F474242
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 371 | 672 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0010104|Ga0373934_0010104_2543_3088 |
| Length | 181 |
| Sequence | MRTFKSRAVFKERGTNNPQAISARAPNEGEVLMTTVAFTINGKPASVEADAETPLLWIVREHLKLTGTKFGCGAGLCGACTVHIDGKAVRSCQTQLSDVANKKVTTIEGLSPSSNHPLQKAWVAMQVPQCGYCQSGQIMQAAELLAKNPKPTREQIVAHMDGNICRCGTYSEIIAAIQSVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 99 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 239 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 240 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 317 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.32 |
| Nodule | 0.15 |
| Rhizoplane | 4.76 |
| Rhizosphere | 90.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10128726 | 3300003373 | Bacteria | 623 |
| 2 | JGI25404J52841_10016510 | 3300003659 | Bacteria | 1601 |
| 3 | Ga0065704_10785888 | 3300005289 | Bacteria | 530 |
| 4 | Ga0070690_100006106 | 3300005330 | Bacteria | 6818 |
| 5 | Ga0070677_10374496 | 3300005333 | Bacteria | 744 |
| 6 | Ga0068869_100389709 | 3300005334 | Bacteria | 1143 |
| 7 | Ga0068869_100391792 | 3300005334 | Bacteria | 1141 |
| 8 | Ga0068869_100440164 | 3300005334 | Bacteria | 1079 |
| 9 | Ga0070666_10355014 | 3300005335 | Bacteria | 1049 |
| 10 | Ga0070680_100032648 | 3300005336 | Bacteria | 4191 |
| 11 | Ga0070680_100262602 | 3300005336 | Bacteria | 1461 |
| 12 | Ga0070680_100624075 | 3300005336 | Bacteria | 926 |
| 13 | Ga0070682_100048610 | 3300005337 | Bacteria | 2642 |
| 14 | Ga0070682_100302877 | 3300005337 | Bacteria | 1174 |
| 15 | Ga0070660_101419699 | 3300005339 | Bacteria | 590 |
| 16 | Ga0070687_100126458 | 3300005343 | Bacteria | 1470 |
| 17 | Ga0070687_100342959 | 3300005343 | Bacteria | 962 |
| 18 | Ga0070661_100020373 | 3300005344 | Bacteria | 4728 |
| 19 | Ga0070692_10090294 | 3300005345 | Bacteria | 1664 |
| 20 | Ga0070668_100519804 | 3300005347 | Bacteria | 1033 |
| 21 | Ga0070668_100654926 | 3300005347 | Bacteria | 923 |
| 22 | Ga0070669_100022862 | 3300005353 | Bacteria | 4472 |
| 23 | Ga0070675_100183795 | 3300005354 | Bacteria | 1808 |
| 24 | Ga0070675_100612894 | 3300005354 | Bacteria | 988 |
| 25 | Ga0070671_100008579 | 3300005355 | Bacteria | 8192 |
| 26 | Ga0070671_100025538 | 3300005355 | Bacteria | 4848 |
| 27 | Ga0070674_100227535 | 3300005356 | Bacteria | 1454 |
| 28 | Ga0070674_101144444 | 3300005356 | Bacteria | 689 |
| 29 | Ga0070674_102000651 | 3300005356 | Bacteria | 527 |
| 30 | Ga0070673_100226801 | 3300005364 | Bacteria | 1619 |
| 31 | Ga0070673_100342201 | 3300005364 | Bacteria | 1326 |
| 32 | Ga0070673_100356908 | 3300005364 | Bacteria | 1299 |
| 33 | Ga0070673_100397972 | 3300005364 | Bacteria | 1231 |
| 34 | Ga0070688_100029086 | 3300005365 | Bacteria | 3305 |
| 35 | Ga0070688_100805501 | 3300005365 | Bacteria | 735 |
| 36 | Ga0070667_100027878 | 3300005367 | Bacteria | 4700 |
| 37 | Ga0070709_10043323 | 3300005434 | Bacteria | 2783 |
| 38 | Ga0070714_100123387 | 3300005435 | Bacteria | 2307 |
| 39 | Ga0070714_100175915 | 3300005435 | Bacteria | 1945 |
| 40 | Ga0070714_100409051 | 3300005435 | Bacteria | 1284 |
| 41 | Ga0070714_102161638 | 3300005435 | Bacteria | 542 |
| 42 | Ga0070713_100009021 | 3300005436 | Bacteria | 7109 |
| 43 | Ga0070713_100040579 | 3300005436 | Bacteria | 3785 |
| 44 | Ga0070705_100073272 | 3300005440 | Bacteria | 2077 |
| 45 | Ga0070705_100115431 | 3300005440 | Bacteria | 1724 |
| 46 | Ga0070705_100290007 | 3300005440 | Bacteria | 1168 |
| 47 | Ga0070705_100453974 | 3300005440 | Bacteria | 962 |
| 48 | Ga0070700_100013138 | 3300005441 | Bacteria | 4645 |
| 49 | Ga0070700_100194672 | 3300005441 | Bacteria | 1420 |
| 50 | Ga0070700_100615643 | 3300005441 | Bacteria | 853 |
| 51 | Ga0070700_100711916 | 3300005441 | Bacteria | 799 |
| 52 | Ga0070694_100003882 | 3300005444 | Bacteria | 8935 |
| 53 | Ga0070694_100719311 | 3300005444 | Bacteria | 813 |
| 54 | Ga0070708_100188446 | 3300005445 | Bacteria | 1929 |
| 55 | Ga0070708_100419022 | 3300005445 | Bacteria | 1263 |
| 56 | Ga0070678_100049153 | 3300005456 | Bacteria | 3042 |
| 57 | Ga0070678_100342618 | 3300005456 | Bacteria | 1283 |
| 58 | Ga0070681_10133520 | 3300005458 | Bacteria | 2413 |
| 59 | Ga0070681_10427378 | 3300005458 | Bacteria | 1237 |
| 60 | Ga0070681_10814770 | 3300005458 | Bacteria | 851 |
| 61 | Ga0068867_100017351 | 3300005459 | Bacteria | 5113 |
| 62 | Ga0070685_10202602 | 3300005466 | Bacteria | 1291 |
| 63 | Ga0070706_100622432 | 3300005467 | Bacteria | 1002 |
| 64 | Ga0070707_100018789 | 3300005468 | Bacteria | 6508 |
| 65 | Ga0070699_100120113 | 3300005518 | Bacteria | 2310 |
| 66 | Ga0070679_100186952 | 3300005530 | Bacteria | 2042 |
| 67 | Ga0070672_100260719 | 3300005543 | Bacteria | 1462 |
| 68 | Ga0070672_100384043 | 3300005543 | Bacteria | 1201 |
| 69 | Ga0070672_100895312 | 3300005543 | Bacteria | 784 |
| 70 | Ga0070686_100027561 | 3300005544 | Bacteria | 3439 |
| 71 | Ga0070686_100142741 | 3300005544 | Bacteria | 1668 |
| 72 | Ga0070686_101258202 | 3300005544 | Bacteria | 617 |
| 73 | Ga0070695_100015436 | 3300005545 | Bacteria | 4613 |
| 74 | Ga0070695_100145469 | 3300005545 | Bacteria | 1648 |
| 75 | Ga0070696_100029970 | 3300005546 | Bacteria | 3722 |
| 76 | Ga0070696_100038929 | 3300005546 | Bacteria | 3283 |
| 77 | Ga0070696_100665171 | 3300005546 | Bacteria | 846 |
| 78 | Ga0070696_100831509 | 3300005546 | Bacteria | 762 |
| 79 | Ga0070693_100201773 | 3300005547 | Bacteria | 1292 |
| 80 | Ga0070665_100974124 | 3300005548 | Bacteria | 860 |
| 81 | Ga0070665_101824417 | 3300005548 | Bacteria | 614 |
| 82 | Ga0070704_100016121 | 3300005549 | Bacteria | 4714 |
| 83 | Ga0070704_100418576 | 3300005549 | Bacteria | 1147 |
| 84 | Ga0068855_100977352 | 3300005563 | Bacteria | 891 |
| 85 | Ga0068857_100248290 | 3300005577 | Bacteria | 1631 |
| 86 | Ga0068857_100377497 | 3300005577 | Bacteria | 1316 |
| 87 | Ga0068856_100082302 | 3300005614 | Bacteria | 3194 |
| 88 | Ga0070702_100027865 | 3300005615 | Bacteria | 3054 |
| 89 | Ga0070702_100144172 | 3300005615 | Bacteria | 1521 |
| 90 | Ga0070702_100151106 | 3300005615 | Bacteria | 1491 |
| 91 | Ga0068852_100858171 | 3300005616 | Bacteria | 924 |
| 92 | Ga0068859_100905611 | 3300005617 | Bacteria | 966 |
| 93 | Ga0068859_100978902 | 3300005617 | Bacteria | 928 |
| 94 | Ga0068859_101608328 | 3300005617 | Bacteria | 718 |
| 95 | Ga0068864_100429786 | 3300005618 | Bacteria | 1260 |
| 96 | Ga0068864_100717558 | 3300005618 | Bacteria | 978 |
| 97 | Ga0068866_10011993 | 3300005718 | Bacteria | 3768 |
| 98 | Ga0068866_10425324 | 3300005718 | Bacteria | 863 |
| 99 | Ga0068861_100340354 | 3300005719 | Bacteria | 1313 |
| 100 | Ga0068861_100438187 | 3300005719 | Bacteria | 1168 |
| 101 | Ga0068861_100479378 | 3300005719 | Bacteria | 1120 |
| 102 | Ga0068861_101432359 | 3300005719 | Bacteria | 676 |
| 103 | Ga0068870_10308294 | 3300005840 | Bacteria | 1002 |
| 104 | Ga0068863_100210284 | 3300005841 | Bacteria | 1873 |
| 105 | Ga0068863_101236766 | 3300005841 | Bacteria | 753 |
| 106 | Ga0068858_100072052 | 3300005842 | Bacteria | 3205 |
| 107 | Ga0068858_100190310 | 3300005842 | Bacteria | 1939 |
| 108 | Ga0068860_100079095 | 3300005843 | Bacteria | 3126 |
| 109 | Ga0068860_100117945 | 3300005843 | Bacteria | 2540 |
| 110 | Ga0068860_100190478 | 3300005843 | Bacteria | 1985 |
| 111 | Ga0068860_100785953 | 3300005843 | Bacteria | 965 |
| 112 | Ga0068860_101594448 | 3300005843 | Bacteria | 675 |
| 113 | Ga0068862_100018505 | 3300005844 | Bacteria | 5802 |
| 114 | Ga0068862_100030714 | 3300005844 | Bacteria | 4529 |
| 115 | Ga0068862_101540753 | 3300005844 | Bacteria | 671 |
| 116 | Ga0081455_10036231 | 3300005937 | Bacteria | 4397 |
| 117 | Ga0081455_10107400 | 3300005937 | Bacteria | 2225 |
| 118 | Ga0081538_10176651 | 3300005981 | Bacteria | 921 |
| 119 | Ga0081538_10181416 | 3300005981 | Bacteria | 900 |
| 120 | Ga0081540_1006133 | 3300005983 | Bacteria | 8828 |
| 121 | Ga0081539_10026344 | 3300005985 | Bacteria | 3712 |
| 122 | Ga0081539_10269674 | 3300005985 | Bacteria | 746 |
| 123 | Ga0070717_10287787 | 3300006028 | Bacteria | 1458 |
| 124 | Ga0070717_10304245 | 3300006028 | Bacteria | 1418 |
| 125 | Ga0070717_10353656 | 3300006028 | Bacteria | 1314 |
| 126 | Ga0075368_10371382 | 3300006042 | Bacteria | 625 |
| 127 | Ga0075363_100081654 | 3300006048 | Bacteria | 1768 |
| 128 | Ga0075363_100304863 | 3300006048 | Bacteria | 925 |
| 129 | Ga0075364_10052349 | 3300006051 | Bacteria | 2667 |
| 130 | Ga0075364_10336997 | 3300006051 | Bacteria | 1028 |
| 131 | Ga0075364_10343313 | 3300006051 | Bacteria | 1017 |
| 132 | Ga0075432_10206958 | 3300006058 | Bacteria | 779 |
| 133 | Ga0070716_101562941 | 3300006173 | Bacteria | 541 |
| 134 | Ga0070712_100045103 | 3300006175 | Bacteria | 3042 |
| 135 | Ga0070712_100454882 | 3300006175 | Bacteria | 1067 |
| 136 | Ga0075362_10077944 | 3300006177 | Bacteria | 1523 |
| 137 | Ga0075369_10109332 | 3300006186 | Bacteria | 1245 |
| 138 | Ga0075366_10016671 | 3300006195 | Bacteria | 4223 |
| 139 | Ga0075366_10457563 | 3300006195 | Bacteria | 787 |
| 140 | Ga0097621_100004686 | 3300006237 | Bacteria | 9551 |
| 141 | Ga0097621_100034588 | 3300006237 | Bacteria | 4032 |
| 142 | Ga0097621_100230113 | 3300006237 | Bacteria | 1618 |
| 143 | Ga0097621_100287900 | 3300006237 | Bacteria | 1448 |
| 144 | Ga0097621_100336478 | 3300006237 | Bacteria | 1340 |
| 145 | Ga0075370_10158882 | 3300006353 | Bacteria | 1326 |
| 146 | Ga0075370_10253411 | 3300006353 | Bacteria | 1043 |
| 147 | Ga0068871_100013670 | 3300006358 | Bacteria | 6031 |
| 148 | Ga0068871_100074445 | 3300006358 | Bacteria | 2801 |
| 149 | Ga0068871_100996774 | 3300006358 | Bacteria | 780 |
| 150 | Ga0075428_100753775 | 3300006844 | Bacteria | 1036 |
| 151 | Ga0075428_100760842 | 3300006844 | Bacteria | 1030 |
| 152 | Ga0075430_100091457 | 3300006846 | Bacteria | 2544 |
| 153 | Ga0075431_100082951 | 3300006847 | Bacteria | 3309 |
| 154 | Ga0075431_100748334 | 3300006847 | Bacteria | 953 |
| 155 | Ga0075433_10094261 | 3300006852 | Bacteria | 2649 |
| 156 | Ga0075434_100051055 | 3300006871 | Bacteria | 4108 |
| 157 | Ga0075434_100204221 | 3300006871 | Bacteria | 1996 |
| 158 | Ga0068865_100321596 | 3300006881 | Bacteria | 1245 |
| 159 | Ga0068865_101101125 | 3300006881 | Bacteria | 699 |
| 160 | Ga0068865_101172128 | 3300006881 | Bacteria | 679 |
| 161 | Ga0097620_100905567 | 3300006931 | Bacteria | 966 |
| 162 | Ga0097620_100978924 | 3300006931 | Bacteria | 928 |
| 163 | Ga0097620_101608286 | 3300006931 | Bacteria | 718 |
| 164 | Ga0075435_100439953 | 3300007076 | Bacteria | 1124 |
| 165 | Ga0075435_100486238 | 3300007076 | Bacteria | 1066 |
| 166 | Ga0075435_101121401 | 3300007076 | Bacteria | 688 |
| 167 | Ga0075435_101631938 | 3300007076 | Bacteria | 566 |
| 168 | Ga0099795_10024280 | 3300007788 | Bacteria | 2020 |
| 169 | Ga0111539_10029898 | 3300009094 | Bacteria | 6627 |
| 170 | Ga0111539_10110001 | 3300009094 | Bacteria | 3233 |
| 171 | Ga0111539_10425782 | 3300009094 | Bacteria | 1546 |
| 172 | Ga0111539_10615131 | 3300009094 | Bacteria | 1265 |
| 173 | Ga0111539_10737742 | 3300009094 | Bacteria | 1146 |
| 174 | Ga0105245_10156120 | 3300009098 | Bacteria | 2161 |
| 175 | Ga0105245_12674415 | 3300009098 | Bacteria | 552 |
| 176 | Ga0105247_10167208 | 3300009101 | Bacteria | 1460 |
| 177 | Ga0105247_10203139 | 3300009101 | Bacteria | 1333 |
| 178 | Ga0114129_10049013 | 3300009147 | Bacteria | 5937 |
