
47 Ga0075364_10064433 3300006051 Bacteria 2405
48 Ga0075370_10044492 3300006353 Bacteria 2510
49 Ga0079104_1000166 3300006946 Bacteria 94027
50 Ga0079104_1000200 3300006946 Bacteria 84123
51 Ga0079104_1000357 3300006946 Bacteria 55345
52 Ga0079104_1000361 3300006946 Bacteria 54642
53 Ga0079104_1000801 3300006946 Bacteria 26565
54 Ga0079104_1000820 3300006946 Bacteria 25957
55 Ga0079104_1005550 3300006946 Bacteria 5015
56 Ga0105251_10000529 3300009011 Bacteria 36039
57 Ga0105251_10006493 3300009011 Bacteria 7436
58 Ga0105251_10020654 3300009011 Bacteria 3457
59 Ga0105251_10020945 3300009011 Bacteria 3424
60 Ga0105251_10022586 3300009011 Bacteria 3263
61 Ga0105251_10035304 3300009011 Bacteria 2468
62 Ga0105251_10058614 3300009011 Bacteria 1818
63 Ga0105251_10123549 3300009011 Bacteria 1175
64 Ga0105244_10000041 3300009036 Bacteria 155525
65 Ga0105244_10000105 3300009036 Bacteria 86528
66 Ga0105244_10000393 3300009036 Bacteria 40595
67 Ga0105244_10001770 3300009036 Bacteria 16977
68 Ga0105244_10002872 3300009036 Bacteria 12752
69 Ga0105244_10014267 3300009036 Bacteria 4601
70 Ga0105244_10059165 3300009036 Bacteria 1932
71 Ga0105250_10000052 3300009092 Bacteria 116382
72 Ga0105250_10000150 3300009092 Bacteria 61428
73 Ga0105250_10002334 3300009092 Bacteria 9604
74 Ga0105250_10013872 3300009092 Bacteria 3319
75 Ga0105250_10070252 3300009092 Bacteria 1414
76 Ga0105240_10298217 3300009093 Bacteria 1845
77 Ga0105241_10118234 3300009174 Bacteria 2131
78 Ga0105237_10120666 3300009545 Bacteria 2616
79 Ga0105238_10258160 3300009551 Bacteria 1722
80 Ga0105239_10012979 3300010375 Bacteria 9268
81 Ga0157373_10153592 3300013100 Bacteria 1619
82 Ga0157371_10009234 3300013102 Bacteria 7779
83 Ga0157370_10010977 3300013104 Bacteria 9502
84 Ga0157369_10037593 3300013105 Bacteria 5300
85 Ga0157369_10107538 3300013105 Bacteria 2967
86 Ga0171463_1016 3300013249 Bacteria 62129
87 Ga0183366_1001 3300015679 Bacteria 2743932
88 Ga0183370_1001 3300015680 Bacteria 2743932
89 Ga0183369_1001 3300015685 Bacteria 2743932
90 Ga0183368_1001 3300015687 Bacteria 2743932
91 Ga0183363_1267 3300015690 Bacteria 8408
92 Ga0209436_100035 3300025208 Bacteria 79010
93 Ga0209436_100712 3300025208 Bacteria 13940
94 Ga0207425_1000968 3300025245 Bacteria 13512
95 Ga0209026_1000141 3300025250 Bacteria 114545
96 Ga0209148_1000111 3300025254 Bacteria 198095
97 Ga0209759_1000354 3300025256 Bacteria 59742
98 Ga0209129_1003607 3300025258 Bacteria 6618
99 Ga0209565_1020783 3300025263 Bacteria 1381
100 Ga0209455_1000206 3300025272 Bacteria 84430
101 Ga0209130_1000031 3300025284 Bacteria 322932
102 Ga0209130_1001334 3300025284 Bacteria 16707
103 Ga0209676_1001434 3300025292 Bacteria 22507
104 Ga0209025_1000121 3300025294 Bacteria 208700
105 Ga0209025_1005690 3300025294 Bacteria 10037
106 Ga0209025_1007351 3300025294 Bacteria 8243
107 Ga0209025_1057570 3300025294 Bacteria 1484
108 Ga0209564_1000081 3300025295 Bacteria 261592
109 Ga0209564_1000826 3300025295 Bacteria 42101
110 Ga0209758_1011158 3300025297 Bacteria 5246
111 Ga0209758_1011779 3300025297 Bacteria 5009
112 Ga0209758_1014158 3300025297 Bacteria 4271
113 Ga0209050_1000852 3300025298 Bacteria 41567
114 Ga0209256_1000639 3300025299 Bacteria 47642
115 Ga0209256_1003364 3300025299 Bacteria 11321
116 Ga0207426_1000042 3300025302 Bacteria 433289
117 Ga0207426_1001728 3300025302 Bacteria 16707
118 Ga0209051_1013148 3300025303 Bacteria 3956
119 Ga0209257_1001851 3300025304 Bacteria 23010
120 Ga0207696_1000003 3300025711 Bacteria 860639
121 Ga0207696_1000007 3300025711 Bacteria 578417
122 Ga0207696_1016740 3300025711 Bacteria 2445
123 Ga0207655_1000001 3300025728 Bacteria 1866413
124 Ga0207655_1000087 3300025728 Bacteria 205876
125 Ga0207655_1000121 3300025728 Bacteria 155535
126 Ga0207655_1000226 3300025728 Bacteria 94688
127 Ga0207655_1000404 3300025728 Bacteria 59563
128 Ga0207655_1004508 3300025728 Bacteria 9852
129 Ga0207655_1013914 3300025728 Bacteria 4584
130 Ga0207655_1082901 3300025728 Bacteria 1151
131 Ga0207713_1000005 3300025735 Bacteria 649958
132 Ga0207713_1000038 3300025735 Bacteria 247609
133 Ga0207713_1000155 3300025735 Bacteria 102677
134 Ga0207713_1020667 3300025735 Bacteria 3181
135 Ga0207713_1076555 3300025735 Bacteria 1217
136 Ga0207713_1083459 3300025735 Bacteria 1142
137 Ga0207684_10509325 3300025910 Bacteria 1031
138 Ga0207671_10056487 3300025914 Bacteria 2909
139 Ga0207681_10110117 3300025923 Bacteria 2002
140 Ga0207694_10193215 3300025924 Bacteria 1654
141 Ga0207690_10021808 3300025932 Bacteria 3977
142 Ga0207706_10260167 3300025933 Bacteria 1515
143 Ga0207709_10007717 3300025935 Bacteria 5966
144 Ga0207709_10027659 3300025935 Bacteria 3270
145 Ga0207648_10301135 3300026089 Bacteria 1438
146 Ga0207674_10000067 3300026116 Bacteria 107803
147 Ga0207674_10208463 3300026116 Bacteria 1904
148 Ga0209281_1000001 3300027111 Bacteria 1933496
149 Ga0209281_1000021 3300027111 Bacteria 541033
150 Ga0209281_1000075 3300027111 Bacteria 267114
151 Ga0209281_1000100 3300027111 Bacteria 223560
152 Ga0209281_1000205 3300027111 Bacteria 133809
153 Ga0209281_1000232 3300027111 Bacteria 117627
154 Ga0209281_1000630 3300027111 Bacteria 39048
155 Ga0209281_1003662 3300027111 Bacteria 4939
156 Ga0209371_1000001 3300027312 Bacteria 2771503
157 Ga0209371_1000334 3300027312 Bacteria 51398
158 Ga0209371_1000744 3300027312 Bacteria 27167
159 Ga0209371_1001192 3300027312 Bacteria 18823
160 Ga0209371_1005365 3300027312 Bacteria 5125
161 Ga0268266_10000165 3300028379 Bacteria 122830
162 Ga0268266_10376663 3300028379 Bacteria 1338
163 Ga0265318_10016718 3300028577 Bacteria 3023
164 Ga0307515_10022779 3300028794 Bacteria 11022
165 Ga0307515_10024806 3300028794 Bacteria 10418
166 Ga0268256_1000001 3300030500 Bacteria 2771065
167 Ga0268256_1000323 3300030500 Bacteria 47340
168 Ga0268256_1000628 3300030500 Bacteria 27263
169 Ga0268256_1001024 3300030500 Bacteria 18823
170 Ga0268256_1005143 3300030500 Bacteria 5206
171 Ga0265325_10003181 3300031241 Bacteria 10801
172 Ga0265340_10030451 3300031247 Bacteria 2704
173 Ga0265331_10034618 3300031250 Bacteria 2490
174 Ga0265316_10015822 3300031344 Bacteria 6573
175 Ga0307513_10003256 3300031456 Bacteria 22138
176 Ga0307513_10024760 3300031456 Bacteria 6977
177 Ga0265313_10000523 3300031595 Bacteria 40161
178 Ga0265313_10009489 3300031595 Bacteria 6313
179 Ga0316579_10092464 3300031691 Bacteria 1445
180 Ga0265314_10053968 3300031711 Bacteria 2784
181 Ga0316578_10022617 3300031728 Bacteria 3508
182 Ga0395899_0047144 3300037312 Bacteria 3209
183 Ga0395900_0000021 3300037418 Bacteria 351144
184 Ga0395900_0096725 3300037418 Bacteria 3034
185 Ga0395898_0002409 3300037466 Bacteria 22197
186 Ga0395905_0000912 3300037471 Bacteria 38176
187 Ga0395905_0025305 3300037471 Bacteria 5597
188 Ga0395901_0014520 3300038443 Bacteria 8009
189 Ga0439438_000798 3300041405 Bacteria 14062
190 Ga0439438_005515 3300041405 Bacteria 4635
191 Ga0439447_001300 3300041407 Bacteria 9089
192 Ga0439465_0057818 3300041413 Bacteria 1280
193 Ga0451853_1811120 3300041512 Bacteria 1716
194 Ga0439432_058161 3300042006 Bacteria 1195
195 Ga0439452_000040 3300042010 Bacteria 143490