| 179 | Ga0114129_10188585 | 3300009147 | Bacteria | 2801 |
| 180 | Ga0114129_10530805 | 3300009147 | Bacteria | 1533 |
| 181 | Ga0114129_11575763 | 3300009147 | Bacteria | 805 |
| 182 | Ga0105243_10456059 | 3300009148 | Bacteria | 1201 |
| 183 | Ga0105243_10601797 | 3300009148 | Bacteria | 1058 |
| 184 | Ga0105243_11195999 | 3300009148 | Bacteria | 773 |
| 185 | Ga0105241_10086385 | 3300009174 | Bacteria | 2467 |
| 186 | Ga0105241_10089297 | 3300009174 | Bacteria | 2428 |
| 187 | Ga0105242_11150771 | 3300009176 | Bacteria | 792 |
| 188 | Ga0105248_10055417 | 3300009177 | Bacteria | 4446 |
| 189 | Ga0105248_10243440 | 3300009177 | Bacteria | 2025 |
| 190 | Ga0105237_10033765 | 3300009545 | Bacteria | 5183 |
| 191 | Ga0105237_10196848 | 3300009545 | Bacteria | 2015 |
| 192 | Ga0105237_11691072 | 3300009545 | Bacteria | 640 |
| 193 | Ga0105238_10428155 | 3300009551 | Bacteria | 1319 |
| 194 | Ga0105238_11087630 | 3300009551 | Bacteria | 822 |
| 195 | Ga0105249_10043312 | 3300009553 | Bacteria | 4094 |
| 196 | Ga0105249_10063052 | 3300009553 | Bacteria | 3404 |
| 197 | Ga0105249_10246742 | 3300009553 | Bacteria | 1768 |
| 198 | Ga0105249_10344694 | 3300009553 | Bacteria | 1508 |
| 199 | Ga0099796_10083378 | 3300010159 | Bacteria | 1176 |
| 200 | Ga0105239_10357835 | 3300010375 | Bacteria | 1648 |
| 201 | Ga0105246_10105421 | 3300011119 | Bacteria | 2060 |
| 202 | Ga0105246_10878079 | 3300011119 | Bacteria | 802 |
| 203 | Ga0157322_1045631 | 3300012490 | Bacteria | 518 |
| 204 | Ga0157326_1000011 | 3300012513 | Bacteria | 16319 |
| 205 | Ga0157371_10299086 | 3300013102 | Bacteria | 1165 |
| 206 | Ga0157374_10032393 | 3300013296 | Bacteria | 4759 |
| 207 | Ga0157378_10027853 | 3300013297 | Bacteria | 4983 |
| 208 | Ga0157378_10109439 | 3300013297 | Bacteria | 2531 |
| 209 | Ga0157378_10692996 | 3300013297 | Bacteria | 1037 |
| 210 | Ga0157378_10947184 | 3300013297 | Bacteria | 893 |
| 211 | Ga0157378_11716754 | 3300013297 | Bacteria | 675 |
| 212 | Ga0163162_10412216 | 3300013306 | Bacteria | 1483 |
| 213 | Ga0157375_10620436 | 3300013308 | Bacteria | 1239 |
| 214 | Ga0163163_10103638 | 3300014325 | Bacteria | 2870 |
| 215 | Ga0163163_10229684 | 3300014325 | Bacteria | 1905 |
| 216 | Ga0157380_10854994 | 3300014326 | Bacteria | 932 |
| 217 | Ga0157377_10145134 | 3300014745 | Bacteria | 1462 |
| 218 | Ga0157377_10189293 | 3300014745 | Bacteria | 1299 |
| 219 | Ga0157379_10199129 | 3300014968 | Bacteria | 1811 |
| 220 | Ga0157379_10346010 | 3300014968 | Bacteria | 1360 |
| 221 | Ga0157379_10857811 | 3300014968 | Bacteria | 860 |
| 222 | Ga0157379_11097995 | 3300014968 | Bacteria | 762 |
| 223 | Ga0157376_10191352 | 3300014969 | Bacteria | 1876 |
| 224 | Ga0157376_10266040 | 3300014969 | Bacteria | 1608 |
| 225 | Ga0157376_10816670 | 3300014969 | Bacteria | 946 |
| 226 | Ga0163161_10013562 | 3300017792 | Bacteria | 5674 |
| 227 | Ga0213876_10116268 | 3300021384 | Bacteria | 1419 |
| 228 | Ga0207653_10018191 | 3300025885 | Bacteria | 2213 |
| 229 | Ga0207682_10020194 | 3300025893 | Bacteria | 2614 |
| 230 | Ga0207642_10005153 | 3300025899 | Bacteria | 4253 |
| 231 | Ga0207642_10027764 | 3300025899 | Bacteria | 2321 |
| 232 | Ga0207642_10828535 | 3300025899 | Bacteria | 590 |
| 233 | Ga0207710_10093440 | 3300025900 | Bacteria | 1411 |
| 234 | Ga0207710_10398813 | 3300025900 | Bacteria | 706 |
| 235 | Ga0207680_10126377 | 3300025903 | Bacteria | 1679 |
| 236 | Ga0207685_10004676 | 3300025905 | Bacteria | 3516 |
| 237 | Ga0207699_10797621 | 3300025906 | Bacteria | 694 |
| 238 | Ga0207645_10043281 | 3300025907 | Bacteria | 2882 |
| 239 | Ga0207645_10052237 | 3300025907 | Bacteria | 2612 |
| 240 | Ga0207645_11053462 | 3300025907 | Bacteria | 550 |
| 241 | Ga0207643_10005479 | 3300025908 | Bacteria | 6786 |
| 242 | Ga0207684_10092822 | 3300025910 | Bacteria | 2573 |
| 243 | Ga0207654_10112255 | 3300025911 | Bacteria | 1698 |
| 244 | Ga0207654_10322068 | 3300025911 | Bacteria | 1057 |
| 245 | Ga0207707_10157578 | 3300025912 | Bacteria | 1985 |
| 246 | Ga0207707_10171922 | 3300025912 | Bacteria | 1893 |
| 247 | Ga0207671_10127053 | 3300025914 | Bacteria | 1954 |
| 248 | Ga0207693_10032967 | 3300025915 | Bacteria | 4088 |
| 249 | Ga0207693_10906886 | 3300025915 | Bacteria | 676 |
| 250 | Ga0207663_10334983 | 3300025916 | Bacteria | 1141 |
| 251 | Ga0207660_10036634 | 3300025917 | Bacteria | 3411 |
| 252 | Ga0207660_10105982 | 3300025917 | Bacteria | 2107 |
| 253 | Ga0207660_10157734 | 3300025917 | Bacteria | 1748 |
| 254 | Ga0207660_10256230 | 3300025917 | Bacteria | 1382 |
| 255 | Ga0207662_10104710 | 3300025918 | Bacteria | 1757 |
| 256 | Ga0207662_10120656 | 3300025918 | Bacteria | 1644 |
| 257 | Ga0207657_10061677 | 3300025919 | Bacteria | 3213 |
| 258 | Ga0207649_10080347 | 3300025920 | Bacteria | 2108 |
| 259 | Ga0207652_10627665 | 3300025921 | Bacteria | 962 |
| 260 | Ga0207646_10040306 | 3300025922 | Bacteria | 4200 |
| 261 | Ga0207681_10028116 | 3300025923 | Bacteria | 3641 |
| 262 | Ga0207681_10122467 | 3300025923 | Bacteria | 1909 |
| 263 | Ga0207681_11101096 | 3300025923 | Bacteria | 667 |
| 264 | Ga0207694_10296906 | 3300025924 | Bacteria | 1330 |
| 265 | Ga0207694_10412054 | 3300025924 | Bacteria | 1125 |
| 266 | Ga0207694_11558802 | 3300025924 | Bacteria | 557 |
| 267 | Ga0207650_10170269 | 3300025925 | Bacteria | 1730 |
| 268 | Ga0207659_10048920 | 3300025926 | Bacteria | 2997 |
| 269 | Ga0207687_10046586 | 3300025927 | Bacteria | 3002 |
| 270 | Ga0207700_10116224 | 3300025928 | Bacteria | 2161 |
| 271 | Ga0207664_10105470 | 3300025929 | Bacteria | 2335 |
| 272 | Ga0207644_10244927 | 3300025931 | Bacteria | 1428 |
| 273 | Ga0207644_11529297 | 3300025931 | Bacteria | 560 |
| 274 | Ga0207690_10071928 | 3300025932 | Bacteria | 2387 |
| 275 | Ga0207706_10028029 | 3300025933 | Bacteria | 5032 |
| 276 | Ga0207709_10098762 | 3300025935 | Bacteria | 1926 |
| 277 | Ga0207709_10415542 | 3300025935 | Bacteria | 1032 |
| 278 | Ga0207670_10096618 | 3300025936 | Bacteria | 2101 |
| 279 | Ga0207670_10259347 | 3300025936 | Bacteria | 1347 |
| 280 | Ga0207670_10595100 | 3300025936 | Bacteria | 908 |
| 281 | Ga0207669_10078957 | 3300025937 | Bacteria | 2099 |
| 282 | Ga0207669_10146882 | 3300025937 | Bacteria | 1645 |
| 283 | Ga0207669_10447434 | 3300025937 | Bacteria | 1023 |
| 284 | Ga0207704_10033814 | 3300025938 | Bacteria | 2911 |
| 285 | Ga0207704_10261039 | 3300025938 | Bacteria | 1306 |
| 286 | Ga0207704_10477024 | 3300025938 | Bacteria | 1001 |
| 287 | Ga0207704_10650780 | 3300025938 | Bacteria | 868 |
| 288 | Ga0207665_10410718 | 3300025939 | Bacteria | 1032 |
| 289 | Ga0207691_10061457 | 3300025940 | Bacteria | 3412 |
| 290 | Ga0207691_10702797 | 3300025940 | Bacteria | 853 |
| 291 | Ga0207691_10781744 | 3300025940 | Bacteria | 803 |
| 292 | Ga0207711_10044988 | 3300025941 | Bacteria | 3771 |
| 293 | Ga0207711_11796824 | 3300025941 | Bacteria | 556 |
| 294 | Ga0207689_10268154 | 3300025942 | Bacteria | 1413 |
| 295 | Ga0207689_10835276 | 3300025942 | Bacteria | 777 |
| 296 | Ga0207661_10038807 | 3300025944 | Bacteria | 3735 |
| 297 | Ga0207679_10595961 | 3300025945 | Bacteria | 995 |
| 298 | Ga0207667_10118586 | 3300025949 | Bacteria | 2727 |
| 299 | Ga0207651_10524397 | 3300025960 | Bacteria | 1027 |
| 300 | Ga0207651_10659154 | 3300025960 | Bacteria | 919 |
| 301 | Ga0207651_10992272 | 3300025960 | Bacteria | 750 |
| 302 | Ga0207712_10032388 | 3300025961 | Bacteria | 3528 |
| 303 | Ga0207712_10148088 | 3300025961 | Bacteria | 1810 |
| 304 | Ga0207712_10441397 | 3300025961 | Bacteria | 1102 |
| 305 | Ga0207668_10045719 | 3300025972 | Bacteria | 2987 |
| 306 | Ga0207677_10947889 | 3300026023 | Bacteria | 778 |
| 307 | Ga0207703_10083819 | 3300026035 | Bacteria | 2664 |
| 308 | Ga0207639_10219061 | 3300026041 | Bacteria | 1643 |
| 309 | Ga0207678_10019487 | 3300026067 | Bacteria | 5960 |
| 310 | Ga0207708_10045668 | 3300026075 | Bacteria | 3338 |
| 311 | Ga0207708_10432756 | 3300026075 | Bacteria | 1093 |
| 312 | Ga0207708_10432984 | 3300026075 | Bacteria | 1092 |
| 313 | Ga0207708_10532312 | 3300026075 | Bacteria | 989 |
| 314 | Ga0207708_10612094 | 3300026075 | Bacteria | 924 |
| 315 | Ga0207641_10051878 | 3300026088 | Bacteria | 3473 |
| 316 | Ga0207641_10205364 | 3300026088 | Bacteria | 1819 |
| 317 | Ga0207641_11862653 | 3300026088 | Bacteria | 603 |
| 318 | Ga0207648_10001980 | 3300026089 | Bacteria | 22369 |
| 319 | Ga0207648_10058327 | 3300026089 | Bacteria | 3367 |
| 320 | Ga0207676_10175290 | 3300026095 | Bacteria | 1872 |
| 321 | Ga0207676_12015047 | 3300026095 | Bacteria | 576 |
| 322 | Ga0207674_10449795 | 3300026116 | Bacteria | 1245 |
| 323 | Ga0207674_10835889 | 3300026116 | Bacteria | 888 |
| 324 | Ga0207675_100044837 | 3300026118 | Bacteria | 4132 |
| 325 | Ga0207675_100101000 | 3300026118 | Bacteria | 2717 |
| 326 | Ga0207675_100301871 | 3300026118 | Bacteria | 1560 |
| 327 | Ga0207683_10008812 | 3300026121 | Bacteria | 8610 |
| 328 | Ga0207683_10288639 | 3300026121 | Bacteria | 1500 |
| 329 | Ga0209281_1000355 | 3300027111 | Bacteria | 75566 |
| 330 | Ga0209969_1003462 | 3300027360 | Bacteria | 2188 |
| 331 | Ga0209967_1000380 | 3300027364 | Bacteria | 5865 |
| 332 | Ga0209981_1000383 | 3300027378 | Bacteria | 5650 |
| 333 | Ga0209996_1002235 | 3300027395 | Bacteria | 2389 |
| 334 | Ga0210000_1000816 | 3300027462 | Bacteria | 4317 |
| 335 | Ga0210000_1015477 | 3300027462 | Bacteria | 1148 |
| 336 | Ga0209995_1001625 | 3300027471 | Bacteria | 3491 |
| 337 | Ga0209968_1001752 | 3300027526 | Bacteria | 3288 |
| 338 | Ga0209999_1000730 | 3300027543 | Bacteria | 5340 |
| 339 | Ga0209971_1103681 | 3300027682 | Bacteria | 697 |
| 340 | Ga0209966_1029280 | 3300027695 | Bacteria | 1109 |
| 341 | Ga0268266_10166657 | 3300028379 | Bacteria | 1996 |
| 342 | Ga0268266_11297671 | 3300028379 | Bacteria | 703 |
| 343 | Ga0268265_10199458 | 3300028380 | Bacteria | 1735 |
| 344 | Ga0268265_10359437 | 3300028380 | Bacteria | 1332 |
| 345 | Ga0268265_10436948 | 3300028380 | Bacteria | 1219 |
| 346 | Ga0268264_10249852 | 3300028381 | Bacteria | 1647 |
| 347 | Ga0268264_10333309 | 3300028381 | Bacteria | 1439 |
| 348 | Ga0268264_11853455 | 3300028381 | Bacteria | 613 |
| 349 | Ga0265338_10017679 | 3300028800 | Bacteria | 7670 |
| 350 | Ga0265762_1019361 | 3300030760 | Bacteria | 1246 |
| 351 | Ga0265760_10367073 | 3300031090 | Bacteria | 517 |
| 352 | Ga0265340_10001287 | 3300031247 | Bacteria | 14395 |
| 353 | Ga0265339_10018854 | 3300031249 | Bacteria | 4060 |
| 354 | Ga0265331_10073469 | 3300031250 | Bacteria | 1597 |
| 355 | Ga0265316_10441418 | 3300031344 | Bacteria | 934 |
| 356 | Ga0265316_10524620 | 3300031344 | Bacteria | 844 |
| 357 | Ga0307408_101542368 | 3300031548 | Bacteria | 629 |
| 358 | Ga0265314_10004756 | 3300031711 | Bacteria | 12441 |
| 359 | Ga0265314_10042452 | 3300031711 | Bacteria | 3244 |
| 360 | Ga0265342_10000109 | 3300031712 | Bacteria | 91321 |
| 361 | Ga0307405_10089397 | 3300031731 | Bacteria | 2035 |
| 362 | Ga0307405_11083172 | 3300031731 | Bacteria | 688 |
| 363 | Ga0307410_11251882 | 3300031852 | Bacteria | 648 |
| 364 | Ga0307406_10794605 | 3300031901 | Bacteria | 798 |
| 365 | Ga0307407_10568972 | 3300031903 | Bacteria | 840 |
| 366 | Ga0307407_10652696 | 3300031903 | Bacteria | 788 |
| 367 | Ga0307407_10770593 | 3300031903 | Bacteria | 730 |
| 368 | Ga0307412_10329375 | 3300031911 | Bacteria | 1218 |
| 369 | Ga0307412_10507456 | 3300031911 | Bacteria | 1005 |
| 370 | Ga0307416_100035032 | 3300032002 | Bacteria | 3828 |