196 Ga0439452_000362 3300042010 Bacteria 27827
197 Ga0439452_002414 3300042010 Bacteria 6920
198 Ga0439464_0001188 3300042439 Bacteria 6029
199 Ga0466981_0000011 3300044669 Bacteria 132904
200 Ga0495591_000265 3300046458 Bacteria 49660
201 Ga0495638_0000477 3300046460 Bacteria 48044
202 Ga0495638_0014130 3300046460 Bacteria 5406
203 Ga0495638_0024332 3300046460 Bacteria 3949
204 Ga0495650_0000205 3300046471 Bacteria 128197
205 Ga0495631_0130543 3300046518 Bacteria 1080
206 Ga0495597_0005804 3300046542 Bacteria 6470
207 Ga0495625_0002265 3300046660 Bacteria 21150
208 Ga0495588_0012042 3300046674 Bacteria 4077
209 Ga0495669_0110744 3300046684 Bacteria 1282
210 Ga0495649_0000245 3300046694 Bacteria 47917
211 Ga0495649_0000704 3300046694 Bacteria 27306
212 Ga0495649_0029090 3300046694 Bacteria 3060
213 Ga0495672_0000049 3300047320 Bacteria 240851
214 Ga0495679_000031 3300047446 Bacteria 177838
215 Ga0495673_0001407 3300047469 Bacteria 19306
216 Ga0495686_0000045 3300047472 Bacteria 284761
217 Ga0496100_0015040 3300048903 Bacteria 4512
218 Ga0496101_0060363 3300048904 Bacteria 2751
219 Ga0496104_0000172 3300048907 Bacteria 57392
220 Ga0496104_0178715 3300048907 Bacteria 2032
221 Ga0496105_0043401 3300048908 Bacteria 3708
222 Ga0496106_0000401 3300048909 Bacteria 30792
223 Ga0496112_0015340 3300048915 Bacteria 7145
224 Ga0496115_0241670 3300048918 Bacteria 1488
225 Ga0496116_0000233 3300048919 Bacteria 102081
226 Ga0496116_0000348 3300048919 Bacteria 73391
227 Ga0496116_0000411 3300048919 Bacteria 61137
228 Ga0496116_0014444 3300048919 Bacteria 6304
229 Ga0496116_0028703 3300048919 Bacteria 4024
230 Ga0496116_0049751 3300048919 Bacteria 2798
231 Ga0496116_0146218 3300048919 Bacteria 1321
232 Ga0496117_0000517 3300048920 Bacteria 63669
233 Ga0496117_0001239 3300048920 Bacteria 38198
234 Ga0496117_0001463 3300048920 Bacteria 34016
235 Ga0496117_0004405 3300048920 Bacteria 15574
236 Ga0496117_0161810 3300048920 Bacteria 1310
237 Ga0496118_0000428 3300048921 Bacteria 69913
238 Ga0496118_0005623 3300048921 Bacteria 14153
239 Ga0496118_0036064 3300048921 Bacteria 4004
240 Ga0496118_0081093 3300048921 Bacteria 2280
241 Ga0496118_0207172 3300048921 Bacteria 1154
242 Ga0496119_0001022 3300048922 Bacteria 35853
243 Ga0496119_0001255 3300048922 Bacteria 31535
244 Ga0496119_0002170 3300048922 Bacteria 22027
245 Ga0496119_0002577 3300048922 Bacteria 19706
246 Ga0496119_0013643 3300048922 Bacteria 6448
247 Ga0496119_0013740 3300048922 Bacteria 6415
248 Ga0496119_0071340 3300048922 Bacteria 2033
249 Ga0496119_0080904 3300048922 Bacteria 1872
250 Ga0496120_0000460 3300048923 Bacteria 64148
251 Ga0496120_0001060 3300048923 Bacteria 36350
252 Ga0496120_0002784 3300048923 Bacteria 16971
253 Ga0496120_0025656 3300048923 Bacteria 3654
254 Ga0496120_0031078 3300048923 Bacteria 3238
255 Ga0496120_0039729 3300048923 Bacteria 2773
256 Ga0496121_0001841 3300048924 Bacteria 34183
257 Ga0496121_0002570 3300048924 Bacteria 27471
258 Ga0496121_0003887 3300048924 Bacteria 20766
259 Ga0496121_0004704 3300048924 Bacteria 18072
260 Ga0496121_0007775 3300048924 Bacteria 12839
261 Ga0496121_0012649 3300048924 Bacteria 9166
262 Ga0496121_0019222 3300048924 Bacteria 6842
263 Ga0496121_0082770 3300048924 Bacteria 2536
264 Ga0496121_0193149 3300048924 Bacteria 1458
265 Ga0496122_0000145 3300048925 Bacteria 165864
266 Ga0496122_0001329 3300048925 Bacteria 40484
267 Ga0496122_0001768 3300048925 Bacteria 33133
268 Ga0496122_0008279 3300048925 Bacteria 11277
269 Ga0496122_0012045 3300048925 Bacteria 8670
270 Ga0496122_0095550 3300048925 Bacteria 2008
271 Ga0496123_0000018 3300048926 Bacteria 404553
272 Ga0496123_0000281 3300048926 Bacteria 100416
273 Ga0496123_0009633 3300048926 Bacteria 8670
274 Ga0496123_0010152 3300048926 Bacteria 8360
275 Ga0496123_0016959 3300048926 Bacteria 5882
276 Ga0496123_0144231 3300048926 Bacteria 1296
277 Ga0496124_0000217 3300048927 Bacteria 112197
278 Ga0496124_0000940 3300048927 Bacteria 46669
279 Ga0496124_0002532 3300048927 Bacteria 23723
280 Ga0496124_0007281 3300048927 Bacteria 11802
281 Ga0496124_0034576 3300048927 Bacteria 4434
282 Ga0496124_0048669 3300048927 Bacteria 3620
283 Ga0496124_0049742 3300048927 Bacteria 3574
284 Ga0496125_0000161 3300048928 Bacteria 150707
285 Ga0496125_0000221 3300048928 Bacteria 116650
286 Ga0496125_0000413 3300048928 Bacteria 79797
287 Ga0496125_0001224 3300048928 Bacteria 38466
288 Ga0496125_0013279 3300048928 Bacteria 8102
289 Ga0496125_0014109 3300048928 Bacteria 7801
290 Ga0496126_0000212 3300048929 Bacteria 128871
291 Ga0496126_0000457 3300048929 Bacteria 81283
292 Ga0496126_0001037 3300048929 Bacteria 46997
293 Ga0496126_0001379 3300048929 Bacteria 38417
294 Ga0496126_0048574 3300048929 Bacteria 3876
295 Ga0496126_0058691 3300048929 Bacteria 3468
296 Ga0496126_0103806 3300048929 Bacteria 2483
297 Ga0496126_0114648 3300048929 Bacteria 2344
298 Ga0496126_0180806 3300048929 Bacteria 1791
299 Ga0496126_0215147 3300048929 Bacteria 1616
300 Ga0501034_0066095 3300049571 Bacteria 3629
301 Ga0501036_0151551 3300049572 Bacteria 1956
302 Ga0501046_0074604 3300049580 Bacteria 2632
303 Ga0501047_0009665 3300049581 Bacteria 9116
304 Ga0501067_0029936 3300049583 Bacteria 3018
305 Ga0501069_0036367 3300049585 Bacteria 2715
306 Ga0501073_0011570 3300049589 Bacteria 6453
307 Ga0501074_0008060 3300049590 Bacteria 7630
308 Ga0501080_0011770 3300049742 Bacteria 8019
309 Ga0501083_0008142 3300049744 Bacteria 7417
310 Ga0501083_0037673 3300049744 Bacteria 3292
311 Ga0501035_0262151 3300049822 Bacteria 1465
312 Ga0501044_0014820 3300049823 Bacteria 8404
313 nmdc:mga00v17_103000_c1 3300050491 Bacteria 1804
314 nmdc:mga00v17_17091_c1 3300050491 Bacteria 4097
315 nmdc:mga00v17_3353_c1 3300050491 Bacteria 8266
316 nmdc:mga0yw44_13314_c1 3300050492 Bacteria 4326
317 nmdc:mga0yw44_15035_c1 3300050492 Bacteria 4132
318 nmdc:mga0yw44_86236_c1 3300050492 Bacteria 1977
319 nmdc:mga06z11_131522_c1 3300050494 Bacteria 1406
320 nmdc:mga07m45_102151_c1 3300050496 Bacteria 1647
321 Ga0500610_0072085 3300053079 Bacteria 1801
322 Ga0500644_0007122 3300053088 Bacteria 2899
323 Ga0500568_0000004 3300053139 Bacteria 621666
324 Ga0500616_0070862 3300053153 Bacteria 1778
325 Ga0500616_0077995 3300053153 Bacteria 1672
326 Ga0500622_0000343 3300053156 Bacteria 45668
327 Ga0500622_0004607 3300053156 Bacteria 8558
328 Ga0500636_0001782 3300053177 Bacteria 11796
329 Ga0501084_0013748 3300054114 Bacteria 6698
330 Ga0501082_0001003 3300060353 Bacteria 24930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031241 Ga0265325_10003181 Ga0265325_1000318111 279
2 3300031250 Ga0265331_10034618 Ga0265331_100346182 279
3 3300031344 Ga0265316_10015822 Ga0265316_100158225 279
4 3300031595 Ga0265313_10000523 Ga0265313_1000052335 279
5 iso_pu_bacteria 8018221730 8018223714 281
6 iso_pu_bacteria 2791355253 2793281446 284
7 3300053139 Ga0500568_0000004 Ga0500568_0000004_138258_139271 301
8 iso_pu_bacteria 3004289098 3004293641 304
9 iso_pu_bacteria 8004300914 8004305904 305
10 3300027312 Ga0209371_1001192 Ga0209371_10011929 306
11 3300030500 Ga0268256_1001024 Ga0268256_100102410 306
12 3300006051 Ga0075364_10003120 Ga0075364_100031204 307
13 3300046684 Ga0495669_0110744 Ga0495669_0110744_157_1182 307
14 3300050491 nmdc:mga00v17_17091_c1 nmdc:mga00v17_17091_c1_136_1116 307
15 iso_pu_bacteria 2554235234 2555259531 307
16 iso_pu_bacteria 2599185169 2599412110 307
17 iso_pu_bacteria 2600255254 2601525288 307
18 iso_pu_bacteria 2600255255 2601530475 307
19 iso_pu_bacteria 2600255280 2601616921 307
20 iso_pu_bacteria 2600255281 2601621732 307
21 iso_pu_bacteria 2600255287 2601644856 307
22 iso_pu_bacteria 2600255288 2601650544 307
23 iso_pu_bacteria 2600255289 2601655056 307
24 iso_pu_bacteria 2600255290 2601660277 307
25 iso_pu_bacteria 2600255291 2601665174 307
26 iso_pu_bacteria 2600255298 2601697789 307
27 iso_pu_bacteria 2600255299 2601703177 307
28 iso_pu_bacteria 2600255300 2601708124 307
29 iso_pu_bacteria 2600255301 2601713217 307
30 iso_pu_bacteria 2600255302 2601718615 307
31 iso_pu_bacteria 2600255303 2601723338 307
32 iso_pu_bacteria 2600255304 2601728152 307
33 iso_pu_bacteria 2600255305 2601733563 307
34 iso_pu_bacteria 2600255306 2601738136 307
35 iso_pu_bacteria 2600255307 2601742259 307
36 iso_pu_bacteria 2600255309 2601753473 307
37 iso_pu_bacteria 2600255392 2602020140 307
38 iso_pu_bacteria 2602042047 2603643681 307
39 iso_pu_bacteria 2602042052 2603661970 307
40 iso_pu_bacteria 2602042053 2603666868 307
41 iso_pu_bacteria 2602042066 2603700262 307
42 iso_pu_bacteria 2602042067 2603704254 307
43 iso_pu_bacteria 2602042103 2603840676 307
44 iso_pu_bacteria 2602042104 2603845662 307
45 iso_pu_bacteria 2602042105 2603850735 307
46 iso_pu_bacteria 2602042106 2603855893 307
47 iso_pu_bacteria 2602042109 2603866416 307
48 iso_pu_bacteria 2602042110 2603873474 307
49 iso_pu_bacteria 2602042111 2603877476 307
50 iso_pu_bacteria 2603880178 2606050564 307
51 iso_pu_bacteria 2603880184 2606071300 307
52 iso_pu_bacteria 2603880202 2606148248 307
53 iso_pu_bacteria 2603880211 2606178543 307
54 iso_pu_bacteria 2636415599 2637226859 307
55 iso_pu_bacteria 2667528172 2671102107 307
56 iso_pu_bacteria 2675903046 2676406990 307
57 iso_pu_bacteria 2681812866 2681996015 307
58 iso_pu_bacteria 2681812869 2682009034 307
59 iso_pu_bacteria 2751185917 2753854807 307
60 iso_pu_bacteria 2765235842 2765587672 307
61 iso_pu_bacteria 2775506706 2775541928 307
62 iso_pu_bacteria 2775507074 2777023656 307
63 iso_pu_bacteria 2821118458 2821118587 307
64 iso_pu_bacteria 2823373977 2823377212 307
65 iso_pu_bacteria 2844425489 2844426360 307
66 iso_pu_bacteria 2857367948 2857373297 307
67 iso_pu_bacteria 2884086401 2884090189 307
68 iso_pu_bacteria 2904513164 2904515125 307
69 iso_pu_bacteria 2919108558 2919109972 307
70 iso_pu_bacteria 2923634449 2923638223 307
71 iso_pu_bacteria 2927833300 2927835341 307
72 iso_pu_bacteria 2937539931 2937542781 307
73 iso_pu_bacteria 2939568625 2939570829 307
74 iso_pu_bacteria 2939573065 2939574996 307
75 iso_pu_bacteria 2939607340 2939610886 307
76 iso_pu_bacteria 2939642701 2939644935 307
77 iso_pu_bacteria 2969079654 2969083842 307
78 iso_pu_bacteria 2971820967 2971825313 307
79 iso_pu_bacteria 2974310843 2974313397 307
80 iso_pu_bacteria 2984559226 2984560946 307
81 iso_pu_bacteria 2984595703 2984599020 307
82 iso_pu_bacteria 8018405270 8018406618 307
83 iso_pu_bacteria 8055087960 8055090128 307
84 iso_pu_bacteria 8055092621 8055096380 307
85 iso_pu_bacteria 8055097453 8055101445 307
86 iso_pu_bacteria 8057304971 8057306373 307
87 3300031691 Ga0316579_10092464 Ga0316579_100924642 309
88 iso_pu_bacteria 2671180115 2671587953 310
89 iso_pu_bacteria 8054844752 8054848569 310
90 iso_pu_bacteria 8054849141 8054850139 310
91 3300003320 rootH2_10002720 rootH2_100027204 311
92 3300003856 Ga0058692_1000969 Ga0058692_10009692 311
93 3300003856 Ga0058692_1017495 Ga0058692_10174952 311
94 3300005289 Ga0065704_10000245 Ga0065704_1000024525 311
95 3300005289 Ga0065704_10001510 Ga0065704_100015109 311
96 3300005289 Ga0065704_10005294 Ga0065704_100052943 311
97 3300005366 Ga0070659_100037902 Ga0070659_1000379023 311
98 3300005548 Ga0070665_100000224 Ga0070665_10000022470 311
99 3300005548 Ga0070665_100235387 Ga0070665_1002353872 311
100 3300005577 Ga0068857_100001374 Ga0068857_1000013748 311
101 3300006051 Ga0075364_10001237 Ga0075364_100012378 311
102 3300006946 Ga0079104_1000166 Ga0079104_100016690 311
103 3300006946 Ga0079104_1000357 Ga0079104_100035749 311
104 3300006946 Ga0079104_1000361 Ga0079104_100036127 311
105 3300006946 Ga0079104_1000801 Ga0079104_100080130 311
106 3300006946 Ga0079104_1000820 Ga0079104_10008203 311
107 3300006946 Ga0079104_1005550 Ga0079104_10055503 311
108 3300009011 Ga0105251_10000529 Ga0105251_100005293 311
109 3300009011 Ga0105251_10006493 Ga0105251_100064934 311
110 3300009011 Ga0105251_10020654 Ga0105251_100206544 311
111 3300009011 Ga0105251_10022586 Ga0105251_100225863 311
112 3300009011 Ga0105251_10035304 Ga0105251_100353042 311
113 3300009011 Ga0105251_10058614 Ga0105251_100586142 311
114 3300009011 Ga0105251_10123549 Ga0105251_101235491 311
115 3300009036 Ga0105244_10000041 Ga0105244_1000004173 311
116 3300009036 Ga0105244_10000105 Ga0105244_100001051 311
117 3300009036 Ga0105244_10000393 Ga0105244_1000039333 311
118 3300009036 Ga0105244_10002872 Ga0105244_100028725 311
119 3300009036 Ga0105244_10059165 Ga0105244_100591652 311
120 3300009092 Ga0105250_10000052 Ga0105250_1000005240 311
121 3300009092 Ga0105250_10000150 Ga0105250_100001507 311
122 3300009092 Ga0105250_10002334 Ga0105250_100023347 311
123 3300009092 Ga0105250_10070252 Ga0105250_100702521 311
124 3300009093 Ga0105240_10298217 Ga0105240_102982172 311
125 3300013100 Ga0157373_10153592 Ga0157373_101535921 311
126 3300013102 Ga0157371_10009234 Ga0157371_100092346 311
127 3300013104 Ga0157370_10010977 Ga0157370_100109774 311
128 3300015679 Ga0183366_1001 Ga0183366_1001108 311
129 3300015680 Ga0183370_1001 Ga0183370_1001108 311
130 3300015685 Ga0183369_1001 Ga0183369_1001108 311
131 3300015687 Ga0183368_1001 Ga0183368_1001108 311
132 3300025711 Ga0207696_1000003 Ga0207696_1000003181 311
133 3300025711 Ga0207696_1000007 Ga0207696_1000007462 311
134 3300025711 Ga0207696_1016740 Ga0207696_10167402 311
135 3300025728 Ga0207655_1000001 Ga0207655_100000174 311
136 3300025728 Ga0207655_1000087 Ga0207655_100008772 311
137 3300025728 Ga0207655_1000121 Ga0207655_100012172 311
138 3300025728 Ga0207655_1000226 Ga0207655_10002261 311
139 3300025728 Ga0207655_1000404 Ga0207655_100040439 311
140 3300025728 Ga0207655_1004508 Ga0207655_10045087 311
141 3300025728 Ga0207655_1082901 Ga0207655_10829012 311
142 3300025735 Ga0207713_1000005 Ga0207713_1000005603 311
143 3300025735 Ga0207713_1000038 Ga0207713_1000038121 311
144 3300025735 Ga0207713_1000155 Ga0207713_100015544 311
145 3300025735 Ga0207713_1076555 Ga0207713_10765551 311
146 3300025735 Ga0207713_1083459 Ga0207713_10834592 311
147 3300025932 Ga0207690_10021808 Ga0207690_100218083 311
148 3300025935 Ga0207709_10007717 Ga0207709_100077175 311
149 3300025935 Ga0207709_10027659 Ga0207709_100276593 311
150 3300026116 Ga0207674_10000067 Ga0207674_1000006737 311