| 371 | Ga0307411_11682142 | 3300032005 | Bacteria | 587 |
| 372 | Ga0307415_101267430 | 3300032126 | Bacteria | 697 |
| 373 | Ga0307415_101385364 | 3300032126 | Bacteria | 669 |
| 374 | Ga0373948_0005827 | 3300034817 | Bacteria | 2013 |
| 375 | Ga0373948_0024118 | 3300034817 | Bacteria | 1185 |
| 376 | Ga0373950_0113986 | 3300034818 | Bacteria | 593 |
| 377 | Ga0373958_0009143 | 3300034819 | Bacteria | 1624 |
| 378 | Ga0373958_0022336 | 3300034819 | Bacteria | 1181 |
| 379 | Ga0373959_0133529 | 3300034820 | Bacteria | 616 |
| 380 | Ga0373938_0016063 | 3300034957 | Bacteria | 1458 |
| 381 | Ga0373938_0020622 | 3300034957 | Bacteria | 1329 |
| 382 | Ga0373928_0053499 | 3300035084 | Bacteria | 959 |
| 383 | Ga0373928_0154603 | 3300035084 | Bacteria | 637 |
| 384 | Ga0373929_0043265 | 3300035085 | Bacteria | 1007 |
| 385 | Ga0373929_0058729 | 3300035085 | Bacteria | 896 |
| 386 | Ga0373934_0006061 | 3300035086 | Bacteria | 4475 |
| 387 | Ga0373934_0010104 | 3300035086 | Bacteria | 3544 |
| 388 | Ga0373940_0066491 | 3300035088 | Bacteria | 1042 |
| 389 | Ga0373940_0214361 | 3300035088 | Bacteria | 637 |
| 390 | Ga0373944_0071143 | 3300035089 | Bacteria | 1133 |
| 391 | Ga0373951_0015760 | 3300035091 | Bacteria | 1704 |
| 392 | Ga0373952_0027214 | 3300035092 | Bacteria | 1247 |
| 393 | Ga0373932_0042735 | 3300035112 | Bacteria | 1315 |
| 394 | Ga0373932_0359426 | 3300035112 | Bacteria | 555 |
| 395 | Ga0373936_0023451 | 3300035113 | Bacteria | 2405 |
| 396 | Ga0373941_0007309 | 3300035115 | Bacteria | 2699 |
| 397 | Ga0373941_0034247 | 3300035115 | Bacteria | 1531 |
| 398 | Ga0373941_0107943 | 3300035115 | Bacteria | 977 |
| 399 | Ga0373941_0216671 | 3300035115 | Bacteria | 734 |
| 400 | Ga0373945_0012898 | 3300035116 | Bacteria | 2783 |
| 401 | Ga0373953_0009761 | 3300035117 | Bacteria | 3317 |
| 402 | Ga0373953_0369930 | 3300035117 | Bacteria | 629 |
| 403 | Ga0373954_0088618 | 3300035118 | Bacteria | 1484 |
| 404 | Ga0373956_0004855 | 3300035119 | Bacteria | 5384 |
| 405 | Ga0373957_0000553 | 3300035120 | Bacteria | 9493 |
| 406 | Ga0373957_0008590 | 3300035120 | Bacteria | 3316 |
| 407 | Ga0373960_0077047 | 3300035121 | Bacteria | 1042 |
| 408 | Ga0373943_0012783 | 3300035170 | Bacteria | 3784 |
| 409 | Ga0373943_0027681 | 3300035170 | Bacteria | 2665 |
| 410 | Ga0373946_0048763 | 3300035171 | Bacteria | 1764 |
| 411 | Ga0373955_0029726 | 3300035172 | Bacteria | 2845 |
| 412 | Ga0373955_0053891 | 3300035172 | Bacteria | 2197 |
| 413 | Ga0373955_0063123 | 3300035172 | Bacteria | 2050 |
| 414 | Ga0373942_0073592 | 3300035207 | Bacteria | 1002 |
| 415 | Ga0373962_0003240 | 3300035242 | Bacteria | 3911 |
| 416 | Ga0373962_0044643 | 3300035242 | Bacteria | 1259 |
| 417 | Ga0373962_0084713 | 3300035242 | Bacteria | 968 |
| 418 | Ga0373924_0047785 | 3300035410 | Bacteria | 1766 |
| 419 | Ga0373924_0062531 | 3300035410 | Bacteria | 1559 |
| 420 | Ga0373931_0000460 | 3300035691 | Bacteria | 16703 |
| 421 | Ga0373931_0012343 | 3300035691 | Bacteria | 4138 |
| 422 | Ga0373931_0034279 | 3300035691 | Bacteria | 2634 |
| 423 | Ga0373931_0054787 | 3300035691 | Bacteria | 2132 |
| 424 | Ga0373931_0114727 | 3300035691 | Bacteria | 1533 |
| 425 | Ga0373931_0208677 | 3300035691 | Bacteria | 1170 |
| 426 | Ga0373935_0018456 | 3300035692 | Bacteria | 4242 |
| 427 | Ga0373935_0125527 | 3300035692 | Bacteria | 1719 |
| 428 | Ga0373927_0029458 | 3300035695 | Bacteria | 3578 |
| 429 | Ga0373927_0227446 | 3300035695 | Bacteria | 1225 |
| 430 | Ga0373933_0009065 | 3300035724 | Bacteria | 5430 |
| 431 | Ga0373933_0027005 | 3300035724 | Bacteria | 3302 |
| 432 | Ga0373947_0016022 | 3300035725 | Bacteria | 4307 |
| 433 | Ga0373947_0103560 | 3300035725 | Bacteria | 1791 |
| 434 | Ga0373937_0003814 | 3300036401 | Bacteria | 12735 |
| 435 | Ga0373937_0009081 | 3300036401 | Bacteria | 8629 |
| 436 | Ga0373937_0629237 | 3300036401 | Bacteria | 1018 |
| 437 | Ga0373925_0147391 | 3300037068 | Bacteria | 1845 |
| 438 | Ga0373925_0496729 | 3300037068 | Bacteria | 1001 |
| 439 | Ga0373925_0529298 | 3300037068 | Bacteria | 969 |
| 440 | Ga0373925_0568910 | 3300037068 | Bacteria | 932 |
| 441 | Ga0395900_1296940 | 3300037418 | Bacteria | 642 |
| 442 | Ga0395905_0878070 | 3300037471 | Bacteria | 800 |
| 443 | Ga0242420_047095 | 3300038996 | Bacteria | 835 |
| 444 | Ga0436365_1074131 | 3300039437 | Bacteria | 1903 |
| 445 | Ga0439451_086549 | 3300042009 | Bacteria | 631 |
| 446 | Ga0439456_087818 | 3300042013 | Bacteria | 697 |
| 447 | Ga0450923_036570 | 3300042125 | Bacteria | 1019 |
| 448 | Ga0451577_0915903 | 3300042876 | Bacteria | 789 |
| 449 | Ga0453684_0237254 | 3300044712 | Bacteria | 2102 |
| 450 | Ga0453684_0599124 | 3300044712 | Bacteria | 1208 |
| 451 | Ga0453684_1461151 | 3300044712 | Bacteria | 707 |
| 452 | Ga0495592_0002605 | 3300046454 | Bacteria | 12748 |
| 453 | Ga0495592_0137747 | 3300046454 | Bacteria | 1700 |
| 454 | Ga0495603_0024250 | 3300046455 | Bacteria | 3668 |
| 455 | Ga0495603_0065539 | 3300046455 | Bacteria | 2141 |
| 456 | Ga0495603_0120832 | 3300046455 | Bacteria | 1526 |
| 457 | Ga0495629_0038051 | 3300046459 | Bacteria | 3390 |
| 458 | Ga0495629_0049097 | 3300046459 | Bacteria | 2958 |
| 459 | Ga0495629_0269233 | 3300046459 | Bacteria | 1170 |
| 460 | Ga0495641_0014791 | 3300046461 | Bacteria | 4206 |
| 461 | Ga0495651_0001716 | 3300046462 | Bacteria | 16939 |
| 462 | Ga0495651_0002360 | 3300046462 | Bacteria | 14581 |
| 463 | Ga0495653_0002378 | 3300046463 | Bacteria | 14963 |
| 464 | Ga0495653_0018310 | 3300046463 | Bacteria | 5691 |
| 465 | Ga0495580_0077236 | 3300046472 | Bacteria | 2322 |
| 466 | Ga0495582_0349506 | 3300046473 | Bacteria | 851 |
| 467 | Ga0495639_0009155 | 3300046475 | Bacteria | 4244 |
| 468 | Ga0495662_0016267 | 3300046476 | Bacteria | 3605 |
| 469 | Ga0495662_0047410 | 3300046476 | Bacteria | 2074 |
| 470 | Ga0495664_0022046 | 3300046477 | Bacteria | 3685 |
| 471 | Ga0495664_0276060 | 3300046477 | Bacteria | 1015 |
| 472 | Ga0495584_0330817 | 3300046491 | Bacteria | 774 |
| 473 | Ga0495594_0008651 | 3300046499 | Bacteria | 5245 |
| 474 | Ga0495594_0232640 | 3300046499 | Bacteria | 1050 |
| 475 | Ga0495607_0009217 | 3300046501 | Bacteria | 6706 |
| 476 | Ga0495608_0092397 | 3300046511 | Bacteria | 1956 |
| 477 | Ga0495608_0118096 | 3300046511 | Bacteria | 1701 |
| 478 | Ga0495618_0002901 | 3300046514 | Bacteria | 10852 |
| 479 | Ga0495618_0004476 | 3300046514 | Bacteria | 8591 |
| 480 | Ga0495628_0008038 | 3300046516 | Bacteria | 9082 |
| 481 | Ga0495628_0137068 | 3300046516 | Bacteria | 1869 |
| 482 | Ga0495648_0197556 | 3300046524 | Bacteria | 1010 |
| 483 | Ga0495652_0003013 | 3300046529 | Bacteria | 16901 |
| 484 | Ga0495652_0076968 | 3300046529 | Bacteria | 2766 |
| 485 | Ga0495665_0079677 | 3300046531 | Bacteria | 1723 |
| 486 | Ga0495640_0032361 | 3300046533 | Bacteria | 3725 |
| 487 | Ga0495640_0085749 | 3300046533 | Bacteria | 2086 |
| 488 | Ga0495586_0021826 | 3300046535 | Bacteria | 3416 |
| 489 | Ga0495587_0001264 | 3300046536 | Bacteria | 16814 |
| 490 | Ga0495587_0004244 | 3300046536 | Bacteria | 9475 |
| 491 | Ga0495598_0158798 | 3300046537 | Bacteria | 794 |
| 492 | Ga0495609_0009437 | 3300046538 | Bacteria | 4721 |
| 493 | Ga0495621_0051166 | 3300046539 | Bacteria | 1478 |
| 494 | Ga0495645_0008282 | 3300046543 | Bacteria | 7253 |
| 495 | Ga0495645_0011818 | 3300046543 | Bacteria | 6152 |
| 496 | Ga0495622_0299079 | 3300046557 | Bacteria | 701 |
| 497 | Ga0495633_0002046 | 3300046558 | Bacteria | 14548 |
| 498 | Ga0495667_0000399 | 3300046559 | Bacteria | 27814 |
| 499 | Ga0495667_0003782 | 3300046559 | Bacteria | 10163 |
| 500 | Ga0495667_0049529 | 3300046559 | Bacteria | 2773 |
| 501 | Ga0495656_0134506 | 3300046615 | Bacteria | 1180 |
| 502 | Ga0495634_0024003 | 3300046642 | Bacteria | 4282 |
| 503 | Ga0495634_0029340 | 3300046642 | Bacteria | 3808 |
| 504 | Ga0495634_0038969 | 3300046642 | Bacteria | 3238 |
| 505 | Ga0495611_0005086 | 3300046648 | Bacteria | 5637 |
| 506 | Ga0495625_0371188 | 3300046660 | Bacteria | 900 |
| 507 | Ga0495635_0008931 | 3300046663 | Bacteria | 6994 |
| 508 | Ga0495661_0052373 | 3300046665 | Bacteria | 2460 |
| 509 | Ga0495588_0002506 | 3300046674 | Bacteria | 7866 |
| 510 | Ga0495588_0233645 | 3300046674 | Bacteria | 970 |
| 511 | Ga0495657_0001799 | 3300046675 | Bacteria | 18356 |
| 512 | Ga0495657_0035957 | 3300046675 | Bacteria | 3428 |
| 513 | Ga0495599_0005718 | 3300046678 | Bacteria | 7458 |
| 514 | Ga0495599_0010464 | 3300046678 | Bacteria | 5675 |
| 515 | Ga0495623_0014717 | 3300046679 | Bacteria | 5058 |
| 516 | Ga0495623_0028719 | 3300046679 | Bacteria | 3578 |
| 517 | Ga0495646_0005564 | 3300046680 | Bacteria | 7971 |
| 518 | Ga0495646_0014811 | 3300046680 | Bacteria | 4956 |
| 519 | Ga0495646_0022469 | 3300046680 | Bacteria | 3979 |
| 520 | Ga0495669_0080402 | 3300046684 | Bacteria | 1495 |
| 521 | Ga0495613_0072048 | 3300046689 | Bacteria | 2518 |
| 522 | Ga0495624_0138856 | 3300046690 | Bacteria | 1489 |
| 523 | Ga0495600_0001408 | 3300046809 | Bacteria | 13272 |
| 524 | Ga0495600_0004886 | 3300046809 | Bacteria | 8051 |
| 525 | Ga0495600_0327237 | 3300046809 | Bacteria | 963 |
| 526 | Ga0495581_0055099 | 3300047315 | Bacteria | 2295 |
| 527 | Ga0495581_0096108 | 3300047315 | Bacteria | 1720 |
| 528 | Ga0495581_0230185 | 3300047315 | Bacteria | 1084 |
| 529 | Ga0495604_0002929 | 3300047317 | Bacteria | 13669 |
| 530 | Ga0495604_0106800 | 3300047317 | Bacteria | 2047 |
| 531 | Ga0495636_0263674 | 3300047318 | Bacteria | 799 |
| 532 | Ga0495636_0366164 | 3300047318 | Bacteria | 682 |
| 533 | Ga0495674_0004957 | 3300047319 | Bacteria | 12807 |
| 534 | Ga0495674_0052759 | 3300047319 | Bacteria | 3576 |
| 535 | Ga0495674_0071452 | 3300047319 | Bacteria | 2995 |
| 536 | Ga0495680_0001112 | 3300047322 | Bacteria | 29712 |
| 537 | Ga0495680_0007442 | 3300047322 | Bacteria | 10037 |
| 538 | Ga0495675_0001163 | 3300047444 | Bacteria | 15971 |
| 539 | Ga0495675_0001604 | 3300047444 | Bacteria | 13592 |
| 540 | Ga0495679_020259 | 3300047446 | Bacteria | 2319 |
| 541 | Ga0495684_0012837 | 3300047471 | Bacteria | 6466 |
| 542 | Ga0495684_0051773 | 3300047471 | Bacteria | 3133 |
| 543 | Ga0495593_0030114 | 3300047673 | Bacteria | 2972 |
| 544 | Ga0495602_0001583 | 3300048088 | Bacteria | 22640 |
| 545 | Ga0495602_0023384 | 3300048088 | Bacteria | 6022 |
| 546 | Ga0495614_0142563 | 3300048089 | Bacteria | 1065 |
| 547 | Ga0496100_0502118 | 3300048903 | Bacteria | 934 |
| 548 | Ga0496101_0024345 | 3300048904 | Bacteria | 4189 |
| 549 | Ga0496101_0248886 | 3300048904 | Bacteria | 1384 |
| 550 | Ga0496102_0019387 | 3300048905 | Bacteria | 5991 |
| 551 | Ga0496102_0470386 | 3300048905 | Bacteria | 1178 |
| 552 | Ga0496103_0077901 | 3300048906 | Bacteria | 2082 |
| 553 | Ga0496104_0030009 | 3300048907 | Bacteria | 5049 |
| 554 | Ga0496104_0453429 | 3300048907 | Bacteria | 1194 |
| 555 | Ga0496105_0028251 | 3300048908 | Bacteria | 4588 |
| 556 | Ga0496105_0723954 | 3300048908 | Bacteria | 762 |
| 557 | Ga0496106_0081601 | 3300048909 | Bacteria | 2484 |
| 558 | Ga0496106_0197408 | 3300048909 | Bacteria | 1601 |
| 559 | Ga0496107_0101059 | 3300048910 | Bacteria | 2114 |
| 560 | Ga0496107_0363311 | 3300048910 | Bacteria | 1077 |
| 561 | Ga0496107_0681911 | 3300048910 | Bacteria | 756 |
| 562 | Ga0496109_0174191 | 3300048912 | Bacteria | 2019 |
| 563 | Ga0496109_0272893 | 3300048912 | Bacteria | 1594 |
| 564 | Ga0496110_0146876 | 3300048913 | Bacteria | 2133 |