151 3300027111 Ga0209281_1000001 Ga0209281_10000011786 311
152 3300027111 Ga0209281_1000021 Ga0209281_1000021456 311
153 3300027111 Ga0209281_1000075 Ga0209281_1000075213 311
154 3300027111 Ga0209281_1000205 Ga0209281_1000205103 311
155 3300027111 Ga0209281_1000232 Ga0209281_100023240 311
156 3300027111 Ga0209281_1000630 Ga0209281_10006309 311
157 3300027111 Ga0209281_1003662 Ga0209281_10036625 311
158 3300027312 Ga0209371_1000001 Ga0209371_100000165 311
159 3300027312 Ga0209371_1000334 Ga0209371_100033434 311
160 3300027312 Ga0209371_1000744 Ga0209371_10007447 311
161 3300027312 Ga0209371_1005365 Ga0209371_10053653 311
162 3300028379 Ga0268266_10000165 Ga0268266_1000016571 311
163 3300030500 Ga0268256_1000001 Ga0268256_10000012576 311
164 3300030500 Ga0268256_1000323 Ga0268256_100032313 311
165 3300030500 Ga0268256_1000628 Ga0268256_10006287 311
166 3300030500 Ga0268256_1005143 Ga0268256_10051433 311
167 3300041405 Ga0439438_000798 Ga0439438_000798_11563_12525 311
168 3300041512 Ga0451853_1811120 Ga0451853_1811120_288_1250 311
169 3300042006 Ga0439432_058161 Ga0439432_058161_54_1016 311
170 3300042010 Ga0439452_000040 Ga0439452_000040_45574_46536 311
171 3300042010 Ga0439452_000362 Ga0439452_000362_1693_2655 311
172 3300042439 Ga0439464_0001188 Ga0439464_0001188_1017_1979 311
173 3300044669 Ga0466981_0000011 Ga0466981_0000011_26850_27812 311
174 3300046458 Ga0495591_000265 Ga0495591_000265_5939_6901 311
175 3300046460 Ga0495638_0000477 Ga0495638_0000477_25328_26290 311
176 3300046471 Ga0495650_0000205 Ga0495650_0000205_57505_58467 311
177 3300046694 Ga0495649_0000245 Ga0495649_0000245_6463_7425 311
178 3300046694 Ga0495649_0000704 Ga0495649_0000704_16840_17826 311
179 3300047469 Ga0495673_0001407 Ga0495673_0001407_15743_16705 311
180 3300048903 Ga0496100_0015040 Ga0496100_0015040_2076_3038 311
181 3300048904 Ga0496101_0060363 Ga0496101_0060363_1404_2366 311
182 3300048907 Ga0496104_0000172 Ga0496104_0000172_313_1275 311
183 3300048907 Ga0496104_0178715 Ga0496104_0178715_1057_2019 311
184 3300048908 Ga0496105_0043401 Ga0496105_0043401_912_1874 311
185 3300048919 Ga0496116_0000411 Ga0496116_0000411_2180_3142 311
186 3300048919 Ga0496116_0014444 Ga0496116_0014444_4746_5708 311
187 3300048919 Ga0496116_0028703 Ga0496116_0028703_1289_2251 311
188 3300048919 Ga0496116_0049751 Ga0496116_0049751_1267_2229 311
189 3300048920 Ga0496117_0000517 Ga0496117_0000517_28561_29523 311
190 3300048920 Ga0496117_0001239 Ga0496117_0001239_655_1617 311
191 3300048920 Ga0496117_0004405 Ga0496117_0004405_848_1810 311
192 3300048920 Ga0496117_0161810 Ga0496117_0161810_238_1200 311
193 3300048921 Ga0496118_0000428 Ga0496118_0000428_35083_36045 311
194 3300048921 Ga0496118_0005623 Ga0496118_0005623_10161_11123 311
195 3300048921 Ga0496118_0207172 Ga0496118_0207172_110_1072 311
196 3300048922 Ga0496119_0001022 Ga0496119_0001022_1520_2482 311
197 3300048922 Ga0496119_0001255 Ga0496119_0001255_5407_6369 311
198 3300048922 Ga0496119_0002170 Ga0496119_0002170_14390_15352 311
199 3300048922 Ga0496119_0013643 Ga0496119_0013643_4973_5935 311
200 3300048922 Ga0496119_0013740 Ga0496119_0013740_4111_5073 311
201 3300048922 Ga0496119_0071340 Ga0496119_0071340_932_1894 311
202 3300048922 Ga0496119_0080904 Ga0496119_0080904_195_1157 311
203 3300048923 Ga0496120_0000460 Ga0496120_0000460_27981_28943 311
204 3300048923 Ga0496120_0002784 Ga0496120_0002784_11333_12295 311
205 3300048923 Ga0496120_0025656 Ga0496120_0025656_1219_2181 311
206 3300048923 Ga0496120_0031078 Ga0496120_0031078_1395_2357 311
207 3300048923 Ga0496120_0039729 Ga0496120_0039729_59_1021 311
208 3300048924 Ga0496121_0001841 Ga0496121_0001841_24845_25807 311
209 3300048924 Ga0496121_0002570 Ga0496121_0002570_870_1832 311
210 3300048924 Ga0496121_0003887 Ga0496121_0003887_1605_2567 311
211 3300048924 Ga0496121_0004704 Ga0496121_0004704_16983_17945 311
212 3300048924 Ga0496121_0012649 Ga0496121_0012649_6587_7549 311
213 3300048924 Ga0496121_0019222 Ga0496121_0019222_2436_3398 311
214 3300048925 Ga0496122_0000145 Ga0496122_0000145_80801_81763 311
215 3300048925 Ga0496122_0001768 Ga0496122_0001768_4785_5747 311
216 3300048925 Ga0496122_0012045 Ga0496122_0012045_5547_6509 311
217 3300048925 Ga0496122_0095550 Ga0496122_0095550_941_1903 311
218 3300048926 Ga0496123_0000281 Ga0496123_0000281_83733_84695 311
219 3300048926 Ga0496123_0009633 Ga0496123_0009633_2162_3124 311
220 3300048926 Ga0496123_0010152 Ga0496123_0010152_4785_5747 311
221 3300048926 Ga0496123_0016959 Ga0496123_0016959_301_1263 311
222 3300048927 Ga0496124_0000217 Ga0496124_0000217_66173_67135 311
223 3300048927 Ga0496124_0002532 Ga0496124_0002532_19026_19988 311
224 3300048927 Ga0496124_0007281 Ga0496124_0007281_9270_10232 311
225 3300048927 Ga0496124_0034576 Ga0496124_0034576_1490_2452 311
226 3300048927 Ga0496124_0048669 Ga0496124_0048669_837_1799 311
227 3300048927 Ga0496124_0049742 Ga0496124_0049742_47_1009 311
228 3300048928 Ga0496125_0000413 Ga0496125_0000413_73140_74102 311
229 3300048928 Ga0496125_0001224 Ga0496125_0001224_16983_17945 311
230 3300048928 Ga0496125_0013279 Ga0496125_0013279_6095_7057 311
231 3300048928 Ga0496125_0014109 Ga0496125_0014109_6085_7128 311
232 3300048929 Ga0496126_0000457 Ga0496126_0000457_37482_38444 311
233 3300048929 Ga0496126_0001379 Ga0496126_0001379_23702_24664 311
234 3300048929 Ga0496126_0048574 Ga0496126_0048574_2670_3632 311
235 3300048929 Ga0496126_0103806 Ga0496126_0103806_1001_1963 311
236 3300048929 Ga0496126_0114648 Ga0496126_0114648_563_1525 311
237 3300048929 Ga0496126_0180806 Ga0496126_0180806_32_994 311
238 3300048929 Ga0496126_0215147 Ga0496126_0215147_90_1052 311
239 3300050491 nmdc:mga00v17_103000_c1 nmdc:mga00v17_103000_c1_321_1283 311
240 3300050491 nmdc:mga00v17_3353_c1 nmdc:mga00v17_3353_c1_5850_6812 311
241 iso_pu_bacteria 2847085930 2847090179 311
242 3300009011 Ga0105251_10020945 Ga0105251_100209454 313
243 3300009036 Ga0105244_10014267 Ga0105244_100142675 313
244 3300025728 Ga0207655_1013914 Ga0207655_10139143 313
245 3300025735 Ga0207713_1020667 Ga0207713_10206674 313
246 3300046660 Ga0495625_0002265 Ga0495625_0002265_18712_19683 313
247 3300047446 Ga0495679_000031 Ga0495679_000031_175796_176767 313
248 iso_pu_bacteria 2582581298 2585222312 313
249 iso_pu_bacteria 2585427529 2585544735 313
250 iso_pu_bacteria 2919100787 2919102878 313
251 3300006946 Ga0079104_1000200 Ga0079104_100020034 314
252 3300009036 Ga0105244_10001770 Ga0105244_100017702 314
253 3300009092 Ga0105250_10013872 Ga0105250_100138724 314
254 3300027111 Ga0209281_1000100 Ga0209281_1000100134 314
255 3300046542 Ga0495597_0005804 Ga0495597_0005804_1816_2790 314
256 3300046674 Ga0495588_0012042 Ga0495588_0012042_2026_3000 314
257 3300047320 Ga0495672_0000049 Ga0495672_0000049_975_1949 314
258 iso_pu_bacteria 2932401849 2932405048 314
259 3300041405 Ga0439438_005515 Ga0439438_005515_2955_3932 315
260 3300041407 Ga0439447_001300 Ga0439447_001300_6402_7379 315
261 3300048919 Ga0496116_0000348 Ga0496116_0000348_18225_19202 315
262 3300048922 Ga0496119_0002577 Ga0496119_0002577_3891_4868 315
263 3300048923 Ga0496120_0001060 Ga0496120_0001060_20535_21512 315
264 iso_pu_bacteria 2510917022 2511137278 315
265 iso_pu_bacteria 2524023207 2524452000 315
266 iso_pu_bacteria 2582581283 2585164362 315
267 iso_pu_bacteria 2582581306 2585264603 315
268 iso_pu_bacteria 2582581307 2585274105 315
269 iso_pu_bacteria 2582581865 2585389971 315
270 iso_pu_bacteria 2585427531 2585560555 315
271 iso_pu_bacteria 2585427608 2585898767 315
272 iso_pu_bacteria 2585427609 2585903662 315
273 iso_pu_bacteria 2585428125 2587981219 315
274 iso_pu_bacteria 2599185352 2600197115 315
275 iso_pu_bacteria 2643221557 2643804838 315
276 iso_pu_bacteria 2643221607 2644051703 315
277 iso_pu_bacteria 2643221610 2644067377 315
278 iso_pu_bacteria 2643221618 2644104273 315
279 iso_pu_bacteria 2643221626 2644148036 315
280 iso_pu_bacteria 2643221636 2644200187 315
281 iso_pu_bacteria 2643221655 2644310235 315
282 iso_pu_bacteria 2643221659 2644333441 315
283 iso_pu_bacteria 2643221668 2644378857 315
284 iso_pu_bacteria 2643221675 2644418465 315
285 iso_pu_bacteria 2643221680 2644451832 315
286 iso_pu_bacteria 2643221686 2644480571 315
287 iso_pu_bacteria 2643221689 2644498719 315
288 iso_pu_bacteria 2643221698 2644543711 315
289 iso_pu_bacteria 2643221712 2644616780 315
290 iso_pu_bacteria 2643221723 2644675180 315
291 iso_pu_bacteria 2643221726 2644691005 315
292 iso_pu_bacteria 2690316117 2692318987 315
293 iso_pu_bacteria 2751185821 2753459285 315
294 iso_pu_bacteria 2775507049 2776916037 315
295 iso_pu_bacteria 2842509118 2842510546 315
296 iso_pu_bacteria 2844163670 2844165046 315
297 iso_pu_bacteria 2847417321 2847422511 315
298 iso_pu_bacteria 2848992105 2848998080 315
299 iso_pu_bacteria 2852387548 2852390980 315
300 iso_pu_bacteria 2855872281 2855875848 315
301 iso_pu_bacteria 2891373044 2891376953 315
302 iso_pu_bacteria 2941499720 2941503968 315
303 iso_pu_bacteria 2957443900 2957444698 315
304 iso_pu_bacteria 2960617483 2960621127 315
305 iso_pu_bacteria 2960624210 2960630352 315
306 iso_pu_bacteria 2960660292 2960661413 315
307 iso_pu_bacteria 2977523885 2977524913 315
308 iso_pu_bacteria 2989349275 2989353811 315
309 iso_pu_bacteria 3003930520 3003935661 315
310 iso_pu_bacteria 643692032 643823617 315
311 3300002739 JGI25158J39367_1006431 JGI25158J39367_10064311 316
312 3300002987 JGI25159J45721_1000563 JGI25159J45721_10005635 316
313 3300003187 JGI25151J46595_10051658 JGI25151J46595_100516581 316
314 3300003354 JGI25160J50197_1000820 JGI25160J50197_100082013 316
315 3300003374 JGI25161J50226_1004440 JGI25161J50226_10044403 316
316 3300003771 Ga0055526_1001598 Ga0055526_100159813 316
317 3300003781 Ga0055536_1001086 Ga0055536_10010865 316
318 3300003791 Ga0055530_10012188 Ga0055530_100121882 316
319 3300004625 Ga0055543_1000727 Ga0055543_100072713 316
320 3300005262 Ga0065165_1002311 Ga0065165_100231113 316
321 3300025208 Ga0209436_100712 Ga0209436_1007126 316
322 3300025263 Ga0209565_1020783 Ga0209565_10207832 316
323 3300025284 Ga0209130_1001334 Ga0209130_100133413 316
324 3300025292 Ga0209676_1001434 Ga0209676_10014346 316
325 3300025294 Ga0209025_1007351 Ga0209025_10073516 316
326 3300025295 Ga0209564_1000081 Ga0209564_100008121 316
327 3300025298 Ga0209050_1000852 Ga0209050_100085220 316
328 3300025299 Ga0209256_1003364 Ga0209256_10033648 316
329 3300025302 Ga0207426_1001728 Ga0207426_100172813 316
330 3300025304 Ga0209257_1001851 Ga0209257_10018516 316
331 3300042010 Ga0439452_002414 Ga0439452_002414_961_1938 316
332 3300046518 Ga0495631_0130543 Ga0495631_0130543_96_1064 316
333 3300048924 Ga0496121_0193149 Ga0496121_0193149_240_1223 316
334 iso_pu_bacteria 2510461069 2510840239 316
335 iso_pu_bacteria 2643221568 2643853946 316
336 iso_pu_bacteria 2643221637 2644206992 316
337 iso_pu_bacteria 2643221718 2644650640 316
338 iso_pu_bacteria 2978969890 2978970098 316
339 iso_pu_bacteria 2984587000 2984587127 316
340 3300002739 JGI25158J39367_1000423 JGI25158J39367_10004231 317
341 3300002773 JGI25152J39213_1003426 JGI25152J39213_10034264 317
342 3300002774 JGI25150J39212_1001197 JGI25150J39212_10011973 317
343 3300002987 JGI25159J45721_1006968 JGI25159J45721_10069682 317
344 3300003187 JGI25151J46595_10003579 JGI25151J46595_100035796 317
345 3300003215 JGI25153J46596_10006515 JGI25153J46596_100065153 317
346 3300003215 JGI25153J46596_10007864 JGI25153J46596_100078643 317
347 3300003354 JGI25160J50197_1008401 JGI25160J50197_10084012 317
348 3300003374 JGI25161J50226_1000289 JGI25161J50226_100028926 317
349 3300003771 Ga0055526_1004357 Ga0055526_10043578 317
350 3300003790 Ga0055528_1018754 Ga0055528_10187542 317
351 3300003792 Ga0055540_1009751 Ga0055540_10097511 317
352 3300004625 Ga0055543_1000023 Ga0055543_1000023104 317
353 3300005262 Ga0065165_1014205 Ga0065165_10142052 317
354 3300025208 Ga0209436_100035 Ga0209436_10003570 317
355 3300025245 Ga0207425_1000968 Ga0207425_10009683 317
356 3300025258 Ga0209129_1003607 Ga0209129_10036074 317
357 3300025284 Ga0209130_1000031 Ga0209130_1000031134 317
358 3300025294 Ga0209025_1005690 Ga0209025_10056906 317
359 3300025295 Ga0209564_1000826 Ga0209564_100082630 317
360 3300025297 Ga0209758_1011158 Ga0209758_10111583 317
361 3300025297 Ga0209758_1011779 Ga0209758_10117792 317
362 3300025302 Ga0207426_1000042 Ga0207426_1000042276 317
363 3300025303 Ga0209051_1013148 Ga0209051_10131484 317
364 3300025923 Ga0207681_10110117 Ga0207681_101101172 317
365 3300028577 Ga0265318_10016718 Ga0265318_100167183 317
366 3300028794 Ga0307515_10022779 Ga0307515_100227794 317
367 3300031247 Ga0265340_10030451 Ga0265340_100304512 317
368 3300031456 Ga0307513_10024760 Ga0307513_100247604 317
369 3300031711 Ga0265314_10053968 Ga0265314_100539681 317
370 3300041413 Ga0439465_0057818 Ga0439465_0057818_254_1258 317
371 3300046694 Ga0495649_0029090 Ga0495649_0029090_1134_2138 317
372 3300048909 Ga0496106_0000401 Ga0496106_0000401_19575_20579 317
373 3300048919 Ga0496116_0146218 Ga0496116_0146218_215_1219 317
374 3300048921 Ga0496118_0081093 Ga0496118_0081093_104_1108 317
375 3300048924 Ga0496121_0007775 Ga0496121_0007775_9058_10062 317
376 3300048926 Ga0496123_0144231 Ga0496123_0144231_104_1108 317
377 3300049744 Ga0501083_0037673 Ga0501083_0037673_1051_2055 317
378 3300053156 Ga0500622_0000343 Ga0500622_0000343_42272_43276 317
379 iso_pu_bacteria 8055693939 8055698006 317
380 3300003775 Ga0055524_1002668 Ga0055524_10026687 318
381 3300025294 Ga0209025_1057570 Ga0209025_10575701 318
382 3300025299 Ga0209256_1000639 Ga0209256_100063936 318
383 3300031728 Ga0316578_10022617 Ga0316578_100226173 318
384 3300048928 Ga0496125_0000221 Ga0496125_0000221_104346_105347 318
385 iso_pu_bacteria 2738543031 2739350913 318
386 3300005468 Ga0070707_100308219 Ga0070707_1003082191 319
387 3300006353 Ga0075370_10044492 Ga0075370_100444921 319
388 3300013249 Ga0171463_1016 Ga0171463_101664 319
389 3300015690 Ga0183363_1267 Ga0183363_12674 319
390 3300025294 Ga0209025_1000121 Ga0209025_1000121125 319
391 3300025910 Ga0207684_10509325 Ga0207684_105093251 319
392 3300031456 Ga0307513_10003256 Ga0307513_100032566 319
393 3300046460 Ga0495638_0014130 Ga0495638_0014130_855_1865 319
394 3300046460 Ga0495638_0024332 Ga0495638_0024332_1408_2418 319