| 565 | Ga0496110_0336062 | 3300048913 | Bacteria | 1376 |
| 566 | Ga0496110_0628378 | 3300048913 | Bacteria | 973 |
| 567 | Ga0496111_0214600 | 3300048914 | Bacteria | 1429 |
| 568 | Ga0496111_0471961 | 3300048914 | Bacteria | 925 |
| 569 | Ga0496112_0085280 | 3300048915 | Bacteria | 3125 |
| 570 | Ga0496112_0271320 | 3300048915 | Bacteria | 1645 |
| 571 | Ga0496112_0341494 | 3300048915 | Bacteria | 1441 |
| 572 | Ga0496113_0035614 | 3300048916 | Bacteria | 3641 |
| 573 | Ga0496114_0013459 | 3300048917 | Bacteria | 6559 |
| 574 | Ga0496114_0062312 | 3300048917 | Bacteria | 3121 |
| 575 | Ga0496114_1733281 | 3300048917 | Bacteria | 513 |
| 576 | Ga0496115_0042463 | 3300048918 | Bacteria | 3622 |
| 577 | Ga0496115_0080953 | 3300048918 | Bacteria | 2644 |
| 578 | Ga0496115_0970370 | 3300048918 | Bacteria | 651 |
| 579 | Ga0496120_0094524 | 3300048923 | Bacteria | 1591 |
| 580 | Ga0496121_0210301 | 3300048924 | Bacteria | 1379 |
| 581 | Ga0501298_042792 | 3300049521 | Bacteria | 922 |
| 582 | Ga0501299_098622 | 3300049522 | Bacteria | 675 |
| 583 | Ga0501032_0832354 | 3300049569 | Bacteria | 582 |
| 584 | Ga0501033_0224770 | 3300049570 | Bacteria | 1335 |
| 585 | Ga0501033_0474699 | 3300049570 | Bacteria | 867 |
| 586 | Ga0501034_0095341 | 3300049571 | Bacteria | 2972 |
| 587 | Ga0501036_0144874 | 3300049572 | Bacteria | 2004 |
| 588 | Ga0501037_0341375 | 3300049573 | Bacteria | 1034 |
| 589 | Ga0501038_0156816 | 3300049574 | Bacteria | 1853 |
| 590 | Ga0501038_0971669 | 3300049574 | Bacteria | 624 |
| 591 | Ga0501039_0017403 | 3300049575 | Bacteria | 5513 |
| 592 | Ga0501040_0022746 | 3300049576 | Bacteria | 4199 |
| 593 | Ga0501040_0103324 | 3300049576 | Bacteria | 1989 |
| 594 | Ga0501041_0006065 | 3300049577 | Bacteria | 7069 |
| 595 | Ga0501041_0133905 | 3300049577 | Bacteria | 1544 |
| 596 | Ga0501042_0208178 | 3300049578 | Bacteria | 1410 |
| 597 | Ga0501042_0226997 | 3300049578 | Bacteria | 1347 |
| 598 | Ga0501043_0491311 | 3300049579 | Bacteria | 918 |
| 599 | Ga0501043_0669116 | 3300049579 | Bacteria | 761 |
| 600 | Ga0501046_0027302 | 3300049580 | Bacteria | 4659 |
| 601 | Ga0501046_0346226 | 3300049580 | Bacteria | 1079 |
| 602 | Ga0501047_0068048 | 3300049581 | Bacteria | 3431 |
| 603 | Ga0501048_0096880 | 3300049582 | Bacteria | 2081 |
| 604 | Ga0501048_0188131 | 3300049582 | Bacteria | 1463 |
| 605 | Ga0501048_0211324 | 3300049582 | Bacteria | 1376 |
| 606 | Ga0501071_0742196 | 3300049587 | Bacteria | 756 |
| 607 | Ga0501072_1006602 | 3300049588 | Bacteria | 649 |
| 608 | Ga0501074_0435638 | 3300049590 | Bacteria | 930 |
| 609 | Ga0501074_0437308 | 3300049590 | Bacteria | 928 |
| 610 | Ga0501075_0041908 | 3300049591 | Bacteria | 3432 |
| 611 | Ga0501076_0026896 | 3300049592 | Bacteria | 4460 |
| 612 | Ga0501076_0161930 | 3300049592 | Bacteria | 1823 |
| 613 | Ga0501076_0296267 | 3300049592 | Bacteria | 1326 |
| 614 | Ga0501077_0016657 | 3300049593 | Bacteria | 4633 |
| 615 | Ga0501079_0081315 | 3300049741 | Bacteria | 2505 |
| 616 | Ga0501079_1221784 | 3300049741 | Bacteria | 592 |
| 617 | Ga0501080_0696526 | 3300049742 | Bacteria | 896 |
| 618 | Ga0501081_0008800 | 3300049743 | Bacteria | 6560 |
| 619 | Ga0501081_0103375 | 3300049743 | Bacteria | 2016 |
| 620 | Ga0501083_0778045 | 3300049744 | Bacteria | 623 |
| 621 | Ga0501283_043946 | 3300049779 | Bacteria | 779 |
| 622 | Ga0501035_0767972 | 3300049822 | Bacteria | 772 |
| 623 | Ga0501044_0108990 | 3300049823 | Bacteria | 2779 |
| 624 | Ga0501045_0047507 | 3300049824 | Bacteria | 3127 |
| 625 | Ga0501045_0617821 | 3300049824 | Bacteria | 802 |
| 626 | nmdc:mga03683_65702_c1 | 3300050489 | Bacteria | 1541 |
| 627 | nmdc:mga03n38_264242_c1 | 3300050490 | Bacteria | 913 |
| 628 | nmdc:mga03n38_91499_c1 | 3300050490 | Bacteria | 1449 |
| 629 | nmdc:mga0yw44_195218_c1 | 3300050492 | Bacteria | 1336 |
| 630 | nmdc:mga0yw44_667525_c1 | 3300050492 | Bacteria | 706 |
| 631 | nmdc:mga0k408_134429_c1 | 3300050493 | Bacteria | 1469 |
| 632 | nmdc:mga0k408_31294_c1 | 3300050493 | Bacteria | 3038 |
| 633 | nmdc:mga06z11_256202_c1 | 3300050494 | Bacteria | 1031 |
| 634 | nmdc:mga06z11_338928_c1 | 3300050494 | Bacteria | 899 |
| 635 | nmdc:mga06z11_472306_c1 | 3300050494 | Bacteria | 759 |
| 636 | nmdc:mga06z11_58079_c1 | 3300050494 | Bacteria | 2006 |
| 637 | nmdc:mga07m45_230274_c1 | 3300050496 | Bacteria | 1078 |
| 638 | nmdc:mga07m45_67187_c2 | 3300050496 | Bacteria | 1470 |
| 639 | nmdc:mga05p37_16853_c1 | 3300050507 | Bacteria | 8809 |
| 640 | nmdc:mga05p37_868586_c1 | 3300050507 | Bacteria | 977 |
| 641 | nmdc:mga05p37_964886_c1 | 3300050507 | Bacteria | 910 |
| 642 | nmdc:mga09592_416614_c1 | 3300050508 | Bacteria | 1161 |
| 643 | nmdc:mga0qj67_10268_c1 | 3300050509 | Bacteria | 6993 |
| 644 | nmdc:mga0qj67_404038_c1 | 3300050509 | Bacteria | 1102 |
| 645 | nmdc:mga06r32_1212198_c1 | 3300050510 | Bacteria | 701 |
| 646 | nmdc:mga06r32_91427_c1 | 3300050510 | Bacteria | 2974 |
| 647 | nmdc:mga08y16_1671324_c1 | 3300050511 | Bacteria | 593 |
| 648 | nmdc:mga08y16_234293_c1 | 3300050511 | Bacteria | 1898 |
| 649 | nmdc:mga08y16_587966_c1 | 3300050511 | Bacteria | 1123 |
| 650 | nmdc:mga08y16_79407_c1 | 3300050511 | Bacteria | 3420 |
| 651 | nmdc:mga08y16_97268_c1 | 3300050511 | Bacteria | 3066 |
| 652 | nmdc:mga0n895_269598_c1 | 3300050512 | Bacteria | 1727 |
| 653 | nmdc:mga0n895_46102_c1 | 3300050512 | Bacteria | 4257 |
| 654 | nmdc:mga0rr50_701864_c1 | 3300050513 | Bacteria | 863 |
| 655 | nmdc:mga0a205_1106149_c1 | 3300050515 | Bacteria | 640 |
| 656 | nmdc:mga0a205_448320_c1 | 3300050515 | Bacteria | 1151 |
| 657 | nmdc:mga0sz30_47199_c1 | 3300050516 | Bacteria | 1819 |
| 658 | Ga0495601_0008313 | 3300053077 | Bacteria | 6126 |
| 659 | Ga0495601_0016135 | 3300053077 | Bacteria | 4522 |
| 660 | Ga0495612_0001797 | 3300053078 | Bacteria | 8784 |
| 661 | Ga0495595_0002645 | 3300053084 | Bacteria | 7024 |
| 662 | Ga0495595_0003758 | 3300053084 | Bacteria | 6038 |
| 663 | Ga0495619_0000973 | 3300053085 | Bacteria | 18754 |
| 664 | Ga0495619_0004883 | 3300053085 | Bacteria | 8511 |
| 665 | Ga0500593_005031 | 3300053117 | Bacteria | 5170 |
| 666 | Ga0500595_034388 | 3300053119 | Bacteria | 1676 |
| 667 | Ga0500645_110932 | 3300053730 | Bacteria | 769 |
| 668 | Ga0501084_0406068 | 3300054114 | Bacteria | 1151 |
| 669 | Ga0501084_0607172 | 3300054114 | Bacteria | 924 |
| 670 | Ga0590077_067956 | 3300059426 | Bacteria | 812 |
| 671 | Ga0501082_0412087 | 3300060353 | Bacteria | 1180 |
| 672 | Ga0530510_0496892 | 3300061734 | Bacteria | 925 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_0412087 | Ga0501082_0412087_11_424 | 132 |
| 2 | 3300005719 | Ga0068861_100438187 | Ga0068861_1004381873 | 136 |
| 3 | 3300035207 | Ga0373942_0073592 | Ga0373942_0073592_34_480 | 148 |
| 4 | 3300042876 | Ga0451577_0915903 | Ga0451577_0915903_310_765 | 148 |
| 5 | 3300044712 | Ga0453684_0599124 | Ga0453684_0599124_469_924 | 148 |
| 6 | 3300044712 | Ga0453684_1461151 | Ga0453684_1461151_153_608 | 148 |
| 7 | 3300005335 | Ga0070666_10355014 | Ga0070666_103550142 | 149 |
| 8 | 3300005435 | Ga0070714_100409051 | Ga0070714_1004090511 | 149 |
| 9 | 3300005440 | Ga0070705_100115431 | Ga0070705_1001154312 | 149 |
| 10 | 3300005456 | Ga0070678_100342618 | Ga0070678_1003426182 | 149 |
| 11 | 3300005545 | Ga0070695_100015436 | Ga0070695_1000154363 | 149 |
| 12 | 3300005547 | Ga0070693_100201773 | Ga0070693_1002017732 | 149 |
| 13 | 3300006028 | Ga0070717_10304245 | Ga0070717_103042451 | 149 |
| 14 | 3300009545 | Ga0105237_11691072 | Ga0105237_116910721 | 149 |
| 15 | 3300012490 | Ga0157322_1045631 | Ga0157322_10456311 | 149 |
| 16 | 3300014968 | Ga0157379_10857811 | Ga0157379_108578111 | 149 |
| 17 | 3300025906 | Ga0207699_10797621 | Ga0207699_107976212 | 149 |
| 18 | 3300030760 | Ga0265762_1019361 | Ga0265762_10193612 | 149 |
| 19 | 3300031090 | Ga0265760_10367073 | Ga0265760_103670731 | 149 |
| 20 | 3300031247 | Ga0265340_10001287 | Ga0265340_100012873 | 149 |
| 21 | 3300031249 | Ga0265339_10018854 | Ga0265339_100188542 | 149 |
| 22 | 3300031250 | Ga0265331_10073469 | Ga0265331_100734692 | 149 |
| 23 | 3300031344 | Ga0265316_10524620 | Ga0265316_105246202 | 149 |
| 24 | 3300031711 | Ga0265314_10042452 | Ga0265314_100424522 | 149 |
| 25 | 3300031712 | Ga0265342_10000109 | Ga0265342_1000010950 | 149 |
| 26 | 3300035086 | Ga0373934_0010104 | Ga0373934_0010104_2543_3088 | 149 |
| 27 | 3300035112 | Ga0373932_0359426 | Ga0373932_0359426_30_479 | 149 |
| 28 | 3300035117 | Ga0373953_0009761 | Ga0373953_0009761_495_1040 | 149 |
| 29 | 3300035118 | Ga0373954_0088618 | Ga0373954_0088618_792_1337 | 149 |
| 30 | 3300035120 | Ga0373957_0008590 | Ga0373957_0008590_1171_1716 | 149 |
| 31 | 3300035170 | Ga0373943_0027681 | Ga0373943_0027681_1199_1744 | 149 |
| 32 | 3300035171 | Ga0373946_0048763 | Ga0373946_0048763_409_954 | 149 |
| 33 | 3300035172 | Ga0373955_0063123 | Ga0373955_0063123_1327_1872 | 149 |
| 34 | 3300035410 | Ga0373924_0047785 | Ga0373924_0047785_1069_1614 | 149 |
| 35 | 3300035692 | Ga0373935_0125527 | Ga0373935_0125527_149_694 | 149 |
| 36 | 3300035695 | Ga0373927_0029458 | Ga0373927_0029458_2822_3367 | 149 |
| 37 | 3300035724 | Ga0373933_0027005 | Ga0373933_0027005_2039_2584 | 149 |
| 38 | 3300035725 | Ga0373947_0103560 | Ga0373947_0103560_495_1040 | 149 |
| 39 | 3300036401 | Ga0373937_0003814 | Ga0373937_0003814_9887_10432 | 149 |
| 40 | 3300037068 | Ga0373925_0568910 | Ga0373925_0568910_190_735 | 149 |
| 41 | 3300044712 | Ga0453684_0237254 | Ga0453684_0237254_389_838 | 149 |
| 42 | 3300046454 | Ga0495592_0002605 | Ga0495592_0002605_7907_8452 | 149 |
| 43 | 3300046455 | Ga0495603_0065539 | Ga0495603_0065539_1281_1826 | 149 |
| 44 | 3300046459 | Ga0495629_0038051 | Ga0495629_0038051_500_1045 | 149 |
| 45 | 3300046462 | Ga0495651_0001716 | Ga0495651_0001716_12905_13450 | 149 |
| 46 | 3300046463 | Ga0495653_0002378 | Ga0495653_0002378_12092_12637 | 149 |
| 47 | 3300046473 | Ga0495582_0349506 | Ga0495582_0349506_99_548 | 149 |
| 48 | 3300046476 | Ga0495662_0047410 | Ga0495662_0047410_530_1075 | 149 |
| 49 | 3300046477 | Ga0495664_0022046 | Ga0495664_0022046_572_1117 | 149 |
| 50 | 3300046511 | Ga0495608_0092397 | Ga0495608_0092397_401_946 | 149 |
| 51 | 3300046514 | Ga0495618_0004476 | Ga0495618_0004476_3717_4262 | 149 |
| 52 | 3300046516 | Ga0495628_0008038 | Ga0495628_0008038_4983_5528 | 149 |
| 53 | 3300046529 | Ga0495652_0003013 | Ga0495652_0003013_12677_13222 | 149 |
| 54 | 3300046531 | Ga0495665_0079677 | Ga0495665_0079677_28_477 | 149 |
| 55 | 3300046533 | Ga0495640_0032361 | Ga0495640_0032361_756_1301 | 149 |
| 56 | 3300046536 | Ga0495587_0004244 | Ga0495587_0004244_6648_7193 | 149 |
| 57 | 3300046543 | Ga0495645_0011818 | Ga0495645_0011818_1092_1637 | 149 |
| 58 | 3300046559 | Ga0495667_0000399 | Ga0495667_0000399_9330_9875 | 149 |
| 59 | 3300046642 | Ga0495634_0024003 | Ga0495634_0024003_1491_2036 | 149 |
| 60 | 3300046663 | Ga0495635_0008931 | Ga0495635_0008931_4023_4568 | 149 |
| 61 | 3300046675 | Ga0495657_0035957 | Ga0495657_0035957_2352_2897 | 149 |
| 62 | 3300046678 | Ga0495599_0010464 | Ga0495599_0010464_3001_3546 | 149 |
| 63 | 3300046679 | Ga0495623_0028719 | Ga0495623_0028719_547_1092 | 149 |
| 64 | 3300046680 | Ga0495646_0022469 | Ga0495646_0022469_2777_3322 | 149 |
| 65 | 3300046690 | Ga0495624_0138856 | Ga0495624_0138856_1018_1467 | 149 |
| 66 | 3300046809 | Ga0495600_0004886 | Ga0495600_0004886_606_1151 | 149 |
| 67 | 3300047315 | Ga0495581_0230185 | Ga0495581_0230185_278_823 | 149 |
| 68 | 3300047317 | Ga0495604_0106800 | Ga0495604_0106800_1093_1638 | 149 |
| 69 | 3300047319 | Ga0495674_0052759 | Ga0495674_0052759_2219_2764 | 149 |
| 70 | 3300047322 | Ga0495680_0001112 | Ga0495680_0001112_2377_2922 | 149 |
| 71 | 3300047444 | Ga0495675_0001163 | Ga0495675_0001163_2249_2794 | 149 |
| 72 | 3300047471 | Ga0495684_0012837 | Ga0495684_0012837_3563_4108 | 149 |
| 73 | 3300047673 | Ga0495593_0030114 | Ga0495593_0030114_1904_2449 | 149 |
| 74 | 3300048088 | Ga0495602_0023384 | Ga0495602_0023384_4746_5291 | 149 |
| 75 | 3300048089 | Ga0495614_0142563 | Ga0495614_0142563_449_994 | 149 |
| 76 | 3300048918 | Ga0496115_0970370 | Ga0496115_0970370_124_573 | 149 |
| 77 | 3300053077 | Ga0495601_0008313 | Ga0495601_0008313_1093_1638 | 149 |
| 78 | 3300053078 | Ga0495612_0001797 | Ga0495612_0001797_8187_8732 | 149 |
| 79 | 3300053084 | Ga0495595_0003758 | Ga0495595_0003758_4529_5074 | 149 |
| 80 | 3300053085 | Ga0495619_0000973 | Ga0495619_0000973_5699_6244 | 149 |
| 81 | 3300005289 | Ga0065704_10785888 | Ga0065704_107858881 | 150 |
| 82 | 3300005333 | Ga0070677_10374496 | Ga0070677_103744962 | 150 |
| 83 | 3300005334 | Ga0068869_100389709 | Ga0068869_1003897092 | 150 |
| 84 | 3300005336 | Ga0070680_100032648 | Ga0070680_1000326482 | 150 |
| 85 | 3300005336 | Ga0070680_100262602 | Ga0070680_1002626022 | 150 |
| 86 | 3300005336 | Ga0070680_100624075 | Ga0070680_1006240751 | 150 |
| 87 | 3300005339 | Ga0070660_101419699 | Ga0070660_1014196991 | 150 |
| 88 | 3300005343 | Ga0070687_100126458 | Ga0070687_1001264582 | 150 |
| 89 | 3300005345 | Ga0070692_10090294 | Ga0070692_100902942 | 150 |
| 90 | 3300005353 | Ga0070669_100022862 | Ga0070669_1000228623 | 150 |
| 91 | 3300005354 | Ga0070675_100183795 | Ga0070675_1001837952 | 150 |
| 92 | 3300005356 | Ga0070674_101144444 | Ga0070674_1011444442 | 150 |
| 93 | 3300005364 | Ga0070673_100356908 | Ga0070673_1003569082 | 150 |
| 94 | 3300005365 | Ga0070688_100805501 | Ga0070688_1008055012 | 150 |
| 95 | 3300005435 | Ga0070714_100175915 | Ga0070714_1001759153 | 150 |
| 96 | 3300005440 | Ga0070705_100073272 | Ga0070705_1000732722 | 150 |
| 97 | 3300005441 | Ga0070700_100013138 | Ga0070700_1000131382 | 150 |
| 98 | 3300005441 | Ga0070700_100194672 | Ga0070700_1001946722 | 150 |
| 99 | 3300005441 | Ga0070700_100711916 | Ga0070700_1007119161 | 150 |
| 100 | 3300005444 | Ga0070694_100003882 | Ga0070694_1000038822 | 150 |
| 101 | 3300005458 | Ga0070681_10814770 | Ga0070681_108147701 | 150 |
| 102 | 3300005459 | Ga0068867_100017351 | Ga0068867_1000173515 | 150 |
| 103 | 3300005466 | Ga0070685_10202602 | Ga0070685_102026022 | 150 |
| 104 | 3300005543 | Ga0070672_100384043 | Ga0070672_1003840431 | 150 |
| 105 | 3300005544 | Ga0070686_100142741 | Ga0070686_1001427412 | 150 |
| 106 | 3300005544 | Ga0070686_101258202 | Ga0070686_1012582021 | 150 |
| 107 | 3300005546 | Ga0070696_100029970 | Ga0070696_1000299704 | 150 |
| 108 | 3300005546 | Ga0070696_100665171 | Ga0070696_1006651712 | 150 |
| 109 | 3300005548 | Ga0070665_101824417 | Ga0070665_1018244171 | 150 |
| 110 | 3300005549 | Ga0070704_100016121 | Ga0070704_1000161212 | 150 |
| 111 | 3300005577 | Ga0068857_100248290 | Ga0068857_1002482902 | 150 |
| 112 | 3300005577 | Ga0068857_100377497 | Ga0068857_1003774972 | 150 |
| 113 | 3300005615 | Ga0070702_100027865 | Ga0070702_1000278654 | 150 |
| 114 | 3300005617 | Ga0068859_100978902 | Ga0068859_1009789022 | 150 |
| 115 | 3300005718 | Ga0068866_10011993 | Ga0068866_100119933 | 150 |
| 116 | 3300005719 | Ga0068861_100340354 | Ga0068861_1003403542 | 150 |
| 117 | 3300005840 | Ga0068870_10308294 | Ga0068870_103082942 | 150 |
| 118 | 3300005841 | Ga0068863_100210284 | Ga0068863_1002102842 | 150 |
| 119 | 3300005842 | Ga0068858_100072052 | Ga0068858_1000720522 | 150 |
| 120 | 3300005842 | Ga0068858_100190310 | Ga0068858_1001903102 | 150 |
| 121 | 3300005843 | Ga0068860_100117945 | Ga0068860_1001179453 | 150 |
| 122 | 3300005844 | Ga0068862_100018505 | Ga0068862_1000185052 | 150 |
| 123 | 3300005844 | Ga0068862_100030714 | Ga0068862_1000307143 | 150 |
| 124 | 3300006051 | Ga0075364_10052349 | Ga0075364_100523492 | 150 |
| 125 | 3300006051 | Ga0075364_10343313 | Ga0075364_103433132 | 150 |
| 126 | 3300006237 | Ga0097621_100004686 | Ga0097621_1000046868 | 150 |
| 127 | 3300006237 | Ga0097621_100336478 | Ga0097621_1003364782 | 150 |
| 128 | 3300006358 | Ga0068871_100013670 | Ga0068871_1000136702 | 150 |
| 129 | 3300006846 | Ga0075430_100091457 | Ga0075430_1000914573 | 150 |
| 130 | 3300006881 | Ga0068865_101172128 | Ga0068865_1011721281 | 150 |
| 131 | 3300006931 | Ga0097620_100978924 | Ga0097620_1009789241 | 150 |
| 132 | 3300007076 | Ga0075435_101121401 | Ga0075435_1011214011 | 150 |
| 133 | 3300009094 | Ga0111539_10110001 | Ga0111539_101100012 | 150 |
| 134 | 3300009094 | Ga0111539_10425782 | Ga0111539_104257823 | 150 |
| 135 | 3300009094 | Ga0111539_10615131 | Ga0111539_106151312 | 150 |
| 136 | 3300009094 | Ga0111539_10737742 | Ga0111539_107377422 | 150 |
| 137 | 3300009147 | Ga0114129_11575763 | Ga0114129_115757632 | 150 |
| 138 | 3300009174 | Ga0105241_10089297 | Ga0105241_100892972 | 150 |
| 139 | 3300009176 | Ga0105242_11150771 | Ga0105242_111507712 | 150 |
| 140 | 3300009177 | Ga0105248_10055417 | Ga0105248_100554175 | 150 |
| 141 | 3300009545 | Ga0105237_10033765 | Ga0105237_100337654 | 150 |
| 142 | 3300009551 | Ga0105238_10428155 | Ga0105238_104281552 | 150 |
| 143 | 3300009553 | Ga0105249_10043312 | Ga0105249_100433124 | 150 |
| 144 | 3300009553 | Ga0105249_10063052 | Ga0105249_100630522 | 150 |
| 145 | 3300013297 | Ga0157378_10109439 | Ga0157378_101094392 | 150 |
| 146 | 3300013297 | Ga0157378_10947184 | Ga0157378_109471841 | 150 |
| 147 | 3300014325 | Ga0163163_10229684 | Ga0163163_102296842 | 150 |
| 148 | 3300014326 | Ga0157380_10854994 | Ga0157380_108549942 | 150 |
| 149 | 3300014745 | Ga0157377_10145134 | Ga0157377_101451342 | 150 |
| 150 | 3300014969 | Ga0157376_10191352 | Ga0157376_101913522 | 150 |
| 151 | 3300021384 | Ga0213876_10116268 | Ga0213876_101162682 | 150 |
| 152 | 3300025893 | Ga0207682_10020194 | Ga0207682_100201942 | 150 |
| 153 | 3300025899 | Ga0207642_10005153 | Ga0207642_100051533 | 150 |
| 154 | 3300025903 | Ga0207680_10126377 | Ga0207680_101263771 | 150 |
| 155 | 3300025907 | Ga0207645_10052237 | Ga0207645_100522373 | 150 |
| 156 | 3300025908 | Ga0207643_10005479 | Ga0207643_100054793 | 150 |
| 157 | 3300025911 | Ga0207654_10322068 | Ga0207654_103220682 | 150 |
| 158 | 3300025914 | Ga0207671_10127053 | Ga0207671_101270532 | 150 |
| 159 | 3300025917 | Ga0207660_10036634 | Ga0207660_100366342 | 150 |
| 160 | 3300025917 | Ga0207660_10105982 | Ga0207660_101059822 | 150 |
| 161 | 3300025918 | Ga0207662_10104710 | Ga0207662_101047102 | 150 |
| 162 | 3300025923 | Ga0207681_10028116 | Ga0207681_100281163 | 150 |
| 163 | 3300025924 | Ga0207694_10296906 | Ga0207694_102969062 | 150 |
| 164 | 3300025924 | Ga0207694_10412054 | Ga0207694_104120542 | 150 |
| 165 | 3300025926 | Ga0207659_10048920 | Ga0207659_100489202 | 150 |
| 166 | 3300025936 | Ga0207670_10259347 | Ga0207670_102593472 | 150 |
| 167 | 3300025936 | Ga0207670_10595100 | Ga0207670_105951002 | 150 |
| 168 | 3300025937 | Ga0207669_10146882 | Ga0207669_101468822 | 150 |
| 169 | 3300025938 | Ga0207704_10033814 | Ga0207704_100338142 | 150 |
| 170 | 3300025938 | Ga0207704_10477024 | Ga0207704_104770241 | 150 |
| 171 | 3300025940 | Ga0207691_10061457 | Ga0207691_100614573 | 150 |
| 172 | 3300025941 | Ga0207711_10044988 | Ga0207711_100449882 | 150 |
| 173 | 3300025942 | Ga0207689_10268154 | Ga0207689_102681542 | 150 |
| 174 | 3300025944 | Ga0207661_10038807 | Ga0207661_100388074 | 150 |
| 175 | 3300025960 | Ga0207651_10659154 | Ga0207651_106591542 | 150 |
| 176 | 3300025961 | Ga0207712_10032388 | Ga0207712_100323883 | 150 |
| 177 | 3300025961 | Ga0207712_10148088 | Ga0207712_101480881 | 150 |
| 178 | 3300025972 | Ga0207668_10045719 | Ga0207668_100457192 | 150 |
| 179 | 3300026035 | Ga0207703_10083819 | Ga0207703_100838193 | 150 |
| 180 | 3300026041 | Ga0207639_10219061 | Ga0207639_102190612 | 150 |
| 181 | 3300026075 | Ga0207708_10045668 | Ga0207708_100456684 | 150 |
| 182 | 3300026075 | Ga0207708_10432984 | Ga0207708_104329842 | 150 |
| 183 | 3300026075 | Ga0207708_10532312 | Ga0207708_105323122 | 150 |
| 184 | 3300026088 | Ga0207641_10051878 | Ga0207641_100518782 | 150 |
| 185 | 3300026089 | Ga0207648_10001980 | Ga0207648_1000198019 | 150 |
| 186 | 3300026095 | Ga0207676_12015047 | Ga0207676_120150472 | 150 |
| 187 | 3300026116 | Ga0207674_10449795 | Ga0207674_104497952 | 150 |
| 188 | 3300026116 | Ga0207674_10835889 | Ga0207674_108358892 | 150 |
| 189 | 3300026118 | Ga0207675_100044837 | Ga0207675_1000448372 | 150 |
| 190 | 3300026118 | Ga0207675_100101000 | Ga0207675_1001010004 | 150 |
| 191 | 3300026118 | Ga0207675_100301871 | Ga0207675_1003018712 | 150 |
| 192 | 3300026121 | Ga0207683_10288639 | Ga0207683_102886392 | 150 |
| 193 | 3300027111 | Ga0209281_1000355 | Ga0209281_100035538 | 150 |
| 194 | 3300027360 | Ga0209969_1003462 | Ga0209969_10034622 | 150 |
| 195 | 3300027364 | Ga0209967_1000380 | Ga0209967_10003802 | 150 |
| 196 | 3300027378 | Ga0209981_1000383 | Ga0209981_10003833 | 150 |
| 197 | 3300027395 | Ga0209996_1002235 | Ga0209996_10022352 | 150 |
| 198 | 3300027462 | Ga0210000_1000816 | Ga0210000_10008163 | 150 |
| 199 | 3300027462 | Ga0210000_1015477 | Ga0210000_10154772 | 150 |
| 200 | 3300027471 | Ga0209995_1001625 | Ga0209995_10016252 | 150 |
| 201 | 3300027526 | Ga0209968_1001752 | Ga0209968_10017522 | 150 |
| 202 | 3300027543 | Ga0209999_1000730 | Ga0209999_10007303 | 150 |
| 203 | 3300027682 | Ga0209971_1103681 | Ga0209971_11036811 | 150 |
| 204 | 3300027695 | Ga0209966_1029280 | Ga0209966_10292802 | 150 |
| 205 | 3300028379 | Ga0268266_10166657 | Ga0268266_101666572 | 150 |
| 206 | 3300028380 | Ga0268265_10359437 | Ga0268265_103594372 | 150 |
| 207 | 3300028380 | Ga0268265_10436948 | Ga0268265_104369481 | 150 |
| 208 | 3300028381 | Ga0268264_10333309 | Ga0268264_103333093 | 150 |
| 209 | 3300031548 | Ga0307408_101542368 | Ga0307408_1015423681 | 150 |
| 210 | 3300031731 | Ga0307405_11083172 | Ga0307405_110831722 | 150 |
| 211 | 3300031852 | Ga0307410_11251882 | Ga0307410_112518821 | 150 |
| 212 | 3300031901 | Ga0307406_10794605 | Ga0307406_107946051 | 150 |
| 213 | 3300031903 | Ga0307407_10652696 | Ga0307407_106526962 | 150 |
| 214 | 3300031903 | Ga0307407_10770593 | Ga0307407_107705932 | 150 |
| 215 | 3300031911 | Ga0307412_10329375 | Ga0307412_103293752 | 150 |
| 216 | 3300031911 | Ga0307412_10507456 | Ga0307412_105074562 | 150 |
| 217 | 3300032002 | Ga0307416_100035032 | Ga0307416_1000350324 | 150 |
| 218 | 3300032005 | Ga0307411_11682142 | Ga0307411_116821422 | 150 |
| 219 | 3300032126 | Ga0307415_101267430 | Ga0307415_1012674302 | 150 |
| 220 | 3300034817 | Ga0373948_0005827 | Ga0373948_0005827_926_1387 | 150 |
| 221 | 3300034819 | Ga0373958_0009143 | Ga0373958_0009143_492_953 | 150 |
| 222 | 3300034819 | Ga0373958_0022336 | Ga0373958_0022336_287_739 | 150 |
| 223 | 3300034957 | Ga0373938_0016063 | Ga0373938_0016063_65_517 | 150 |
| 224 | 3300035084 | Ga0373928_0154603 | Ga0373928_0154603_131_583 | 150 |
| 225 | 3300035085 | Ga0373929_0043265 | Ga0373929_0043265_77_538 | 150 |
| 226 | 3300035088 | Ga0373940_0066491 | Ga0373940_0066491_362_823 | 150 |
| 227 | 3300035091 | Ga0373951_0015760 | Ga0373951_0015760_314_775 | 150 |
| 228 | 3300035112 | Ga0373932_0042735 | Ga0373932_0042735_173_634 | 150 |