395 3300048920 Ga0496117_0001463 Ga0496117_0001463_29174_30178 319
396 3300048925 Ga0496122_0001329 Ga0496122_0001329_14741_15745 319
397 3300048926 Ga0496123_0000018 Ga0496123_0000018_23901_24905 319
398 3300048927 Ga0496124_0000940 Ga0496124_0000940_17315_18319 319
399 3300048928 Ga0496125_0000161 Ga0496125_0000161_92506_93510 319
400 3300048929 Ga0496126_0000212 Ga0496126_0000212_86065_87069 319
401 3300053088 Ga0500644_0007122 Ga0500644_0007122_93_1103 319
402 3300053156 Ga0500622_0004607 Ga0500622_0004607_4584_5594 319
403 3300053177 Ga0500636_0001782 Ga0500636_0001782_5621_6631 319
404 iso_pu_bacteria 2511231027 2511389559 319
405 iso_pu_bacteria 2775506902 2776269682 319
406 iso_pu_bacteria 2775506904 2776282611 319
407 iso_pu_bacteria 2842871566 2842872624 319
408 iso_pu_bacteria 2919119836 2919124820 319
409 iso_pu_bacteria 3002141150 3002141574 319
410 3300013105 Ga0157369_10037593 Ga0157369_100375933 320
411 3300048919 Ga0496116_0000233 Ga0496116_0000233_83281_84294 320
412 3300048929 Ga0496126_0001037 Ga0496126_0001037_26959_27972 320
413 3300028794 Ga0307515_10024806 Ga0307515_100248062 321
414 3300031595 Ga0265313_10009489 Ga0265313_100094897 321
415 3300049571 Ga0501034_0066095 Ga0501034_0066095_1167_2165 321
416 3300049572 Ga0501036_0151551 Ga0501036_0151551_712_1710 321
417 3300049580 Ga0501046_0074604 Ga0501046_0074604_285_1283 321
418 3300049581 Ga0501047_0009665 Ga0501047_0009665_6400_7398 321
419 3300049583 Ga0501067_0029936 Ga0501067_0029936_1072_2070 321
420 3300049585 Ga0501069_0036367 Ga0501069_0036367_1510_2508 321
421 3300049589 Ga0501073_0011570 Ga0501073_0011570_1861_2859 321
422 3300049590 Ga0501074_0008060 Ga0501074_0008060_3414_4412 321
423 3300049742 Ga0501080_0011770 Ga0501080_0011770_3280_4278 321
424 3300049744 Ga0501083_0008142 Ga0501083_0008142_4156_5154 321
425 3300049822 Ga0501035_0262151 Ga0501035_0262151_25_1023 321
426 3300049823 Ga0501044_0014820 Ga0501044_0014820_4691_5689 321
427 3300054114 Ga0501084_0013748 Ga0501084_0013748_4146_5144 321
428 3300060353 Ga0501082_0001003 Ga0501082_0001003_5396_6394 321
429 iso_pu_bacteria 2503198000 2503198883 321
430 iso_pu_bacteria 2508501123 2509117911 321
431 iso_pu_bacteria 2509276018 2509368893 321
432 iso_pu_bacteria 2509276022 2509393694 321
433 iso_pu_bacteria 2512875016 2512933722 321
434 iso_pu_bacteria 2512875024 2512961887 321
435 iso_pu_bacteria 2513237164 2514035445 321
436 iso_pu_bacteria 2588253730 2588519805 321
437 iso_pu_bacteria 2687453392 2688596155 321
438 iso_pu_bacteria 2693429783 2694627712 321
439 iso_pu_bacteria 2693429784 2694636826 321
440 iso_pu_bacteria 2721755686 2723573293 321
441 iso_pu_bacteria 2756170246 2756673552 321
442 iso_pu_bacteria 2841734538 2841736551 321
443 iso_pu_bacteria 2844002411 2844003280 321
444 iso_pu_bacteria 2856320880 2856324070 321
445 iso_pu_bacteria 2856328259 2856329437 321
446 iso_pu_bacteria 2856334872 2856335078 321
447 iso_pu_bacteria 2856364286 2856367388 321
448 iso_pu_bacteria 2857349434 2857353095 321
449 iso_pu_bacteria 2869169390 2869174244 321
450 iso_pu_bacteria 2869234852 2869239198 321
451 iso_pu_bacteria 2869242130 2869246632 321
452 iso_pu_bacteria 2869249662 2869256581 321
453 iso_pu_bacteria 2869256925 2869257584 321
454 iso_pu_bacteria 2869264136 2869270089 321
455 iso_pu_bacteria 2869271264 2869271629 321
456 iso_pu_bacteria 2869278585 2869282405 321
457 iso_pu_bacteria 2869285874 2869288529 321
458 iso_pu_bacteria 2871429161 2871431196 321
459 iso_pu_bacteria 2871435913 2871443382 321
460 iso_pu_bacteria 2871451962 2871452045 321
461 iso_pu_bacteria 2871459585 2871465275 321
462 iso_pu_bacteria 2871466892 2871473467 321
463 iso_pu_bacteria 2871474448 2871478537 321
464 iso_pu_bacteria 2871481445 2871481545 321
465 iso_pu_bacteria 2871495908 2871498816 321
466 iso_pu_bacteria 2874109183 2874114846 321
467 iso_pu_bacteria 2874116593 2874123514 321
468 iso_pu_bacteria 2874123672 2874126290 321
469 iso_pu_bacteria 2874131515 2874134453 321
470 iso_pu_bacteria 2874139085 2874142764 321
471 iso_pu_bacteria 2874146452 2874150571 321
472 iso_pu_bacteria 2874155637 2874158311 321
473 iso_pu_bacteria 2874162495 2874163669 321
474 iso_pu_bacteria 2874168670 2874170524 321
475 iso_pu_bacteria 2876363079 2876364023 321
476 iso_pu_bacteria 2876377896 2876381400 321
477 iso_pu_bacteria 2876386047 2876392590 321
478 iso_pu_bacteria 2876392853 2876399057 321
479 iso_pu_bacteria 2876399893 2876401118 321
480 iso_pu_bacteria 2876406927 2876407899 321
481 iso_pu_bacteria 2876413966 2876416619 321
482 iso_pu_bacteria 2876420981 2876427223 321
483 iso_pu_bacteria 2878730984 2878734941 321
484 iso_pu_bacteria 2878738818 2878739794 321
485 iso_pu_bacteria 2878745973 2878747800 321
486 iso_pu_bacteria 2878760144 2878763034 321
487 iso_pu_bacteria 2878767105 2878770004 321
488 iso_pu_bacteria 2878781027 2878782814 321
489 iso_pu_bacteria 2878788777 2878792915 321
490 iso_pu_bacteria 2881147464 2881148370 321
491 iso_pu_bacteria 2881155292 2881158316 321
492 iso_pu_bacteria 2881161766 2881165153 321
493 iso_pu_bacteria 2882632389 2882635236 321
494 iso_pu_bacteria 2885305155 2885307032 321
495 iso_pu_bacteria 2885326080 2885329029 321
496 iso_pu_bacteria 2885334103 2885339784 321
497 iso_pu_bacteria 2885342637 2885349263 321
498 iso_pu_bacteria 2885350715 2885357493 321
499 iso_pu_bacteria 2888337043 2888343547 321
500 iso_pu_bacteria 2888350351 2888353369 321
501 iso_pu_bacteria 2889010040 2889015085 321
502 iso_pu_bacteria 2889016732 2889019840 321
503 iso_pu_bacteria 2903448605 2903453878 321
504 iso_pu_bacteria 2903492973 2903502281 321
505 iso_pu_bacteria 2903513507 2903521373 321
506 iso_pu_bacteria 2903521522 2903525818 321
507 iso_pu_bacteria 2903528002 2903532636 321
508 iso_pu_bacteria 2903540706 2903543618 321
509 iso_pu_bacteria 2904659560 2904665584 321
510 iso_pu_bacteria 2906308376 2906310973 321
511 iso_pu_bacteria 2906321335 2906323084 321
512 iso_pu_bacteria 2906354277 2906354912 321
513 iso_pu_bacteria 2906363423 2906366351 321
514 iso_pu_bacteria 2906370794 2906374156 321
515 iso_pu_bacteria 2906378014 2906385749 321
516 iso_pu_bacteria 2906386501 2906391744 321
517 iso_pu_bacteria 2906393657 2906394422 321
518 iso_pu_bacteria 2906408224 2906408993 321
519 iso_pu_bacteria 2922130491 2922137749 321
520 iso_pu_bacteria 2922151315 2922153578 321
521 iso_pu_bacteria 2922178524 2922182116 321
522 iso_pu_bacteria 2922185730 2922189398 321
523 iso_pu_bacteria 2924733363 2924740597 321
524 iso_pu_bacteria 2924741084 2924741754 321
525 iso_pu_bacteria 2924748358 2924753115 321
526 iso_pu_bacteria 2924762789 2924768712 321
527 iso_pu_bacteria 2924776078 2924777415 321
528 iso_pu_bacteria 2937813078 2937815510 321
529 iso_pu_bacteria 2937822353 2937822826 321
530 iso_pu_bacteria 2937836603 2937838874 321
531 iso_pu_bacteria 2937848649 2937852719 321
532 iso_pu_bacteria 2937861824 2937864387 321
533 iso_pu_bacteria 2937877337 2937880434 321
534 iso_pu_bacteria 2937972304 2937975768 321
535 iso_pu_bacteria 2937994558 2937997464 321
536 iso_pu_bacteria 2938014810 2938020422 321