| 229 | 3300035115 | Ga0373941_0007309 | Ga0373941_0007309_1010_1462 | 150 |
| 230 | 3300035115 | Ga0373941_0034247 | Ga0373941_0034247_680_1141 | 150 |
| 231 | 3300035242 | Ga0373962_0003240 | Ga0373962_0003240_62_523 | 150 |
| 232 | 3300035691 | Ga0373931_0000460 | Ga0373931_0000460_12286_12747 | 150 |
| 233 | 3300035691 | Ga0373931_0034279 | Ga0373931_0034279_1484_1936 | 150 |
| 234 | 3300035691 | Ga0373931_0208677 | Ga0373931_0208677_17_478 | 150 |
| 235 | 3300037471 | Ga0395905_0878070 | Ga0395905_0878070_60_512 | 150 |
| 236 | 3300039437 | Ga0436365_1074131 | Ga0436365_1074131_462_920 | 150 |
| 237 | 3300042009 | Ga0439451_086549 | Ga0439451_086549_46_504 | 150 |
| 238 | 3300042013 | Ga0439456_087818 | Ga0439456_087818_185_637 | 150 |
| 239 | 3300042125 | Ga0450923_036570 | Ga0450923_036570_378_830 | 150 |
| 240 | 3300046524 | Ga0495648_0197556 | Ga0495648_0197556_470_943 | 150 |
| 241 | 3300046537 | Ga0495598_0158798 | Ga0495598_0158798_58_510 | 150 |
| 242 | 3300046539 | Ga0495621_0051166 | Ga0495621_0051166_309_761 | 150 |
| 243 | 3300046615 | Ga0495656_0134506 | Ga0495656_0134506_633_1100 | 150 |
| 244 | 3300046660 | Ga0495625_0371188 | Ga0495625_0371188_169_642 | 150 |
| 245 | 3300046684 | Ga0495669_0080402 | Ga0495669_0080402_38_490 | 150 |
| 246 | 3300047318 | Ga0495636_0263674 | Ga0495636_0263674_26_478 | 150 |
| 247 | 3300047318 | Ga0495636_0366164 | Ga0495636_0366164_14_466 | 150 |
| 248 | 3300048923 | Ga0496120_0094524 | Ga0496120_0094524_1086_1559 | 150 |
| 249 | 3300049521 | Ga0501298_042792 | Ga0501298_042792_390_842 | 150 |
| 250 | 3300049522 | Ga0501299_098622 | Ga0501299_098622_81_533 | 150 |
| 251 | 3300049569 | Ga0501032_0832354 | Ga0501032_0832354_48_500 | 150 |
| 252 | 3300049570 | Ga0501033_0224770 | Ga0501033_0224770_504_956 | 150 |
| 253 | 3300049570 | Ga0501033_0474699 | Ga0501033_0474699_157_732 | 150 |
| 254 | 3300049571 | Ga0501034_0095341 | Ga0501034_0095341_1557_2009 | 150 |
| 255 | 3300049572 | Ga0501036_0144874 | Ga0501036_0144874_357_809 | 150 |
| 256 | 3300049573 | Ga0501037_0341375 | Ga0501037_0341375_54_506 | 150 |
| 257 | 3300049574 | Ga0501038_0156816 | Ga0501038_0156816_299_751 | 150 |
| 258 | 3300049574 | Ga0501038_0971669 | Ga0501038_0971669_34_486 | 150 |
| 259 | 3300049575 | Ga0501039_0017403 | Ga0501039_0017403_1085_1537 | 150 |
| 260 | 3300049576 | Ga0501040_0022746 | Ga0501040_0022746_1739_2191 | 150 |
| 261 | 3300049577 | Ga0501041_0006065 | Ga0501041_0006065_2056_2508 | 150 |
| 262 | 3300049577 | Ga0501041_0133905 | Ga0501041_0133905_636_1088 | 150 |
| 263 | 3300049578 | Ga0501042_0208178 | Ga0501042_0208178_814_1266 | 150 |
| 264 | 3300049578 | Ga0501042_0226997 | Ga0501042_0226997_64_516 | 150 |
| 265 | 3300049579 | Ga0501043_0491311 | Ga0501043_0491311_85_537 | 150 |
| 266 | 3300049579 | Ga0501043_0669116 | Ga0501043_0669116_242_694 | 150 |
| 267 | 3300049580 | Ga0501046_0027302 | Ga0501046_0027302_3759_4211 | 150 |
| 268 | 3300049580 | Ga0501046_0346226 | Ga0501046_0346226_177_629 | 150 |
| 269 | 3300049581 | Ga0501047_0068048 | Ga0501047_0068048_456_908 | 150 |
| 270 | 3300049582 | Ga0501048_0188131 | Ga0501048_0188131_555_1007 | 150 |
| 271 | 3300049582 | Ga0501048_0211324 | Ga0501048_0211324_676_1128 | 150 |
| 272 | 3300049587 | Ga0501071_0742196 | Ga0501071_0742196_174_626 | 150 |
| 273 | 3300049588 | Ga0501072_1006602 | Ga0501072_1006602_144_596 | 150 |
| 274 | 3300049591 | Ga0501075_0041908 | Ga0501075_0041908_2816_3268 | 150 |
| 275 | 3300049592 | Ga0501076_0161930 | Ga0501076_0161930_1307_1759 | 150 |
| 276 | 3300049592 | Ga0501076_0296267 | Ga0501076_0296267_368_820 | 150 |
| 277 | 3300049741 | Ga0501079_0081315 | Ga0501079_0081315_756_1208 | 150 |
| 278 | 3300049741 | Ga0501079_1221784 | Ga0501079_1221784_11_463 | 150 |
| 279 | 3300049742 | Ga0501080_0696526 | Ga0501080_0696526_288_740 | 150 |
| 280 | 3300049743 | Ga0501081_0103375 | Ga0501081_0103375_929_1381 | 150 |
| 281 | 3300049779 | Ga0501283_043946 | Ga0501283_043946_211_663 | 150 |
| 282 | 3300049822 | Ga0501035_0767972 | Ga0501035_0767972_191_643 | 150 |
| 283 | 3300049823 | Ga0501044_0108990 | Ga0501044_0108990_2181_2633 | 150 |
| 284 | 3300049824 | Ga0501045_0047507 | Ga0501045_0047507_101_553 | 150 |
| 285 | 3300049824 | Ga0501045_0617821 | Ga0501045_0617821_219_671 | 150 |
| 286 | 3300050492 | nmdc:mga0yw44_667525_c1 | nmdc:mga0yw44_667525_c1_165_617 | 150 |
| 287 | 3300050507 | nmdc:mga05p37_964886_c1 | nmdc:mga05p37_964886_c1_411_863 | 150 |
| 288 | 3300050508 | nmdc:mga09592_416614_c1 | nmdc:mga09592_416614_c1_211_663 | 150 |
| 289 | 3300050509 | nmdc:mga0qj67_10268_c1 | nmdc:mga0qj67_10268_c1_2184_2636 | 150 |
| 290 | 3300050509 | nmdc:mga0qj67_404038_c1 | nmdc:mga0qj67_404038_c1_526_978 | 150 |
| 291 | 3300050511 | nmdc:mga08y16_1671324_c1 | nmdc:mga08y16_1671324_c1_16_483 | 150 |
| 292 | 3300050511 | nmdc:mga08y16_234293_c1 | nmdc:mga08y16_234293_c1_558_1025 | 150 |
| 293 | 3300050511 | nmdc:mga08y16_79407_c1 | nmdc:mga08y16_79407_c1_1767_2219 | 150 |
| 294 | 3300050511 | nmdc:mga08y16_97268_c1 | nmdc:mga08y16_97268_c1_2083_2535 | 150 |
| 295 | 3300050516 | nmdc:mga0sz30_47199_c1 | nmdc:mga0sz30_47199_c1_1324_1776 | 150 |
| 296 | 3300053730 | Ga0500645_110932 | Ga0500645_110932_40_513 | 150 |
| 297 | 3300054114 | Ga0501084_0406068 | Ga0501084_0406068_345_797 | 150 |
| 298 | 3300005330 | Ga0070690_100006106 | Ga0070690_1000061065 | 151 |
| 299 | 3300005334 | Ga0068869_100391792 | Ga0068869_1003917922 | 151 |
| 300 | 3300005334 | Ga0068869_100440164 | Ga0068869_1004401642 | 151 |
| 301 | 3300005337 | Ga0070682_100302877 | Ga0070682_1003028772 | 151 |
| 302 | 3300005343 | Ga0070687_100342959 | Ga0070687_1003429592 | 151 |
| 303 | 3300005347 | Ga0070668_100519804 | Ga0070668_1005198042 | 151 |
| 304 | 3300005355 | Ga0070671_100025538 | Ga0070671_1000255382 | 151 |
| 305 | 3300005356 | Ga0070674_100227535 | Ga0070674_1002275352 | 151 |
| 306 | 3300005364 | Ga0070673_100342201 | Ga0070673_1003422012 | 151 |
| 307 | 3300005365 | Ga0070688_100029086 | Ga0070688_1000290862 | 151 |
| 308 | 3300005441 | Ga0070700_100615643 | Ga0070700_1006156432 | 151 |
| 309 | 3300005458 | Ga0070681_10133520 | Ga0070681_101335202 | 151 |
| 310 | 3300005543 | Ga0070672_100260719 | Ga0070672_1002607192 | 151 |
| 311 | 3300005548 | Ga0070665_100974124 | Ga0070665_1009741242 | 151 |
| 312 | 3300005549 | Ga0070704_100418576 | Ga0070704_1004185762 | 151 |
| 313 | 3300005563 | Ga0068855_100977352 | Ga0068855_1009773522 | 151 |
| 314 | 3300005615 | Ga0070702_100151106 | Ga0070702_1001511062 | 151 |
| 315 | 3300005616 | Ga0068852_100858171 | Ga0068852_1008581711 | 151 |
| 316 | 3300005617 | Ga0068859_101608328 | Ga0068859_1016083281 | 151 |
| 317 | 3300005618 | Ga0068864_100429786 | Ga0068864_1004297862 | 151 |
| 318 | 3300005618 | Ga0068864_100717558 | Ga0068864_1007175582 | 151 |
| 319 | 3300005718 | Ga0068866_10425324 | Ga0068866_104253242 | 151 |
| 320 | 3300005719 | Ga0068861_100479378 | Ga0068861_1004793782 | 151 |
| 321 | 3300005843 | Ga0068860_100079095 | Ga0068860_1000790953 | 151 |
| 322 | 3300005843 | Ga0068860_101594448 | Ga0068860_1015944481 | 151 |
| 323 | 3300005985 | Ga0081539_10026344 | Ga0081539_100263443 | 151 |
| 324 | 3300005985 | Ga0081539_10269674 | Ga0081539_102696741 | 151 |
| 325 | 3300006048 | Ga0075363_100081654 | Ga0075363_1000816541 | 151 |
| 326 | 3300006048 | Ga0075363_100304863 | Ga0075363_1003048631 | 151 |
| 327 | 3300006051 | Ga0075364_10336997 | Ga0075364_103369971 | 151 |
| 328 | 3300006177 | Ga0075362_10077944 | Ga0075362_100779442 | 151 |
| 329 | 3300006186 | Ga0075369_10109332 | Ga0075369_101093321 | 151 |
| 330 | 3300006195 | Ga0075366_10016671 | Ga0075366_100166712 | 151 |
| 331 | 3300006195 | Ga0075366_10457563 | Ga0075366_104575632 | 151 |
| 332 | 3300006237 | Ga0097621_100287900 | Ga0097621_1002879002 | 151 |
| 333 | 3300006353 | Ga0075370_10158882 | Ga0075370_101588822 | 151 |
| 334 | 3300006353 | Ga0075370_10253411 | Ga0075370_102534111 | 151 |
| 335 | 3300006881 | Ga0068865_101101125 | Ga0068865_1011011252 | 151 |
| 336 | 3300006931 | Ga0097620_101608286 | Ga0097620_1016082862 | 151 |
| 337 | 3300007076 | Ga0075435_100486238 | Ga0075435_1004862382 | 151 |
| 338 | 3300007076 | Ga0075435_101631938 | Ga0075435_1016319382 | 151 |
| 339 | 3300009098 | Ga0105245_12674415 | Ga0105245_126744151 | 151 |
| 340 | 3300009101 | Ga0105247_10203139 | Ga0105247_102031392 | 151 |
| 341 | 3300009148 | Ga0105243_10456059 | Ga0105243_104560592 | 151 |
| 342 | 3300009148 | Ga0105243_11195999 | Ga0105243_111959992 | 151 |
| 343 | 3300009177 | Ga0105248_10243440 | Ga0105248_102434402 | 151 |
| 344 | 3300009551 | Ga0105238_11087630 | Ga0105238_110876302 | 151 |
| 345 | 3300009553 | Ga0105249_10246742 | Ga0105249_102467422 | 151 |
| 346 | 3300011119 | Ga0105246_10878079 | Ga0105246_108780792 | 151 |
| 347 | 3300013297 | Ga0157378_10692996 | Ga0157378_106929961 | 151 |
| 348 | 3300013306 | Ga0163162_10412216 | Ga0163162_104122162 | 151 |
| 349 | 3300014325 | Ga0163163_10103638 | Ga0163163_101036382 | 151 |
| 350 | 3300014745 | Ga0157377_10189293 | Ga0157377_101892931 | 151 |
| 351 | 3300014969 | Ga0157376_10266040 | Ga0157376_102660402 | 151 |
| 352 | 3300025899 | Ga0207642_10027764 | Ga0207642_100277642 | 151 |
| 353 | 3300025900 | Ga0207710_10398813 | Ga0207710_103988131 | 151 |
| 354 | 3300025907 | Ga0207645_10043281 | Ga0207645_100432812 | 151 |
| 355 | 3300025912 | Ga0207707_10157578 | Ga0207707_101575781 | 151 |
| 356 | 3300025917 | Ga0207660_10256230 | Ga0207660_102562302 | 151 |
| 357 | 3300025918 | Ga0207662_10120656 | Ga0207662_101206562 | 151 |
| 358 | 3300025921 | Ga0207652_10627665 | Ga0207652_106276652 | 151 |
| 359 | 3300025923 | Ga0207681_10122467 | Ga0207681_101224671 | 151 |
| 360 | 3300025924 | Ga0207694_11558802 | Ga0207694_115588021 | 151 |
| 361 | 3300025925 | Ga0207650_10170269 | Ga0207650_101702691 | 151 |
| 362 | 3300025931 | Ga0207644_11529297 | Ga0207644_115292971 | 151 |
| 363 | 3300025935 | Ga0207709_10415542 | Ga0207709_104155421 | 151 |
| 364 | 3300025936 | Ga0207670_10096618 | Ga0207670_100966181 | 151 |
| 365 | 3300025937 | Ga0207669_10447434 | Ga0207669_104474342 | 151 |
| 366 | 3300025938 | Ga0207704_10261039 | Ga0207704_102610392 | 151 |
| 367 | 3300025938 | Ga0207704_10650780 | Ga0207704_106507802 | 151 |
| 368 | 3300025940 | Ga0207691_10702797 | Ga0207691_107027971 | 151 |
| 369 | 3300025941 | Ga0207711_11796824 | Ga0207711_117968241 | 151 |
| 370 | 3300025942 | Ga0207689_10835276 | Ga0207689_108352761 | 151 |
| 371 | 3300025960 | Ga0207651_10524397 | Ga0207651_105243971 | 151 |
| 372 | 3300026075 | Ga0207708_10432756 | Ga0207708_104327562 | 151 |
| 373 | 3300026088 | Ga0207641_10205364 | Ga0207641_102053642 | 151 |
| 374 | 3300026089 | Ga0207648_10058327 | Ga0207648_100583272 | 151 |
| 375 | 3300026095 | Ga0207676_10175290 | Ga0207676_101752902 | 151 |
| 376 | 3300028379 | Ga0268266_11297671 | Ga0268266_112976712 | 151 |
| 377 | 3300028380 | Ga0268265_10199458 | Ga0268265_101994581 | 151 |
| 378 | 3300028381 | Ga0268264_10249852 | Ga0268264_102498522 | 151 |
| 379 | 3300028800 | Ga0265338_10017679 | Ga0265338_100176792 | 151 |
| 380 | 3300031903 | Ga0307407_10568972 | Ga0307407_105689722 | 151 |
| 381 | 3300034817 | Ga0373948_0024118 | Ga0373948_0024118_320_775 | 151 |
| 382 | 3300034818 | Ga0373950_0113986 | Ga0373950_0113986_68_523 | 151 |
| 383 | 3300034820 | Ga0373959_0133529 | Ga0373959_0133529_33_488 | 151 |
| 384 | 3300034957 | Ga0373938_0020622 | Ga0373938_0020622_812_1267 | 151 |
| 385 | 3300035092 | Ga0373952_0027214 | Ga0373952_0027214_101_556 | 151 |
| 386 | 3300035113 | Ga0373936_0023451 | Ga0373936_0023451_1725_2183 | 151 |
| 387 | 3300035121 | Ga0373960_0077047 | Ga0373960_0077047_482_937 | 151 |
| 388 | 3300035242 | Ga0373962_0044643 | Ga0373962_0044643_20_475 | 151 |
| 389 | 3300035691 | Ga0373931_0054787 | Ga0373931_0054787_1656_2111 | 151 |
| 390 | 3300048905 | Ga0496102_0470386 | Ga0496102_0470386_285_740 | 151 |
| 391 | 3300048907 | Ga0496104_0453429 | Ga0496104_0453429_213_668 | 151 |
| 392 | 3300048910 | Ga0496107_0363311 | Ga0496107_0363311_346_801 | 151 |
| 393 | 3300048912 | Ga0496109_0272893 | Ga0496109_0272893_939_1394 | 151 |
| 394 | 3300048915 | Ga0496112_0271320 | Ga0496112_0271320_564_1019 | 151 |
| 395 | 3300048916 | Ga0496113_0035614 | Ga0496113_0035614_1626_2081 | 151 |
| 396 | 3300048917 | Ga0496114_0062312 | Ga0496114_0062312_1191_1646 | 151 |
| 397 | 3300048918 | Ga0496115_0042463 | Ga0496115_0042463_2576_3031 | 151 |
| 398 | 3300049590 | Ga0501074_0435638 | Ga0501074_0435638_304_759 | 151 |
| 399 | 3300049590 | Ga0501074_0437308 | Ga0501074_0437308_134_595 | 151 |
| 400 | 3300049744 | Ga0501083_0778045 | Ga0501083_0778045_80_535 | 151 |
| 401 | 3300050489 | nmdc:mga03683_65702_c1 | nmdc:mga03683_65702_c1_630_1085 | 151 |
| 402 | 3300050490 | nmdc:mga03n38_264242_c1 | nmdc:mga03n38_264242_c1_443_898 | 151 |
| 403 | 3300050490 | nmdc:mga03n38_91499_c1 | nmdc:mga03n38_91499_c1_817_1272 | 151 |
| 404 | 3300050493 | nmdc:mga0k408_134429_c1 | nmdc:mga0k408_134429_c1_597_1052 | 151 |
| 405 | 3300050493 | nmdc:mga0k408_31294_c1 | nmdc:mga0k408_31294_c1_369_824 | 151 |
| 406 | 3300050494 | nmdc:mga06z11_338928_c1 | nmdc:mga06z11_338928_c1_174_629 | 151 |
| 407 | 3300050494 | nmdc:mga06z11_472306_c1 | nmdc:mga06z11_472306_c1_287_742 | 151 |
| 408 | 3300050494 | nmdc:mga06z11_58079_c1 | nmdc:mga06z11_58079_c1_418_873 | 151 |
| 409 | 3300050496 | nmdc:mga07m45_230274_c1 | nmdc:mga07m45_230274_c1_556_1011 | 151 |
| 410 | 3300050496 | nmdc:mga07m45_67187_c2 | nmdc:mga07m45_67187_c2_725_1180 | 151 |
| 411 | 3300050510 | nmdc:mga06r32_1212198_c1 | nmdc:mga06r32_1212198_c1_86_541 | 151 |
| 412 | 3300053117 | Ga0500593_005031 | Ga0500593_005031_4548_5003 | 151 |
| 413 | 3300059426 | Ga0590077_067956 | Ga0590077_067956_28_483 | 151 |
| 414 | 3300061734 | Ga0530510_0496892 | Ga0530510_0496892_210_665 | 151 |
| 415 | 3300003373 | JGI25407J50210_10128726 | JGI25407J50210_101287261 | 152 |
| 416 | 3300003659 | JGI25404J52841_10016510 | JGI25404J52841_100165101 | 152 |
| 417 | 3300005337 | Ga0070682_100048610 | Ga0070682_1000486102 | 152 |
| 418 | 3300005344 | Ga0070661_100020373 | Ga0070661_1000203733 | 152 |
| 419 | 3300005347 | Ga0070668_100654926 | Ga0070668_1006549262 | 152 |
| 420 | 3300005354 | Ga0070675_100612894 | Ga0070675_1006128941 | 152 |
| 421 | 3300005355 | Ga0070671_100008579 | Ga0070671_1000085793 | 152 |
| 422 | 3300005356 | Ga0070674_102000651 | Ga0070674_1020006511 | 152 |
| 423 | 3300005364 | Ga0070673_100226801 | Ga0070673_1002268012 | 152 |
| 424 | 3300005364 | Ga0070673_100397972 | Ga0070673_1003979722 | 152 |
| 425 | 3300005367 | Ga0070667_100027878 | Ga0070667_1000278782 | 152 |
| 426 | 3300005434 | Ga0070709_10043323 | Ga0070709_100433232 | 152 |
| 427 | 3300005435 | Ga0070714_100123387 | Ga0070714_1001233872 | 152 |
| 428 | 3300005435 | Ga0070714_102161638 | Ga0070714_1021616381 | 152 |
| 429 | 3300005436 | Ga0070713_100009021 | Ga0070713_1000090214 | 152 |
| 430 | 3300005436 | Ga0070713_100040579 | Ga0070713_1000405795 | 152 |
| 431 | 3300005440 | Ga0070705_100290007 | Ga0070705_1002900072 | 152 |
| 432 | 3300005440 | Ga0070705_100453974 | Ga0070705_1004539742 | 152 |
| 433 | 3300005444 | Ga0070694_100719311 | Ga0070694_1007193112 | 152 |
| 434 | 3300005445 | Ga0070708_100188446 | Ga0070708_1001884462 | 152 |
| 435 | 3300005445 | Ga0070708_100419022 | Ga0070708_1004190222 | 152 |
| 436 | 3300005456 | Ga0070678_100049153 | Ga0070678_1000491532 | 152 |
| 437 | 3300005458 | Ga0070681_10427378 | Ga0070681_104273782 | 152 |
| 438 | 3300005467 | Ga0070706_100622432 | Ga0070706_1006224322 | 152 |
| 439 | 3300005468 | Ga0070707_100018789 | Ga0070707_1000187894 | 152 |
| 440 | 3300005518 | Ga0070699_100120113 | Ga0070699_1001201131 | 152 |
| 441 | 3300005530 | Ga0070679_100186952 | Ga0070679_1001869522 | 152 |
| 442 | 3300005543 | Ga0070672_100895312 | Ga0070672_1008953122 | 152 |
| 443 | 3300005544 | Ga0070686_100027561 | Ga0070686_1000275613 | 152 |
| 444 | 3300005545 | Ga0070695_100145469 | Ga0070695_1001454691 | 152 |
| 445 | 3300005546 | Ga0070696_100038929 | Ga0070696_1000389292 | 152 |
| 446 | 3300005546 | Ga0070696_100831509 | Ga0070696_1008315091 | 152 |
| 447 | 3300005614 | Ga0068856_100082302 | Ga0068856_1000823022 | 152 |
| 448 | 3300005615 | Ga0070702_100144172 | Ga0070702_1001441722 | 152 |
| 449 | 3300005617 | Ga0068859_100905611 | Ga0068859_1009056112 | 152 |
| 450 | 3300005719 | Ga0068861_101432359 | Ga0068861_1014323592 | 152 |
| 451 | 3300005841 | Ga0068863_101236766 | Ga0068863_1012367662 | 152 |
| 452 | 3300005843 | Ga0068860_100190478 | Ga0068860_1001904782 | 152 |
| 453 | 3300005843 | Ga0068860_100785953 | Ga0068860_1007859531 | 152 |
| 454 | 3300005844 | Ga0068862_101540753 | Ga0068862_1015407531 | 152 |
| 455 | 3300005937 | Ga0081455_10036231 | Ga0081455_100362311 | 152 |
| 456 | 3300005937 | Ga0081455_10107400 | Ga0081455_101074004 | 152 |
| 457 | 3300005981 | Ga0081538_10176651 | Ga0081538_101766511 | 152 |
| 458 | 3300005981 | Ga0081538_10181416 | Ga0081538_101814162 | 152 |
| 459 | 3300005983 | Ga0081540_1006133 | Ga0081540_10061332 | 152 |
| 460 | 3300006028 | Ga0070717_10287787 | Ga0070717_102877873 | 152 |
| 461 | 3300006028 | Ga0070717_10353656 | Ga0070717_103536562 | 152 |
| 462 | 3300006042 | Ga0075368_10371382 | Ga0075368_103713822 | 152 |
| 463 | 3300006058 | Ga0075432_10206958 | Ga0075432_102069581 | 152 |
| 464 | 3300006173 | Ga0070716_101562941 | Ga0070716_1015629411 | 152 |
| 465 | 3300006175 | Ga0070712_100045103 | Ga0070712_1000451033 | 152 |
| 466 | 3300006175 | Ga0070712_100454882 | Ga0070712_1004548821 | 152 |
| 467 | 3300006237 | Ga0097621_100034588 | Ga0097621_1000345884 | 152 |
| 468 | 3300006237 | Ga0097621_100230113 | Ga0097621_1002301132 | 152 |
| 469 | 3300006358 | Ga0068871_100074445 | Ga0068871_1000744452 | 152 |
| 470 | 3300006358 | Ga0068871_100996774 | Ga0068871_1009967741 | 152 |
| 471 | 3300006844 | Ga0075428_100753775 | Ga0075428_1007537752 | 152 |
| 472 | 3300006844 | Ga0075428_100760842 | Ga0075428_1007608422 | 152 |
| 473 | 3300006847 | Ga0075431_100082951 | Ga0075431_1000829512 | 152 |
| 474 | 3300006847 | Ga0075431_100748334 | Ga0075431_1007483342 | 152 |
| 475 | 3300006852 | Ga0075433_10094261 | Ga0075433_100942613 | 152 |
| 476 | 3300006871 | Ga0075434_100051055 | Ga0075434_1000510554 | 152 |
| 477 | 3300006871 | Ga0075434_100204221 | Ga0075434_1002042213 | 152 |
| 478 | 3300006881 | Ga0068865_100321596 | Ga0068865_1003215962 | 152 |
| 479 | 3300006931 | Ga0097620_100905567 | Ga0097620_1009055672 | 152 |
| 480 | 3300007076 | Ga0075435_100439953 | Ga0075435_1004399532 | 152 |
| 481 | 3300007788 | Ga0099795_10024280 | Ga0099795_100242802 | 152 |
| 482 | 3300009094 | Ga0111539_10029898 | Ga0111539_100298982 | 152 |
| 483 | 3300009098 | Ga0105245_10156120 | Ga0105245_101561201 | 152 |
| 484 | 3300009101 | Ga0105247_10167208 | Ga0105247_101672082 | 152 |
| 485 | 3300009147 | Ga0114129_10049013 | Ga0114129_100490132 | 152 |
| 486 | 3300009147 | Ga0114129_10188585 | Ga0114129_101885852 | 152 |
| 487 | 3300009147 | Ga0114129_10530805 | Ga0114129_105308052 | 152 |
| 488 | 3300009148 | Ga0105243_10601797 | Ga0105243_106017971 | 152 |
| 489 | 3300009174 | Ga0105241_10086385 | Ga0105241_100863852 | 152 |
| 490 | 3300009545 | Ga0105237_10196848 | Ga0105237_101968482 | 152 |
| 491 | 3300009553 | Ga0105249_10344694 | Ga0105249_103446942 | 152 |
| 492 | 3300010159 | Ga0099796_10083378 | Ga0099796_100833782 | 152 |
| 493 | 3300010375 | Ga0105239_10357835 | Ga0105239_103578352 | 152 |
| 494 | 3300011119 | Ga0105246_10105421 | Ga0105246_101054212 | 152 |
| 495 | 3300012513 | Ga0157326_1000011 | Ga0157326_100001110 | 152 |
| 496 | 3300013102 | Ga0157371_10299086 | Ga0157371_102990861 | 152 |
| 497 | 3300013296 | Ga0157374_10032393 | Ga0157374_100323933 | 152 |
| 498 | 3300013297 | Ga0157378_10027853 | Ga0157378_100278533 | 152 |
| 499 | 3300013297 | Ga0157378_11716754 | Ga0157378_117167541 | 152 |
| 500 | 3300013308 | Ga0157375_10620436 | Ga0157375_106204362 | 152 |
| 501 | 3300014968 | Ga0157379_10199129 | Ga0157379_101991292 | 152 |
| 502 | 3300014968 | Ga0157379_10346010 | Ga0157379_103460102 | 152 |
| 503 | 3300014968 | Ga0157379_11097995 | Ga0157379_110979952 | 152 |
| 504 | 3300014969 | Ga0157376_10816670 | Ga0157376_108166702 | 152 |
| 505 | 3300017792 | Ga0163161_10013562 | Ga0163161_100135625 | 152 |
| 506 | 3300025885 | Ga0207653_10018191 | Ga0207653_100181912 | 152 |
| 507 | 3300025899 | Ga0207642_10828535 | Ga0207642_108285351 | 152 |
| 508 | 3300025900 | Ga0207710_10093440 | Ga0207710_100934402 | 152 |
| 509 | 3300025905 | Ga0207685_10004676 | Ga0207685_100046763 | 152 |
| 510 | 3300025907 | Ga0207645_11053462 | Ga0207645_110534621 | 152 |
| 511 | 3300025910 | Ga0207684_10092822 | Ga0207684_100928222 | 152 |
| 512 | 3300025911 | Ga0207654_10112255 | Ga0207654_101122551 | 152 |
| 513 | 3300025912 | Ga0207707_10171922 | Ga0207707_101719222 | 152 |
| 514 | 3300025915 | Ga0207693_10032967 | Ga0207693_100329673 | 152 |
| 515 | 3300025915 | Ga0207693_10906886 | Ga0207693_109068861 | 152 |
| 516 | 3300025916 | Ga0207663_10334983 | Ga0207663_103349832 | 152 |
| 517 | 3300025917 | Ga0207660_10157734 | Ga0207660_101577342 | 152 |
| 518 | 3300025919 | Ga0207657_10061677 | Ga0207657_100616772 | 152 |
| 519 | 3300025920 | Ga0207649_10080347 | Ga0207649_100803472 | 152 |
| 520 | 3300025922 | Ga0207646_10040306 | Ga0207646_100403062 | 152 |
| 521 | 3300025923 | Ga0207681_11101096 | Ga0207681_111010961 | 152 |
| 522 | 3300025927 | Ga0207687_10046586 | Ga0207687_100465861 | 152 |
| 523 | 3300025928 | Ga0207700_10116224 | Ga0207700_101162242 | 152 |
| 524 | 3300025929 | Ga0207664_10105470 | Ga0207664_101054703 | 152 |
| 525 | 3300025931 | Ga0207644_10244927 | Ga0207644_102449272 | 152 |
| 526 | 3300025932 | Ga0207690_10071928 | Ga0207690_100719282 | 152 |
| 527 | 3300025933 | Ga0207706_10028029 | Ga0207706_100280294 | 152 |
| 528 | 3300025935 | Ga0207709_10098762 | Ga0207709_100987622 | 152 |
| 529 | 3300025937 | Ga0207669_10078957 | Ga0207669_100789572 | 152 |
| 530 | 3300025939 | Ga0207665_10410718 | Ga0207665_104107181 | 152 |
| 531 | 3300025940 | Ga0207691_10781744 | Ga0207691_107817442 | 152 |
| 532 | 3300025945 | Ga0207679_10595961 | Ga0207679_105959611 | 152 |
| 533 | 3300025949 | Ga0207667_10118586 | Ga0207667_101185862 | 152 |
| 534 | 3300025960 | Ga0207651_10992272 | Ga0207651_109922722 | 152 |
| 535 | 3300025961 | Ga0207712_10441397 | Ga0207712_104413972 | 152 |
| 536 | 3300026023 | Ga0207677_10947889 | Ga0207677_109478892 | 152 |
| 537 | 3300026067 | Ga0207678_10019487 | Ga0207678_100194874 | 152 |
| 538 | 3300026075 | Ga0207708_10612094 | Ga0207708_106120941 | 152 |
| 539 | 3300026088 | Ga0207641_11862653 | Ga0207641_118626532 | 152 |
| 540 | 3300026121 | Ga0207683_10008812 | Ga0207683_100088122 | 152 |
| 541 | 3300028381 | Ga0268264_11853455 | Ga0268264_118534551 | 152 |