537 iso_pu_bacteria 2939669807 2939671941 321
538 iso_pu_bacteria 2958034702 2958038263 321
539 iso_pu_bacteria 2958041894 2958050989 321
540 iso_pu_bacteria 2958071322 2958072329 321
541 iso_pu_bacteria 2958084443 2958087569 321
542 iso_pu_bacteria 2958092219 2958092469 321
543 iso_pu_bacteria 2958100919 2958105007 321
544 iso_pu_bacteria 2958115193 2958116255 321
545 iso_pu_bacteria 2958122699 2958129573 321
546 iso_pu_bacteria 2958130278 2958132931 321
547 iso_pu_bacteria 2958144490 2958149813 321
548 iso_pu_bacteria 2958158011 2958161390 321
549 iso_pu_bacteria 2958165035 2958167938 321
550 iso_pu_bacteria 2958172287 2958178341 321
551 iso_pu_bacteria 2958179912 2958182633 321
552 iso_pu_bacteria 2961077736 2961080481 321
553 iso_pu_bacteria 2961114664 2961120927 321
554 iso_pu_bacteria 2961127735 2961134275 321
555 iso_pu_bacteria 2961163497 2961166406 321
556 iso_pu_bacteria 2961183825 2961187706 321
557 iso_pu_bacteria 2963644680 2963645481 321
558 iso_pu_bacteria 2965018300 2965021225 321
559 iso_pu_bacteria 2965025482 2965026809 321
560 iso_pu_bacteria 2965032056 2965033245 321
561 iso_pu_bacteria 2965040258 2965046120 321
562 iso_pu_bacteria 2965047637 2965053987 321
563 iso_pu_bacteria 2965089291 2965091077 321
564 iso_pu_bacteria 2965102966 2965109662 321
565 iso_pu_bacteria 2965110997 2965114061 321
566 iso_pu_bacteria 2965119406 2965125536 321
567 iso_pu_bacteria 2968016561 2968017403 321
568 iso_pu_bacteria 2968083720 2968085188 321
569 iso_pu_bacteria 2968110612 2968117077 321
570 iso_pu_bacteria 2968117919 2968122499 321
571 iso_pu_bacteria 2968171901 2968174807 321
572 iso_pu_bacteria 2970469710 2970472447 321
573 iso_pu_bacteria 2970489779 2970493569 321
574 iso_pu_bacteria 2970510686 2970511147 321
575 iso_pu_bacteria 2970532167 2970536322 321
576 iso_pu_bacteria 2970547951 2970550904 321
577 iso_pu_bacteria 2970554993 2970557889 321
578 iso_pu_bacteria 2970593180 2970597014 321
579 iso_pu_bacteria 2970619444 2970622865 321
580 iso_pu_bacteria 2970627176 2970629596 321
581 iso_pu_bacteria 2977843712 2977846725 321
582 iso_pu_bacteria 2977851361 2977853499 321
583 iso_pu_bacteria 2977858184 2977863577 321
584 iso_pu_bacteria 2977864932 2977869311 321
585 iso_pu_bacteria 2977872689 2977876734 321
586 iso_pu_bacteria 2977898635 2977902951 321
587 iso_pu_bacteria 2977922695 2977924742 321
588 iso_pu_bacteria 2977935797 2977935828 321
589 iso_pu_bacteria 2977942078 2977945555 321
590 iso_pu_bacteria 2977950692 2977952145 321
591 iso_pu_bacteria 2977971508 2977979559 321
592 iso_pu_bacteria 2979710463 2979715333 321
593 iso_pu_bacteria 2979764755 2979768881 321
594 iso_pu_bacteria 2979772303 2979775665 321
595 iso_pu_bacteria 2987636660 2987641687 321
596 iso_pu_bacteria 2987645492 2987646912 321
597 iso_pu_bacteria 2987652177 2987653928 321
598 iso_pu_bacteria 2987659509 2987662414 321
599 iso_pu_bacteria 2987666974 2987667128 321
600 iso_pu_bacteria 2987673487 2987679619 321
601 iso_pu_bacteria 2996310559 2996314976 321
602 iso_pu_bacteria 2996386984 2996392779 321
603 iso_pu_bacteria 3000135777 3000137546 321
604 iso_pu_bacteria 3004167301 3004173471 321
605 iso_pu_bacteria 3004188549 3004191465 321
606 iso_pu_bacteria 3004195979 3004199175 321
607 iso_pu_bacteria 3004203850 3004209501 321
608 iso_pu_bacteria 3004211236 3004218533 321
609 iso_pu_bacteria 3004218560 3004223621 321
610 iso_pu_bacteria 3004232784 3004238286 321
611 iso_pu_bacteria 3004268573 3004273028 321
612 iso_pu_bacteria 637000159 637076834 321
613 iso_pu_bacteria 649633066 649870715 321
614 iso_pu_bacteria 8002285264 8002287303 321
615 iso_pu_bacteria 8004312739 8004314950 321
616 iso_pu_bacteria 8004361976 8004368351 321
617 iso_pu_bacteria 8004387939 8004390498 321
618 iso_pu_bacteria 8004445564 8004448770 321
619 iso_pu_bacteria 8004633249 8004638940 321
620 iso_pu_bacteria 8004640170 8004641862 321
621 iso_pu_bacteria 8004695233 8004697187 321
622 iso_pu_bacteria 8004703790 8004704751 321
623 iso_pu_bacteria 8004714634 8004717190 321
624 iso_pu_bacteria 8004727605 8004734610 321
625 3300048925 Ga0496122_0008279 Ga0496122_0008279_4619_5623 322
626 3300005539 Ga0068853_100011643 Ga0068853_1000116434 324
627 3300009551 Ga0105238_10258160 Ga0105238_102581601 324
628 3300010375 Ga0105239_10012979 Ga0105239_100129798 324
629 3300013105 Ga0157369_10107538 Ga0157369_101075382 324
630 3300025914 Ga0207671_10056487 Ga0207671_100564873 324
631 3300025924 Ga0207694_10193215 Ga0207694_101932151 324
632 3300037418 Ga0395900_0096725 Ga0395900_0096725_1012_2025 324
633 3300048918 Ga0496115_0241670 Ga0496115_0241670_92_1105 324
634 3300048924 Ga0496121_0082770 Ga0496121_0082770_41_1054 324
635 3300048929 Ga0496126_0058691 Ga0496126_0058691_1969_2982 324
636 3300002705 JGI25156J39149_1004068 JGI25156J39149_10040682 325
637 3300002741 JGI25157J39369_1000879 JGI25157J39369_10008791 325
638 3300003762 Ga0055542_1001704 Ga0055542_10017046 325
639 3300006038 Ga0075365_10020247 Ga0075365_100202474 325
640 3300006038 Ga0075365_10027717 Ga0075365_100277172 325
641 3300006048 Ga0075363_100040104 Ga0075363_1000401041 325
642 3300006048 Ga0075363_100204517 Ga0075363_1002045171 325
643 3300006051 Ga0075364_10064433 Ga0075364_100644332 325
644 3300009174 Ga0105241_10118234 Ga0105241_101182343 325
645 3300009545 Ga0105237_10120666 Ga0105237_101206662 325
646 3300025250 Ga0209026_1000141 Ga0209026_100014190 325
647 3300025254 Ga0209148_1000111 Ga0209148_100011143 325
648 3300025256 Ga0209759_1000354 Ga0209759_100035433 325
649 3300025272 Ga0209455_1000206 Ga0209455_100020642 325
650 3300025297 Ga0209758_1014158 Ga0209758_10141585 325
651 3300025933 Ga0207706_10260167 Ga0207706_102601671 325
652 3300026089 Ga0207648_10301135 Ga0207648_103011352 325
653 3300026116 Ga0207674_10208463 Ga0207674_102084631 325
654 3300028379 Ga0268266_10376663 Ga0268266_103766631 325
655 3300037312 Ga0395899_0047144 Ga0395899_0047144_1834_2862 325
656 3300037418 Ga0395900_0000021 Ga0395900_0000021_41085_42113 325
657 3300037466 Ga0395898_0002409 Ga0395898_0002409_18481_19509 325
658 3300037471 Ga0395905_0000912 Ga0395905_0000912_24898_25926 325
659 3300037471 Ga0395905_0025305 Ga0395905_0025305_2318_3331 325
660 3300038443 Ga0395901_0014520 Ga0395901_0014520_4131_5159 325
661 3300047472 Ga0495686_0000045 Ga0495686_0000045_232182_233207 325
662 3300048915 Ga0496112_0015340 Ga0496112_0015340_4482_5495 325
663 3300048921 Ga0496118_0036064 Ga0496118_0036064_330_1343 325
664 3300050492 nmdc:mga0yw44_13314_c1 nmdc:mga0yw44_13314_c1_592_1605 325
665 3300050492 nmdc:mga0yw44_15035_c1 nmdc:mga0yw44_15035_c1_343_1356 325
666 3300050492 nmdc:mga0yw44_86236_c1 nmdc:mga0yw44_86236_c1_252_1277 325
667 3300050494 nmdc:mga06z11_131522_c1 nmdc:mga06z11_131522_c1_52_1065 325
668 3300050496 nmdc:mga07m45_102151_c1 nmdc:mga07m45_102151_c1_500_1525 325
669 3300053079 Ga0500610_0072085 Ga0500610_0072085_472_1497 325
670 3300053153 Ga0500616_0070862 Ga0500616_0070862_634_1647 325
671 3300053153 Ga0500616_0077995 Ga0500616_0077995_404_1417 325
672 iso_pu_bacteria 2513237305 2514421957 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

48

245

0.91

PF02254

TrkA_N

TrkA-N domain

310

373

0.9

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

25

256

0.87

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

46

241

0.87

PF13379

NMT1_2

NMT1-like family

19

252

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.9736 18 317
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.9672 18 317
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8483 19 314
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.835 14 317
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8294 18 320
ID Description Score Start End Superfamily
af_Q47537_124_320_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9635 122 318 3.40.190.10
af_Q47537_124_320_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9492 122 318 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9324 98 189 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8721 101 192 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8537 98 189 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A530BGF1-F1-model_v4 Taurine ABC transporter substrate-binding protein 0.9885 156 325 GO:0022857
GO:0042918
GO:0043190
AF-A0A530BGF1-F1-model_v4 Taurine ABC transporter substrate-binding protein 0.9827 156 325 GO:0022857
GO:0042918
GO:0043190
AF-A0A013RS58-F1-model_v4 deleted 0.9803 10 318
AF-A0A062IQY5-F1-model_v4 Taurine ABC transporter, periplasmic binding protein 0.9722 10 272 GO:0022857
GO:0042597
GO:0042918
GO:0043190
AF-A0A0J8YK14-F1-model_v4 Taurine ABC transporter substrate-binding protein 0.9708 8 322 GO:0022857
GO:0042597
GO:0042918
GO:0043190

Feature Viewer

pLDDT pTM Quality
92.52 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map