| 542 | 3300031344 | Ga0265316_10441418 | Ga0265316_104414182 | 152 |
| 543 | 3300031711 | Ga0265314_10004756 | Ga0265314_100047566 | 152 |
| 544 | 3300031731 | Ga0307405_10089397 | Ga0307405_100893972 | 152 |
| 545 | 3300032126 | Ga0307415_101385364 | Ga0307415_1013853642 | 152 |
| 546 | 3300035084 | Ga0373928_0053499 | Ga0373928_0053499_244_702 | 152 |
| 547 | 3300035085 | Ga0373929_0058729 | Ga0373929_0058729_258_716 | 152 |
| 548 | 3300035086 | Ga0373934_0006061 | Ga0373934_0006061_3146_3604 | 152 |
| 549 | 3300035088 | Ga0373940_0214361 | Ga0373940_0214361_165_623 | 152 |
| 550 | 3300035089 | Ga0373944_0071143 | Ga0373944_0071143_551_1009 | 152 |
| 551 | 3300035115 | Ga0373941_0107943 | Ga0373941_0107943_328_786 | 152 |
| 552 | 3300035115 | Ga0373941_0216671 | Ga0373941_0216671_147_605 | 152 |
| 553 | 3300035116 | Ga0373945_0012898 | Ga0373945_0012898_1521_1979 | 152 |
| 554 | 3300035117 | Ga0373953_0369930 | Ga0373953_0369930_39_497 | 152 |
| 555 | 3300035119 | Ga0373956_0004855 | Ga0373956_0004855_4553_5011 | 152 |
| 556 | 3300035120 | Ga0373957_0000553 | Ga0373957_0000553_1365_1823 | 152 |
| 557 | 3300035170 | Ga0373943_0012783 | Ga0373943_0012783_2775_3233 | 152 |
| 558 | 3300035172 | Ga0373955_0029726 | Ga0373955_0029726_2139_2597 | 152 |
| 559 | 3300035172 | Ga0373955_0053891 | Ga0373955_0053891_594_1052 | 152 |
| 560 | 3300035242 | Ga0373962_0084713 | Ga0373962_0084713_492_950 | 152 |
| 561 | 3300035410 | Ga0373924_0062531 | Ga0373924_0062531_509_967 | 152 |
| 562 | 3300035691 | Ga0373931_0012343 | Ga0373931_0012343_2817_3275 | 152 |
| 563 | 3300035691 | Ga0373931_0114727 | Ga0373931_0114727_457_915 | 152 |
| 564 | 3300035692 | Ga0373935_0018456 | Ga0373935_0018456_1524_1982 | 152 |
| 565 | 3300035695 | Ga0373927_0227446 | Ga0373927_0227446_80_538 | 152 |
| 566 | 3300035724 | Ga0373933_0009065 | Ga0373933_0009065_607_1065 | 152 |
| 567 | 3300035725 | Ga0373947_0016022 | Ga0373947_0016022_1419_1877 | 152 |
| 568 | 3300036401 | Ga0373937_0009081 | Ga0373937_0009081_2656_3114 | 152 |
| 569 | 3300036401 | Ga0373937_0629237 | Ga0373937_0629237_418_876 | 152 |
| 570 | 3300037068 | Ga0373925_0147391 | Ga0373925_0147391_277_735 | 152 |
| 571 | 3300037068 | Ga0373925_0496729 | Ga0373925_0496729_35_493 | 152 |
| 572 | 3300037068 | Ga0373925_0529298 | Ga0373925_0529298_53_511 | 152 |
| 573 | 3300037418 | Ga0395900_1296940 | Ga0395900_1296940_85_543 | 152 |
| 574 | 3300038996 | Ga0242420_047095 | Ga0242420_047095_184_642 | 152 |
| 575 | 3300046454 | Ga0495592_0137747 | Ga0495592_0137747_55_513 | 152 |
| 576 | 3300046455 | Ga0495603_0024250 | Ga0495603_0024250_1997_2455 | 152 |
| 577 | 3300046455 | Ga0495603_0120832 | Ga0495603_0120832_858_1316 | 152 |
| 578 | 3300046459 | Ga0495629_0049097 | Ga0495629_0049097_123_581 | 152 |
| 579 | 3300046459 | Ga0495629_0269233 | Ga0495629_0269233_580_1038 | 152 |
| 580 | 3300046461 | Ga0495641_0014791 | Ga0495641_0014791_3497_3955 | 152 |
| 581 | 3300046462 | Ga0495651_0002360 | Ga0495651_0002360_7732_8190 | 152 |
| 582 | 3300046463 | Ga0495653_0018310 | Ga0495653_0018310_3185_3643 | 152 |
| 583 | 3300046472 | Ga0495580_0077236 | Ga0495580_0077236_1693_2151 | 152 |
| 584 | 3300046475 | Ga0495639_0009155 | Ga0495639_0009155_1309_1767 | 152 |
| 585 | 3300046476 | Ga0495662_0016267 | Ga0495662_0016267_841_1299 | 152 |
| 586 | 3300046477 | Ga0495664_0276060 | Ga0495664_0276060_65_523 | 152 |
| 587 | 3300046491 | Ga0495584_0330817 | Ga0495584_0330817_120_722 | 152 |
| 588 | 3300046499 | Ga0495594_0008651 | Ga0495594_0008651_3574_4032 | 152 |
| 589 | 3300046499 | Ga0495594_0232640 | Ga0495594_0232640_456_914 | 152 |
| 590 | 3300046501 | Ga0495607_0009217 | Ga0495607_0009217_1709_2167 | 152 |
| 591 | 3300046511 | Ga0495608_0118096 | Ga0495608_0118096_1188_1646 | 152 |
| 592 | 3300046514 | Ga0495618_0002901 | Ga0495618_0002901_1758_2216 | 152 |
| 593 | 3300046516 | Ga0495628_0137068 | Ga0495628_0137068_224_682 | 152 |
| 594 | 3300046529 | Ga0495652_0076968 | Ga0495652_0076968_2236_2694 | 152 |
| 595 | 3300046533 | Ga0495640_0085749 | Ga0495640_0085749_569_1027 | 152 |
| 596 | 3300046535 | Ga0495586_0021826 | Ga0495586_0021826_2752_3210 | 152 |
| 597 | 3300046536 | Ga0495587_0001264 | Ga0495587_0001264_12384_12842 | 152 |
| 598 | 3300046538 | Ga0495609_0009437 | Ga0495609_0009437_632_1090 | 152 |
| 599 | 3300046543 | Ga0495645_0008282 | Ga0495645_0008282_1188_1646 | 152 |
| 600 | 3300046557 | Ga0495622_0299079 | Ga0495622_0299079_111_569 | 152 |
| 601 | 3300046558 | Ga0495633_0002046 | Ga0495633_0002046_10287_10745 | 152 |
| 602 | 3300046559 | Ga0495667_0003782 | Ga0495667_0003782_2711_3169 | 152 |
| 603 | 3300046559 | Ga0495667_0049529 | Ga0495667_0049529_128_586 | 152 |
| 604 | 3300046642 | Ga0495634_0029340 | Ga0495634_0029340_2374_2832 | 152 |
| 605 | 3300046642 | Ga0495634_0038969 | Ga0495634_0038969_935_1393 | 152 |
| 606 | 3300046648 | Ga0495611_0005086 | Ga0495611_0005086_1775_2233 | 152 |
| 607 | 3300046665 | Ga0495661_0052373 | Ga0495661_0052373_1480_1938 | 152 |
| 608 | 3300046674 | Ga0495588_0002506 | Ga0495588_0002506_239_697 | 152 |
| 609 | 3300046674 | Ga0495588_0233645 | Ga0495588_0233645_394_852 | 152 |
| 610 | 3300046675 | Ga0495657_0001799 | Ga0495657_0001799_1755_2213 | 152 |
| 611 | 3300046678 | Ga0495599_0005718 | Ga0495599_0005718_6287_6745 | 152 |
| 612 | 3300046679 | Ga0495623_0014717 | Ga0495623_0014717_2547_3005 | 152 |
| 613 | 3300046680 | Ga0495646_0005564 | Ga0495646_0005564_5874_6332 | 152 |
| 614 | 3300046680 | Ga0495646_0014811 | Ga0495646_0014811_2850_3308 | 152 |
| 615 | 3300046689 | Ga0495613_0072048 | Ga0495613_0072048_599_1057 | 152 |
| 616 | 3300046809 | Ga0495600_0001408 | Ga0495600_0001408_1983_2441 | 152 |
| 617 | 3300046809 | Ga0495600_0327237 | Ga0495600_0327237_378_836 | 152 |
| 618 | 3300047315 | Ga0495581_0055099 | Ga0495581_0055099_607_1065 | 152 |
| 619 | 3300047315 | Ga0495581_0096108 | Ga0495581_0096108_114_572 | 152 |
| 620 | 3300047317 | Ga0495604_0002929 | Ga0495604_0002929_9189_9647 | 152 |
| 621 | 3300047319 | Ga0495674_0004957 | Ga0495674_0004957_8731_9189 | 152 |
| 622 | 3300047319 | Ga0495674_0071452 | Ga0495674_0071452_266_724 | 152 |
| 623 | 3300047322 | Ga0495680_0007442 | Ga0495680_0007442_1785_2243 | 152 |
| 624 | 3300047444 | Ga0495675_0001604 | Ga0495675_0001604_7599_8057 | 152 |
| 625 | 3300047446 | Ga0495679_020259 | Ga0495679_020259_1422_1880 | 152 |
| 626 | 3300047471 | Ga0495684_0051773 | Ga0495684_0051773_2423_2881 | 152 |
| 627 | 3300048088 | Ga0495602_0001583 | Ga0495602_0001583_6441_6899 | 152 |
| 628 | 3300048903 | Ga0496100_0502118 | Ga0496100_0502118_65_523 | 152 |
| 629 | 3300048904 | Ga0496101_0024345 | Ga0496101_0024345_1995_2453 | 152 |
| 630 | 3300048904 | Ga0496101_0248886 | Ga0496101_0248886_136_594 | 152 |
| 631 | 3300048905 | Ga0496102_0019387 | Ga0496102_0019387_5520_5978 | 152 |
| 632 | 3300048906 | Ga0496103_0077901 | Ga0496103_0077901_65_523 | 152 |
| 633 | 3300048907 | Ga0496104_0030009 | Ga0496104_0030009_1514_1972 | 152 |
| 634 | 3300048908 | Ga0496105_0028251 | Ga0496105_0028251_1631_2089 | 152 |
| 635 | 3300048908 | Ga0496105_0723954 | Ga0496105_0723954_94_552 | 152 |
| 636 | 3300048909 | Ga0496106_0081601 | Ga0496106_0081601_495_953 | 152 |
| 637 | 3300048909 | Ga0496106_0197408 | Ga0496106_0197408_1069_1527 | 152 |
| 638 | 3300048910 | Ga0496107_0101059 | Ga0496107_0101059_782_1240 | 152 |
| 639 | 3300048910 | Ga0496107_0681911 | Ga0496107_0681911_45_503 | 152 |
| 640 | 3300048912 | Ga0496109_0174191 | Ga0496109_0174191_212_670 | 152 |
| 641 | 3300048913 | Ga0496110_0146876 | Ga0496110_0146876_1110_1568 | 152 |
| 642 | 3300048913 | Ga0496110_0336062 | Ga0496110_0336062_697_1155 | 152 |
| 643 | 3300048913 | Ga0496110_0628378 | Ga0496110_0628378_319_777 | 152 |
| 644 | 3300048914 | Ga0496111_0214600 | Ga0496111_0214600_330_788 | 152 |
| 645 | 3300048914 | Ga0496111_0471961 | Ga0496111_0471961_411_869 | 152 |
| 646 | 3300048915 | Ga0496112_0085280 | Ga0496112_0085280_2561_3019 | 152 |
| 647 | 3300048915 | Ga0496112_0341494 | Ga0496112_0341494_413_871 | 152 |
| 648 | 3300048917 | Ga0496114_0013459 | Ga0496114_0013459_2243_2701 | 152 |
| 649 | 3300048917 | Ga0496114_1733281 | Ga0496114_1733281_21_479 | 152 |
| 650 | 3300048918 | Ga0496115_0080953 | Ga0496115_0080953_1198_1656 | 152 |
| 651 | 3300048924 | Ga0496121_0210301 | Ga0496121_0210301_718_1176 | 152 |
| 652 | 3300049576 | Ga0501040_0103324 | Ga0501040_0103324_553_1011 | 152 |
| 653 | 3300049582 | Ga0501048_0096880 | Ga0501048_0096880_968_1426 | 152 |
| 654 | 3300049592 | Ga0501076_0026896 | Ga0501076_0026896_3204_3662 | 152 |
| 655 | 3300049593 | Ga0501077_0016657 | Ga0501077_0016657_1962_2420 | 152 |
| 656 | 3300049743 | Ga0501081_0008800 | Ga0501081_0008800_2879_3337 | 152 |
| 657 | 3300050492 | nmdc:mga0yw44_195218_c1 | nmdc:mga0yw44_195218_c1_591_1265 | 152 |
| 658 | 3300050494 | nmdc:mga06z11_256202_c1 | nmdc:mga06z11_256202_c1_557_1015 | 152 |
| 659 | 3300050507 | nmdc:mga05p37_16853_c1 | nmdc:mga05p37_16853_c1_283_741 | 152 |
| 660 | 3300050507 | nmdc:mga05p37_868586_c1 | nmdc:mga05p37_868586_c1_447_917 | 152 |
| 661 | 3300050510 | nmdc:mga06r32_91427_c1 | nmdc:mga06r32_91427_c1_661_1119 | 152 |
| 662 | 3300050511 | nmdc:mga08y16_587966_c1 | nmdc:mga08y16_587966_c1_365_823 | 152 |
| 663 | 3300050512 | nmdc:mga0n895_269598_c1 | nmdc:mga0n895_269598_c1_427_885 | 152 |
| 664 | 3300050512 | nmdc:mga0n895_46102_c1 | nmdc:mga0n895_46102_c1_3207_3665 | 152 |
| 665 | 3300050513 | nmdc:mga0rr50_701864_c1 | nmdc:mga0rr50_701864_c1_21_479 | 152 |
| 666 | 3300050515 | nmdc:mga0a205_1106149_c1 | nmdc:mga0a205_1106149_c1_65_523 | 152 |
| 667 | 3300050515 | nmdc:mga0a205_448320_c1 | nmdc:mga0a205_448320_c1_585_1043 | 152 |
| 668 | 3300053077 | Ga0495601_0016135 | Ga0495601_0016135_2199_2657 | 152 |
| 669 | 3300053084 | Ga0495595_0002645 | Ga0495595_0002645_5853_6311 | 152 |
| 670 | 3300053085 | Ga0495619_0004883 | Ga0495619_0004883_6895_7353 | 152 |
| 671 | 3300053119 | Ga0500595_034388 | Ga0500595_034388_1094_1564 | 152 |
| 672 | 3300054114 | Ga0501084_0607172 | Ga0501084_0607172_277_735 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9769 | 2 | 151 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9608 | 2 | 151 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.96 | 1 | 151 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9585 | 1 | 151 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9584 | 1 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9744 | 2 | 76 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9686 | 2 | 74 | 3.10.20.30 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9669 | 84 | 151 | 1.10.150.120 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.963 | 2 | 76 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9567 | 1 | 76 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A095WSE8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9931 | 4 | 152 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2V9I141-F1-model_v4 | (2Fe-2S)-binding protein | 0.9926 | 4 | 114 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7X0JUW7-F1-model_v4 | Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) | 0.9919 | 2 | 151 |
GO:0046872
GO:0047121 GO:0051537 |
| AF-A0A1H0H0N4-F1-model_v4 | Isoquinoline 1-oxidoreductase, alpha subunit | 0.9917 | 4 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A349TGJ4-F1-model_v4 | (2Fe-2S)-binding protein | 0.9916 | 2 | 142 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar