F474242

General Info

Members Datasets Scaffolds Average Seq Length
672 371 672 154

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0010104|Ga0373934_0010104_2543_3088
Length 181
Sequence MRTFKSRAVFKERGTNNPQAISARAPNEGEVLMTTVAFTINGKPASVEADAETPLLWIVREHLKLTGTKFGCGAGLCGACTVHIDGKAVRSCQTQLSDVANKKVTTIEGLSPSSNHPLQKAWVAMQVPQCGYCQSGQIMQAAELLAKNPKPTREQIVAHMDGNICRCGTYSEIIAAIQSVA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
99 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
317 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 0.15
Rhizoplane 4.76
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10128726 3300003373 Bacteria 623
2 JGI25404J52841_10016510 3300003659 Bacteria 1601
3 Ga0065704_10785888 3300005289 Bacteria 530
4 Ga0070690_100006106 3300005330 Bacteria 6818
5 Ga0070677_10374496 3300005333 Bacteria 744
6 Ga0068869_100389709 3300005334 Bacteria 1143
7 Ga0068869_100391792 3300005334 Bacteria 1141
8 Ga0068869_100440164 3300005334 Bacteria 1079
9 Ga0070666_10355014 3300005335 Bacteria 1049
10 Ga0070680_100032648 3300005336 Bacteria 4191
11 Ga0070680_100262602 3300005336 Bacteria 1461
12 Ga0070680_100624075 3300005336 Bacteria 926
13 Ga0070682_100048610 3300005337 Bacteria 2642
14 Ga0070682_100302877 3300005337 Bacteria 1174
15 Ga0070660_101419699 3300005339 Bacteria 590
16 Ga0070687_100126458 3300005343 Bacteria 1470
17 Ga0070687_100342959 3300005343 Bacteria 962
18 Ga0070661_100020373 3300005344 Bacteria 4728
19 Ga0070692_10090294 3300005345 Bacteria 1664
20 Ga0070668_100519804 3300005347 Bacteria 1033
21 Ga0070668_100654926 3300005347 Bacteria 923
22 Ga0070669_100022862 3300005353 Bacteria 4472
23 Ga0070675_100183795 3300005354 Bacteria 1808
24 Ga0070675_100612894 3300005354 Bacteria 988
25 Ga0070671_100008579 3300005355 Bacteria 8192
26 Ga0070671_100025538 3300005355 Bacteria 4848
27 Ga0070674_100227535 3300005356 Bacteria 1454
28 Ga0070674_101144444 3300005356 Bacteria 689
29 Ga0070674_102000651 3300005356 Bacteria 527
30 Ga0070673_100226801 3300005364 Bacteria 1619
31 Ga0070673_100342201 3300005364 Bacteria 1326
32 Ga0070673_100356908 3300005364 Bacteria 1299
33 Ga0070673_100397972 3300005364 Bacteria 1231
34 Ga0070688_100029086 3300005365 Bacteria 3305
35 Ga0070688_100805501 3300005365 Bacteria 735
36 Ga0070667_100027878 3300005367 Bacteria 4700
37 Ga0070709_10043323 3300005434 Bacteria 2783
38 Ga0070714_100123387 3300005435 Bacteria 2307
39 Ga0070714_100175915 3300005435 Bacteria 1945
40 Ga0070714_100409051 3300005435 Bacteria 1284
41 Ga0070714_102161638 3300005435 Bacteria 542
42 Ga0070713_100009021 3300005436 Bacteria 7109
43 Ga0070713_100040579 3300005436 Bacteria 3785
44 Ga0070705_100073272 3300005440 Bacteria 2077
45 Ga0070705_100115431 3300005440 Bacteria 1724
46 Ga0070705_100290007 3300005440 Bacteria 1168
47 Ga0070705_100453974 3300005440 Bacteria 962
48 Ga0070700_100013138 3300005441 Bacteria 4645
49 Ga0070700_100194672 3300005441 Bacteria 1420
50 Ga0070700_100615643 3300005441 Bacteria 853
51 Ga0070700_100711916 3300005441 Bacteria 799
52 Ga0070694_100003882 3300005444 Bacteria 8935
53 Ga0070694_100719311 3300005444 Bacteria 813
54 Ga0070708_100188446 3300005445 Bacteria 1929
55 Ga0070708_100419022 3300005445 Bacteria 1263
56 Ga0070678_100049153 3300005456 Bacteria 3042
57 Ga0070678_100342618 3300005456 Bacteria 1283
58 Ga0070681_10133520 3300005458 Bacteria 2413
59 Ga0070681_10427378 3300005458 Bacteria 1237
60 Ga0070681_10814770 3300005458 Bacteria 851
61 Ga0068867_100017351 3300005459 Bacteria 5113
62 Ga0070685_10202602 3300005466 Bacteria 1291
63 Ga0070706_100622432 3300005467 Bacteria 1002
64 Ga0070707_100018789 3300005468 Bacteria 6508
65 Ga0070699_100120113 3300005518 Bacteria 2310
66 Ga0070679_100186952 3300005530 Bacteria 2042
67 Ga0070672_100260719 3300005543 Bacteria 1462
68 Ga0070672_100384043 3300005543 Bacteria 1201
69 Ga0070672_100895312 3300005543 Bacteria 784
70 Ga0070686_100027561 3300005544 Bacteria 3439
71 Ga0070686_100142741 3300005544 Bacteria 1668
72 Ga0070686_101258202 3300005544 Bacteria 617
73 Ga0070695_100015436 3300005545 Bacteria 4613
74 Ga0070695_100145469 3300005545 Bacteria 1648
75 Ga0070696_100029970 3300005546 Bacteria 3722
76 Ga0070696_100038929 3300005546 Bacteria 3283
77 Ga0070696_100665171 3300005546 Bacteria 846
78 Ga0070696_100831509 3300005546 Bacteria 762
79 Ga0070693_100201773 3300005547 Bacteria 1292
80 Ga0070665_100974124 3300005548 Bacteria 860
81 Ga0070665_101824417 3300005548 Bacteria 614
82 Ga0070704_100016121 3300005549 Bacteria 4714
83 Ga0070704_100418576 3300005549 Bacteria 1147
84 Ga0068855_100977352 3300005563 Bacteria 891
85 Ga0068857_100248290 3300005577 Bacteria 1631
86 Ga0068857_100377497 3300005577 Bacteria 1316
87 Ga0068856_100082302 3300005614 Bacteria 3194
88 Ga0070702_100027865 3300005615 Bacteria 3054
89 Ga0070702_100144172 3300005615 Bacteria 1521
90 Ga0070702_100151106 3300005615 Bacteria 1491
91 Ga0068852_100858171 3300005616 Bacteria 924
92 Ga0068859_100905611 3300005617 Bacteria 966
93 Ga0068859_100978902 3300005617 Bacteria 928
94 Ga0068859_101608328 3300005617 Bacteria 718
95 Ga0068864_100429786 3300005618 Bacteria 1260
96 Ga0068864_100717558 3300005618 Bacteria 978
97 Ga0068866_10011993 3300005718 Bacteria 3768
98 Ga0068866_10425324 3300005718 Bacteria 863
99 Ga0068861_100340354 3300005719 Bacteria 1313
100 Ga0068861_100438187 3300005719 Bacteria 1168
101 Ga0068861_100479378 3300005719 Bacteria 1120
102 Ga0068861_101432359 3300005719 Bacteria 676
103 Ga0068870_10308294 3300005840 Bacteria 1002
104 Ga0068863_100210284 3300005841 Bacteria 1873
105 Ga0068863_101236766 3300005841 Bacteria 753
106 Ga0068858_100072052 3300005842 Bacteria 3205
107 Ga0068858_100190310 3300005842 Bacteria 1939
108 Ga0068860_100079095 3300005843 Bacteria 3126
109 Ga0068860_100117945 3300005843 Bacteria 2540
110 Ga0068860_100190478 3300005843 Bacteria 1985
111 Ga0068860_100785953 3300005843 Bacteria 965
112 Ga0068860_101594448 3300005843 Bacteria 675
113 Ga0068862_100018505 3300005844 Bacteria 5802
114 Ga0068862_100030714 3300005844 Bacteria 4529
115 Ga0068862_101540753 3300005844 Bacteria 671
116 Ga0081455_10036231 3300005937 Bacteria 4397
117 Ga0081455_10107400 3300005937 Bacteria 2225
118 Ga0081538_10176651 3300005981 Bacteria 921
119 Ga0081538_10181416 3300005981 Bacteria 900
120 Ga0081540_1006133 3300005983 Bacteria 8828
121 Ga0081539_10026344 3300005985 Bacteria 3712
122 Ga0081539_10269674 3300005985 Bacteria 746
123 Ga0070717_10287787 3300006028 Bacteria 1458
124 Ga0070717_10304245 3300006028 Bacteria 1418
125 Ga0070717_10353656 3300006028 Bacteria 1314
126 Ga0075368_10371382 3300006042 Bacteria 625
127 Ga0075363_100081654 3300006048 Bacteria 1768
128 Ga0075363_100304863 3300006048 Bacteria 925
129 Ga0075364_10052349 3300006051 Bacteria 2667
130 Ga0075364_10336997 3300006051 Bacteria 1028
131 Ga0075364_10343313 3300006051 Bacteria 1017
132 Ga0075432_10206958 3300006058 Bacteria 779
133 Ga0070716_101562941 3300006173 Bacteria 541
134 Ga0070712_100045103 3300006175 Bacteria 3042
135 Ga0070712_100454882 3300006175 Bacteria 1067
136 Ga0075362_10077944 3300006177 Bacteria 1523
137 Ga0075369_10109332 3300006186 Bacteria 1245
138 Ga0075366_10016671 3300006195 Bacteria 4223
139 Ga0075366_10457563 3300006195 Bacteria 787
140 Ga0097621_100004686 3300006237 Bacteria 9551
141 Ga0097621_100034588 3300006237 Bacteria 4032
142 Ga0097621_100230113 3300006237 Bacteria 1618
143 Ga0097621_100287900 3300006237 Bacteria 1448
144 Ga0097621_100336478 3300006237 Bacteria 1340
145 Ga0075370_10158882 3300006353 Bacteria 1326
146 Ga0075370_10253411 3300006353 Bacteria 1043
147 Ga0068871_100013670 3300006358 Bacteria 6031
148 Ga0068871_100074445 3300006358 Bacteria 2801
149 Ga0068871_100996774 3300006358 Bacteria 780
150 Ga0075428_100753775 3300006844 Bacteria 1036
151 Ga0075428_100760842 3300006844 Bacteria 1030
152 Ga0075430_100091457 3300006846 Bacteria 2544
153 Ga0075431_100082951 3300006847 Bacteria 3309
154 Ga0075431_100748334 3300006847 Bacteria 953
155 Ga0075433_10094261 3300006852 Bacteria 2649
156 Ga0075434_100051055 3300006871 Bacteria 4108
157 Ga0075434_100204221 3300006871 Bacteria 1996
158 Ga0068865_100321596 3300006881 Bacteria 1245
159 Ga0068865_101101125 3300006881 Bacteria 699
160 Ga0068865_101172128 3300006881 Bacteria 679
161 Ga0097620_100905567 3300006931 Bacteria 966
162 Ga0097620_100978924 3300006931 Bacteria 928
163 Ga0097620_101608286 3300006931 Bacteria 718
164 Ga0075435_100439953 3300007076 Bacteria 1124
165 Ga0075435_100486238 3300007076 Bacteria 1066
166 Ga0075435_101121401 3300007076 Bacteria 688
167 Ga0075435_101631938 3300007076 Bacteria 566
168 Ga0099795_10024280 3300007788 Bacteria 2020
169 Ga0111539_10029898 3300009094 Bacteria 6627
170 Ga0111539_10110001 3300009094 Bacteria 3233
171 Ga0111539_10425782 3300009094 Bacteria 1546
172 Ga0111539_10615131 3300009094 Bacteria 1265
173 Ga0111539_10737742 3300009094 Bacteria 1146
174 Ga0105245_10156120 3300009098 Bacteria 2161
175 Ga0105245_12674415 3300009098 Bacteria 552
176 Ga0105247_10167208 3300009101 Bacteria 1460
177 Ga0105247_10203139 3300009101 Bacteria 1333
178 Ga0114129_10049013 3300009147 Bacteria 5937
179 Ga0114129_10188585 3300009147 Bacteria 2801
180 Ga0114129_10530805 3300009147 Bacteria 1533
181 Ga0114129_11575763 3300009147 Bacteria 805
182 Ga0105243_10456059 3300009148 Bacteria 1201
183 Ga0105243_10601797 3300009148 Bacteria 1058
184 Ga0105243_11195999 3300009148 Bacteria 773
185 Ga0105241_10086385 3300009174 Bacteria 2467
186 Ga0105241_10089297 3300009174 Bacteria 2428
187 Ga0105242_11150771 3300009176 Bacteria 792
188 Ga0105248_10055417 3300009177 Bacteria 4446
189 Ga0105248_10243440 3300009177 Bacteria 2025
190 Ga0105237_10033765 3300009545 Bacteria 5183
191 Ga0105237_10196848 3300009545 Bacteria 2015
192 Ga0105237_11691072 3300009545 Bacteria 640
193 Ga0105238_10428155 3300009551 Bacteria 1319
194 Ga0105238_11087630 3300009551 Bacteria 822
195 Ga0105249_10043312 3300009553 Bacteria 4094
196 Ga0105249_10063052 3300009553 Bacteria 3404
197 Ga0105249_10246742 3300009553 Bacteria 1768
198 Ga0105249_10344694 3300009553 Bacteria 1508
199 Ga0099796_10083378 3300010159 Bacteria 1176
200 Ga0105239_10357835 3300010375 Bacteria 1648
201 Ga0105246_10105421 3300011119 Bacteria 2060
202 Ga0105246_10878079 3300011119 Bacteria 802
203 Ga0157322_1045631 3300012490 Bacteria 518
204 Ga0157326_1000011 3300012513 Bacteria 16319
205 Ga0157371_10299086 3300013102 Bacteria 1165
206 Ga0157374_10032393 3300013296 Bacteria 4759
207 Ga0157378_10027853 3300013297 Bacteria 4983
208 Ga0157378_10109439 3300013297 Bacteria 2531
209 Ga0157378_10692996 3300013297 Bacteria 1037
210 Ga0157378_10947184 3300013297 Bacteria 893
211 Ga0157378_11716754 3300013297 Bacteria 675
212 Ga0163162_10412216 3300013306 Bacteria 1483
213 Ga0157375_10620436 3300013308 Bacteria 1239
214 Ga0163163_10103638 3300014325 Bacteria 2870
215 Ga0163163_10229684 3300014325 Bacteria 1905
216 Ga0157380_10854994 3300014326 Bacteria 932
217 Ga0157377_10145134 3300014745 Bacteria 1462
218 Ga0157377_10189293 3300014745 Bacteria 1299
219 Ga0157379_10199129 3300014968 Bacteria 1811
220 Ga0157379_10346010 3300014968 Bacteria 1360
221 Ga0157379_10857811 3300014968 Bacteria 860
222 Ga0157379_11097995 3300014968 Bacteria 762
223 Ga0157376_10191352 3300014969 Bacteria 1876
224 Ga0157376_10266040 3300014969 Bacteria 1608
225 Ga0157376_10816670 3300014969 Bacteria 946
226 Ga0163161_10013562 3300017792 Bacteria 5674
227 Ga0213876_10116268 3300021384 Bacteria 1419
228 Ga0207653_10018191 3300025885 Bacteria 2213
229 Ga0207682_10020194 3300025893 Bacteria 2614
230 Ga0207642_10005153 3300025899 Bacteria 4253
231 Ga0207642_10027764 3300025899 Bacteria 2321
232 Ga0207642_10828535 3300025899 Bacteria 590
233 Ga0207710_10093440 3300025900 Bacteria 1411
234 Ga0207710_10398813 3300025900 Bacteria 706
235 Ga0207680_10126377 3300025903 Bacteria 1679
236 Ga0207685_10004676 3300025905 Bacteria 3516
237 Ga0207699_10797621 3300025906 Bacteria 694
238 Ga0207645_10043281 3300025907 Bacteria 2882
239 Ga0207645_10052237 3300025907 Bacteria 2612
240 Ga0207645_11053462 3300025907 Bacteria 550
241 Ga0207643_10005479 3300025908 Bacteria 6786
242 Ga0207684_10092822 3300025910 Bacteria 2573
243 Ga0207654_10112255 3300025911 Bacteria 1698
244 Ga0207654_10322068 3300025911 Bacteria 1057
245 Ga0207707_10157578 3300025912 Bacteria 1985
246 Ga0207707_10171922 3300025912 Bacteria 1893
247 Ga0207671_10127053 3300025914 Bacteria 1954
248 Ga0207693_10032967 3300025915 Bacteria 4088
249 Ga0207693_10906886 3300025915 Bacteria 676
250 Ga0207663_10334983 3300025916 Bacteria 1141
251 Ga0207660_10036634 3300025917 Bacteria 3411
252 Ga0207660_10105982 3300025917 Bacteria 2107
253 Ga0207660_10157734 3300025917 Bacteria 1748
254 Ga0207660_10256230 3300025917 Bacteria 1382
255 Ga0207662_10104710 3300025918 Bacteria 1757
256 Ga0207662_10120656 3300025918 Bacteria 1644
257 Ga0207657_10061677 3300025919 Bacteria 3213
258 Ga0207649_10080347 3300025920 Bacteria 2108
259 Ga0207652_10627665 3300025921 Bacteria 962
260 Ga0207646_10040306 3300025922 Bacteria 4200
261 Ga0207681_10028116 3300025923 Bacteria 3641
262 Ga0207681_10122467 3300025923 Bacteria 1909
263 Ga0207681_11101096 3300025923 Bacteria 667
264 Ga0207694_10296906 3300025924 Bacteria 1330
265 Ga0207694_10412054 3300025924 Bacteria 1125
266 Ga0207694_11558802 3300025924 Bacteria 557
267 Ga0207650_10170269 3300025925 Bacteria 1730
268 Ga0207659_10048920 3300025926 Bacteria 2997
269 Ga0207687_10046586 3300025927 Bacteria 3002
270 Ga0207700_10116224 3300025928 Bacteria 2161
271 Ga0207664_10105470 3300025929 Bacteria 2335
272 Ga0207644_10244927 3300025931 Bacteria 1428
273 Ga0207644_11529297 3300025931 Bacteria 560
274 Ga0207690_10071928 3300025932 Bacteria 2387
275 Ga0207706_10028029 3300025933 Bacteria 5032
276 Ga0207709_10098762 3300025935 Bacteria 1926
277 Ga0207709_10415542 3300025935 Bacteria 1032
278 Ga0207670_10096618 3300025936 Bacteria 2101
279 Ga0207670_10259347 3300025936 Bacteria 1347
280 Ga0207670_10595100 3300025936 Bacteria 908
281 Ga0207669_10078957 3300025937 Bacteria 2099
282 Ga0207669_10146882 3300025937 Bacteria 1645
283 Ga0207669_10447434 3300025937 Bacteria 1023
284 Ga0207704_10033814 3300025938 Bacteria 2911
285 Ga0207704_10261039 3300025938 Bacteria 1306
286 Ga0207704_10477024 3300025938 Bacteria 1001
287 Ga0207704_10650780 3300025938 Bacteria 868
288 Ga0207665_10410718 3300025939 Bacteria 1032
289 Ga0207691_10061457 3300025940 Bacteria 3412
290 Ga0207691_10702797 3300025940 Bacteria 853
291 Ga0207691_10781744 3300025940 Bacteria 803
292 Ga0207711_10044988 3300025941 Bacteria 3771
293 Ga0207711_11796824 3300025941 Bacteria 556
294 Ga0207689_10268154 3300025942 Bacteria 1413
295 Ga0207689_10835276 3300025942 Bacteria 777
296 Ga0207661_10038807 3300025944 Bacteria 3735
297 Ga0207679_10595961 3300025945 Bacteria 995
298 Ga0207667_10118586 3300025949 Bacteria 2727
299 Ga0207651_10524397 3300025960 Bacteria 1027
300 Ga0207651_10659154 3300025960 Bacteria 919
301 Ga0207651_10992272 3300025960 Bacteria 750
302 Ga0207712_10032388 3300025961 Bacteria 3528
303 Ga0207712_10148088 3300025961 Bacteria 1810
304 Ga0207712_10441397 3300025961 Bacteria 1102
305 Ga0207668_10045719 3300025972 Bacteria 2987
306 Ga0207677_10947889 3300026023 Bacteria 778
307 Ga0207703_10083819 3300026035 Bacteria 2664
308 Ga0207639_10219061 3300026041 Bacteria 1643
309 Ga0207678_10019487 3300026067 Bacteria 5960
310 Ga0207708_10045668 3300026075 Bacteria 3338
311 Ga0207708_10432756 3300026075 Bacteria 1093
312 Ga0207708_10432984 3300026075 Bacteria 1092
313 Ga0207708_10532312 3300026075 Bacteria 989
314 Ga0207708_10612094 3300026075 Bacteria 924
315 Ga0207641_10051878 3300026088 Bacteria 3473
316 Ga0207641_10205364 3300026088 Bacteria 1819
317 Ga0207641_11862653 3300026088 Bacteria 603
318 Ga0207648_10001980 3300026089 Bacteria 22369
319 Ga0207648_10058327 3300026089 Bacteria 3367
320 Ga0207676_10175290 3300026095 Bacteria 1872
321 Ga0207676_12015047 3300026095 Bacteria 576
322 Ga0207674_10449795 3300026116 Bacteria 1245
323 Ga0207674_10835889 3300026116 Bacteria 888
324 Ga0207675_100044837 3300026118 Bacteria 4132
325 Ga0207675_100101000 3300026118 Bacteria 2717
326 Ga0207675_100301871 3300026118 Bacteria 1560
327 Ga0207683_10008812 3300026121 Bacteria 8610
328 Ga0207683_10288639 3300026121 Bacteria 1500
329 Ga0209281_1000355 3300027111 Bacteria 75566
330 Ga0209969_1003462 3300027360 Bacteria 2188
331 Ga0209967_1000380 3300027364 Bacteria 5865
332 Ga0209981_1000383 3300027378 Bacteria 5650
333 Ga0209996_1002235 3300027395 Bacteria 2389
334 Ga0210000_1000816 3300027462 Bacteria 4317
335 Ga0210000_1015477 3300027462 Bacteria 1148
336 Ga0209995_1001625 3300027471 Bacteria 3491
337 Ga0209968_1001752 3300027526 Bacteria 3288
338 Ga0209999_1000730 3300027543 Bacteria 5340
339 Ga0209971_1103681 3300027682 Bacteria 697
340 Ga0209966_1029280 3300027695 Bacteria 1109
341 Ga0268266_10166657 3300028379 Bacteria 1996
342 Ga0268266_11297671 3300028379 Bacteria 703
343 Ga0268265_10199458 3300028380 Bacteria 1735
344 Ga0268265_10359437 3300028380 Bacteria 1332
345 Ga0268265_10436948 3300028380 Bacteria 1219
346 Ga0268264_10249852 3300028381 Bacteria 1647
347 Ga0268264_10333309 3300028381 Bacteria 1439
348 Ga0268264_11853455 3300028381 Bacteria 613
349 Ga0265338_10017679 3300028800 Bacteria 7670
350 Ga0265762_1019361 3300030760 Bacteria 1246
351 Ga0265760_10367073 3300031090 Bacteria 517
352 Ga0265340_10001287 3300031247 Bacteria 14395
353 Ga0265339_10018854 3300031249 Bacteria 4060
354 Ga0265331_10073469 3300031250 Bacteria 1597
355 Ga0265316_10441418 3300031344 Bacteria 934
356 Ga0265316_10524620 3300031344 Bacteria 844
357 Ga0307408_101542368 3300031548 Bacteria 629
358 Ga0265314_10004756 3300031711 Bacteria 12441
359 Ga0265314_10042452 3300031711 Bacteria 3244
360 Ga0265342_10000109 3300031712 Bacteria 91321
361 Ga0307405_10089397 3300031731 Bacteria 2035
362 Ga0307405_11083172 3300031731 Bacteria 688
363 Ga0307410_11251882 3300031852 Bacteria 648
364 Ga0307406_10794605 3300031901 Bacteria 798
365 Ga0307407_10568972 3300031903 Bacteria 840
366 Ga0307407_10652696 3300031903 Bacteria 788
367 Ga0307407_10770593 3300031903 Bacteria 730
368 Ga0307412_10329375 3300031911 Bacteria 1218
369 Ga0307412_10507456 3300031911 Bacteria 1005
370 Ga0307416_100035032 3300032002 Bacteria 3828
371 Ga0307411_11682142 3300032005 Bacteria 587
372 Ga0307415_101267430 3300032126 Bacteria 697
373 Ga0307415_101385364 3300032126 Bacteria 669
374 Ga0373948_0005827 3300034817 Bacteria 2013
375 Ga0373948_0024118 3300034817 Bacteria 1185
376 Ga0373950_0113986 3300034818 Bacteria 593
377 Ga0373958_0009143 3300034819 Bacteria 1624
378 Ga0373958_0022336 3300034819 Bacteria 1181
379 Ga0373959_0133529 3300034820 Bacteria 616
380 Ga0373938_0016063 3300034957 Bacteria 1458
381 Ga0373938_0020622 3300034957 Bacteria 1329
382 Ga0373928_0053499 3300035084 Bacteria 959
383 Ga0373928_0154603 3300035084 Bacteria 637
384 Ga0373929_0043265 3300035085 Bacteria 1007
385 Ga0373929_0058729 3300035085 Bacteria 896
386 Ga0373934_0006061 3300035086 Bacteria 4475
387 Ga0373934_0010104 3300035086 Bacteria 3544
388 Ga0373940_0066491 3300035088 Bacteria 1042
389 Ga0373940_0214361 3300035088 Bacteria 637
390 Ga0373944_0071143 3300035089 Bacteria 1133
391 Ga0373951_0015760 3300035091 Bacteria 1704
392 Ga0373952_0027214 3300035092 Bacteria 1247
393 Ga0373932_0042735 3300035112 Bacteria 1315
394 Ga0373932_0359426 3300035112 Bacteria 555
395 Ga0373936_0023451 3300035113 Bacteria 2405
396 Ga0373941_0007309 3300035115 Bacteria 2699
397 Ga0373941_0034247 3300035115 Bacteria 1531
398 Ga0373941_0107943 3300035115 Bacteria 977
399 Ga0373941_0216671 3300035115 Bacteria 734
400 Ga0373945_0012898 3300035116 Bacteria 2783
401 Ga0373953_0009761 3300035117 Bacteria 3317
402 Ga0373953_0369930 3300035117 Bacteria 629
403 Ga0373954_0088618 3300035118 Bacteria 1484
404 Ga0373956_0004855 3300035119 Bacteria 5384
405 Ga0373957_0000553 3300035120 Bacteria 9493
406 Ga0373957_0008590 3300035120 Bacteria 3316
407 Ga0373960_0077047 3300035121 Bacteria 1042
408 Ga0373943_0012783 3300035170 Bacteria 3784
409 Ga0373943_0027681 3300035170 Bacteria 2665
410 Ga0373946_0048763 3300035171 Bacteria 1764
411 Ga0373955_0029726 3300035172 Bacteria 2845
412 Ga0373955_0053891 3300035172 Bacteria 2197
413 Ga0373955_0063123 3300035172 Bacteria 2050
414 Ga0373942_0073592 3300035207 Bacteria 1002
415 Ga0373962_0003240 3300035242 Bacteria 3911
416 Ga0373962_0044643 3300035242 Bacteria 1259
417 Ga0373962_0084713 3300035242 Bacteria 968
418 Ga0373924_0047785 3300035410 Bacteria 1766
419 Ga0373924_0062531 3300035410 Bacteria 1559
420 Ga0373931_0000460 3300035691 Bacteria 16703
421 Ga0373931_0012343 3300035691 Bacteria 4138
422 Ga0373931_0034279 3300035691 Bacteria 2634
423 Ga0373931_0054787 3300035691 Bacteria 2132
424 Ga0373931_0114727 3300035691 Bacteria 1533
425 Ga0373931_0208677 3300035691 Bacteria 1170
426 Ga0373935_0018456 3300035692 Bacteria 4242
427 Ga0373935_0125527 3300035692 Bacteria 1719
428 Ga0373927_0029458 3300035695 Bacteria 3578
429 Ga0373927_0227446 3300035695 Bacteria 1225
430 Ga0373933_0009065 3300035724 Bacteria 5430
431 Ga0373933_0027005 3300035724 Bacteria 3302
432 Ga0373947_0016022 3300035725 Bacteria 4307
433 Ga0373947_0103560 3300035725 Bacteria 1791
434 Ga0373937_0003814 3300036401 Bacteria 12735
435 Ga0373937_0009081 3300036401 Bacteria 8629
436 Ga0373937_0629237 3300036401 Bacteria 1018
437 Ga0373925_0147391 3300037068 Bacteria 1845
438 Ga0373925_0496729 3300037068 Bacteria 1001
439 Ga0373925_0529298 3300037068 Bacteria 969
440 Ga0373925_0568910 3300037068 Bacteria 932
441 Ga0395900_1296940 3300037418 Bacteria 642
442 Ga0395905_0878070 3300037471 Bacteria 800
443 Ga0242420_047095 3300038996 Bacteria 835
444 Ga0436365_1074131 3300039437 Bacteria 1903
445 Ga0439451_086549 3300042009 Bacteria 631
446 Ga0439456_087818 3300042013 Bacteria 697
447 Ga0450923_036570 3300042125 Bacteria 1019
448 Ga0451577_0915903 3300042876 Bacteria 789
449 Ga0453684_0237254 3300044712 Bacteria 2102
450 Ga0453684_0599124 3300044712 Bacteria 1208
451 Ga0453684_1461151 3300044712 Bacteria 707
452 Ga0495592_0002605 3300046454 Bacteria 12748
453 Ga0495592_0137747 3300046454 Bacteria 1700
454 Ga0495603_0024250 3300046455 Bacteria 3668
455 Ga0495603_0065539 3300046455 Bacteria 2141
456 Ga0495603_0120832 3300046455 Bacteria 1526
457 Ga0495629_0038051 3300046459 Bacteria 3390
458 Ga0495629_0049097 3300046459 Bacteria 2958
459 Ga0495629_0269233 3300046459 Bacteria 1170
460 Ga0495641_0014791 3300046461 Bacteria 4206
461 Ga0495651_0001716 3300046462 Bacteria 16939
462 Ga0495651_0002360 3300046462 Bacteria 14581
463 Ga0495653_0002378 3300046463 Bacteria 14963
464 Ga0495653_0018310 3300046463 Bacteria 5691
465 Ga0495580_0077236 3300046472 Bacteria 2322
466 Ga0495582_0349506 3300046473 Bacteria 851
467 Ga0495639_0009155 3300046475 Bacteria 4244
468 Ga0495662_0016267 3300046476 Bacteria 3605
469 Ga0495662_0047410 3300046476 Bacteria 2074
470 Ga0495664_0022046 3300046477 Bacteria 3685
471 Ga0495664_0276060 3300046477 Bacteria 1015
472 Ga0495584_0330817 3300046491 Bacteria 774
473 Ga0495594_0008651 3300046499 Bacteria 5245
474 Ga0495594_0232640 3300046499 Bacteria 1050
475 Ga0495607_0009217 3300046501 Bacteria 6706
476 Ga0495608_0092397 3300046511 Bacteria 1956
477 Ga0495608_0118096 3300046511 Bacteria 1701
478 Ga0495618_0002901 3300046514 Bacteria 10852
479 Ga0495618_0004476 3300046514 Bacteria 8591
480 Ga0495628_0008038 3300046516 Bacteria 9082
481 Ga0495628_0137068 3300046516 Bacteria 1869
482 Ga0495648_0197556 3300046524 Bacteria 1010
483 Ga0495652_0003013 3300046529 Bacteria 16901
484 Ga0495652_0076968 3300046529 Bacteria 2766
485 Ga0495665_0079677 3300046531 Bacteria 1723
486 Ga0495640_0032361 3300046533 Bacteria 3725
487 Ga0495640_0085749 3300046533 Bacteria 2086
488 Ga0495586_0021826 3300046535 Bacteria 3416
489 Ga0495587_0001264 3300046536 Bacteria 16814
490 Ga0495587_0004244 3300046536 Bacteria 9475
491 Ga0495598_0158798 3300046537 Bacteria 794
492 Ga0495609_0009437 3300046538 Bacteria 4721
493 Ga0495621_0051166 3300046539 Bacteria 1478
494 Ga0495645_0008282 3300046543 Bacteria 7253
495 Ga0495645_0011818 3300046543 Bacteria 6152
496 Ga0495622_0299079 3300046557 Bacteria 701
497 Ga0495633_0002046 3300046558 Bacteria 14548
498 Ga0495667_0000399 3300046559 Bacteria 27814
499 Ga0495667_0003782 3300046559 Bacteria 10163
500 Ga0495667_0049529 3300046559 Bacteria 2773
501 Ga0495656_0134506 3300046615 Bacteria 1180
502 Ga0495634_0024003 3300046642 Bacteria 4282
503 Ga0495634_0029340 3300046642 Bacteria 3808
504 Ga0495634_0038969 3300046642 Bacteria 3238
505 Ga0495611_0005086 3300046648 Bacteria 5637
506 Ga0495625_0371188 3300046660 Bacteria 900
507 Ga0495635_0008931 3300046663 Bacteria 6994
508 Ga0495661_0052373 3300046665 Bacteria 2460
509 Ga0495588_0002506 3300046674 Bacteria 7866
510 Ga0495588_0233645 3300046674 Bacteria 970
511 Ga0495657_0001799 3300046675 Bacteria 18356
512 Ga0495657_0035957 3300046675 Bacteria 3428
513 Ga0495599_0005718 3300046678 Bacteria 7458
514 Ga0495599_0010464 3300046678 Bacteria 5675
515 Ga0495623_0014717 3300046679 Bacteria 5058
516 Ga0495623_0028719 3300046679 Bacteria 3578
517 Ga0495646_0005564 3300046680 Bacteria 7971
518 Ga0495646_0014811 3300046680 Bacteria 4956
519 Ga0495646_0022469 3300046680 Bacteria 3979
520 Ga0495669_0080402 3300046684 Bacteria 1495
521 Ga0495613_0072048 3300046689 Bacteria 2518
522 Ga0495624_0138856 3300046690 Bacteria 1489
523 Ga0495600_0001408 3300046809 Bacteria 13272
524 Ga0495600_0004886 3300046809 Bacteria 8051
525 Ga0495600_0327237 3300046809 Bacteria 963
526 Ga0495581_0055099 3300047315 Bacteria 2295
527 Ga0495581_0096108 3300047315 Bacteria 1720
528 Ga0495581_0230185 3300047315 Bacteria 1084
529 Ga0495604_0002929 3300047317 Bacteria 13669
530 Ga0495604_0106800 3300047317 Bacteria 2047
531 Ga0495636_0263674 3300047318 Bacteria 799
532 Ga0495636_0366164 3300047318 Bacteria 682
533 Ga0495674_0004957 3300047319 Bacteria 12807
534 Ga0495674_0052759 3300047319 Bacteria 3576
535 Ga0495674_0071452 3300047319 Bacteria 2995
536 Ga0495680_0001112 3300047322 Bacteria 29712
537 Ga0495680_0007442 3300047322 Bacteria 10037
538 Ga0495675_0001163 3300047444 Bacteria 15971
539 Ga0495675_0001604 3300047444 Bacteria 13592
540 Ga0495679_020259 3300047446 Bacteria 2319
541 Ga0495684_0012837 3300047471 Bacteria 6466
542 Ga0495684_0051773 3300047471 Bacteria 3133
543 Ga0495593_0030114 3300047673 Bacteria 2972
544 Ga0495602_0001583 3300048088 Bacteria 22640
545 Ga0495602_0023384 3300048088 Bacteria 6022
546 Ga0495614_0142563 3300048089 Bacteria 1065
547 Ga0496100_0502118 3300048903 Bacteria 934
548 Ga0496101_0024345 3300048904 Bacteria 4189
549 Ga0496101_0248886 3300048904 Bacteria 1384
550 Ga0496102_0019387 3300048905 Bacteria 5991
551 Ga0496102_0470386 3300048905 Bacteria 1178
552 Ga0496103_0077901 3300048906 Bacteria 2082
553 Ga0496104_0030009 3300048907 Bacteria 5049
554 Ga0496104_0453429 3300048907 Bacteria 1194
555 Ga0496105_0028251 3300048908 Bacteria 4588
556 Ga0496105_0723954 3300048908 Bacteria 762
557 Ga0496106_0081601 3300048909 Bacteria 2484
558 Ga0496106_0197408 3300048909 Bacteria 1601
559 Ga0496107_0101059 3300048910 Bacteria 2114
560 Ga0496107_0363311 3300048910 Bacteria 1077
561 Ga0496107_0681911 3300048910 Bacteria 756
562 Ga0496109_0174191 3300048912 Bacteria 2019
563 Ga0496109_0272893 3300048912 Bacteria 1594
564 Ga0496110_0146876 3300048913 Bacteria 2133
565 Ga0496110_0336062 3300048913 Bacteria 1376
566 Ga0496110_0628378 3300048913 Bacteria 973
567 Ga0496111_0214600 3300048914 Bacteria 1429
568 Ga0496111_0471961 3300048914 Bacteria 925
569 Ga0496112_0085280 3300048915 Bacteria 3125
570 Ga0496112_0271320 3300048915 Bacteria 1645
571 Ga0496112_0341494 3300048915 Bacteria 1441
572 Ga0496113_0035614 3300048916 Bacteria 3641
573 Ga0496114_0013459 3300048917 Bacteria 6559
574 Ga0496114_0062312 3300048917 Bacteria 3121
575 Ga0496114_1733281 3300048917 Bacteria 513
576 Ga0496115_0042463 3300048918 Bacteria 3622
577 Ga0496115_0080953 3300048918 Bacteria 2644
578 Ga0496115_0970370 3300048918 Bacteria 651
579 Ga0496120_0094524 3300048923 Bacteria 1591
580 Ga0496121_0210301 3300048924 Bacteria 1379
581 Ga0501298_042792 3300049521 Bacteria 922
582 Ga0501299_098622 3300049522 Bacteria 675
583 Ga0501032_0832354 3300049569 Bacteria 582
584 Ga0501033_0224770 3300049570 Bacteria 1335
585 Ga0501033_0474699 3300049570 Bacteria 867
586 Ga0501034_0095341 3300049571 Bacteria 2972
587 Ga0501036_0144874 3300049572 Bacteria 2004
588 Ga0501037_0341375 3300049573 Bacteria 1034
589 Ga0501038_0156816 3300049574 Bacteria 1853
590 Ga0501038_0971669 3300049574 Bacteria 624
591 Ga0501039_0017403 3300049575 Bacteria 5513
592 Ga0501040_0022746 3300049576 Bacteria 4199
593 Ga0501040_0103324 3300049576 Bacteria 1989
594 Ga0501041_0006065 3300049577 Bacteria 7069
595 Ga0501041_0133905 3300049577 Bacteria 1544
596 Ga0501042_0208178 3300049578 Bacteria 1410
597 Ga0501042_0226997 3300049578 Bacteria 1347
598 Ga0501043_0491311 3300049579 Bacteria 918
599 Ga0501043_0669116 3300049579 Bacteria 761
600 Ga0501046_0027302 3300049580 Bacteria 4659
601 Ga0501046_0346226 3300049580 Bacteria 1079
602 Ga0501047_0068048 3300049581 Bacteria 3431
603 Ga0501048_0096880 3300049582 Bacteria 2081
604 Ga0501048_0188131 3300049582 Bacteria 1463
605 Ga0501048_0211324 3300049582 Bacteria 1376
606 Ga0501071_0742196 3300049587 Bacteria 756
607 Ga0501072_1006602 3300049588 Bacteria 649
608 Ga0501074_0435638 3300049590 Bacteria 930
609 Ga0501074_0437308 3300049590 Bacteria 928
610 Ga0501075_0041908 3300049591 Bacteria 3432
611 Ga0501076_0026896 3300049592 Bacteria 4460
612 Ga0501076_0161930 3300049592 Bacteria 1823
613 Ga0501076_0296267 3300049592 Bacteria 1326
614 Ga0501077_0016657 3300049593 Bacteria 4633
615 Ga0501079_0081315 3300049741 Bacteria 2505
616 Ga0501079_1221784 3300049741 Bacteria 592
617 Ga0501080_0696526 3300049742 Bacteria 896
618 Ga0501081_0008800 3300049743 Bacteria 6560
619 Ga0501081_0103375 3300049743 Bacteria 2016
620 Ga0501083_0778045 3300049744 Bacteria 623
621 Ga0501283_043946 3300049779 Bacteria 779
622 Ga0501035_0767972 3300049822 Bacteria 772
623 Ga0501044_0108990 3300049823 Bacteria 2779
624 Ga0501045_0047507 3300049824 Bacteria 3127
625 Ga0501045_0617821 3300049824 Bacteria 802
626 nmdc:mga03683_65702_c1 3300050489 Bacteria 1541
627 nmdc:mga03n38_264242_c1 3300050490 Bacteria 913
628 nmdc:mga03n38_91499_c1 3300050490 Bacteria 1449
629 nmdc:mga0yw44_195218_c1 3300050492 Bacteria 1336
630 nmdc:mga0yw44_667525_c1 3300050492 Bacteria 706
631 nmdc:mga0k408_134429_c1 3300050493 Bacteria 1469
632 nmdc:mga0k408_31294_c1 3300050493 Bacteria 3038
633 nmdc:mga06z11_256202_c1 3300050494 Bacteria 1031
634 nmdc:mga06z11_338928_c1 3300050494 Bacteria 899
635 nmdc:mga06z11_472306_c1 3300050494 Bacteria 759
636 nmdc:mga06z11_58079_c1 3300050494 Bacteria 2006
637 nmdc:mga07m45_230274_c1 3300050496 Bacteria 1078
638 nmdc:mga07m45_67187_c2 3300050496 Bacteria 1470
639 nmdc:mga05p37_16853_c1 3300050507 Bacteria 8809
640 nmdc:mga05p37_868586_c1 3300050507 Bacteria 977
641 nmdc:mga05p37_964886_c1 3300050507 Bacteria 910
642 nmdc:mga09592_416614_c1 3300050508 Bacteria 1161
643 nmdc:mga0qj67_10268_c1 3300050509 Bacteria 6993
644 nmdc:mga0qj67_404038_c1 3300050509 Bacteria 1102
645 nmdc:mga06r32_1212198_c1 3300050510 Bacteria 701
646 nmdc:mga06r32_91427_c1 3300050510 Bacteria 2974
647 nmdc:mga08y16_1671324_c1 3300050511 Bacteria 593
648 nmdc:mga08y16_234293_c1 3300050511 Bacteria 1898
649 nmdc:mga08y16_587966_c1 3300050511 Bacteria 1123
650 nmdc:mga08y16_79407_c1 3300050511 Bacteria 3420
651 nmdc:mga08y16_97268_c1 3300050511 Bacteria 3066
652 nmdc:mga0n895_269598_c1 3300050512 Bacteria 1727
653 nmdc:mga0n895_46102_c1 3300050512 Bacteria 4257
654 nmdc:mga0rr50_701864_c1 3300050513 Bacteria 863
655 nmdc:mga0a205_1106149_c1 3300050515 Bacteria 640
656 nmdc:mga0a205_448320_c1 3300050515 Bacteria 1151
657 nmdc:mga0sz30_47199_c1 3300050516 Bacteria 1819
658 Ga0495601_0008313 3300053077 Bacteria 6126
659 Ga0495601_0016135 3300053077 Bacteria 4522
660 Ga0495612_0001797 3300053078 Bacteria 8784
661 Ga0495595_0002645 3300053084 Bacteria 7024
662 Ga0495595_0003758 3300053084 Bacteria 6038
663 Ga0495619_0000973 3300053085 Bacteria 18754
664 Ga0495619_0004883 3300053085 Bacteria 8511
665 Ga0500593_005031 3300053117 Bacteria 5170
666 Ga0500595_034388 3300053119 Bacteria 1676
667 Ga0500645_110932 3300053730 Bacteria 769
668 Ga0501084_0406068 3300054114 Bacteria 1151
669 Ga0501084_0607172 3300054114 Bacteria 924
670 Ga0590077_067956 3300059426 Bacteria 812
671 Ga0501082_0412087 3300060353 Bacteria 1180
672 Ga0530510_0496892 3300061734 Bacteria 925

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0412087 Ga0501082_0412087_11_424 132
2 3300005719 Ga0068861_100438187 Ga0068861_1004381873 136
3 3300035207 Ga0373942_0073592 Ga0373942_0073592_34_480 148
4 3300042876 Ga0451577_0915903 Ga0451577_0915903_310_765 148
5 3300044712 Ga0453684_0599124 Ga0453684_0599124_469_924 148
6 3300044712 Ga0453684_1461151 Ga0453684_1461151_153_608 148
7 3300005335 Ga0070666_10355014 Ga0070666_103550142 149
8 3300005435 Ga0070714_100409051 Ga0070714_1004090511 149
9 3300005440 Ga0070705_100115431 Ga0070705_1001154312 149
10 3300005456 Ga0070678_100342618 Ga0070678_1003426182 149
11 3300005545 Ga0070695_100015436 Ga0070695_1000154363 149
12 3300005547 Ga0070693_100201773 Ga0070693_1002017732 149
13 3300006028 Ga0070717_10304245 Ga0070717_103042451 149
14 3300009545 Ga0105237_11691072 Ga0105237_116910721 149
15 3300012490 Ga0157322_1045631 Ga0157322_10456311 149
16 3300014968 Ga0157379_10857811 Ga0157379_108578111 149
17 3300025906 Ga0207699_10797621 Ga0207699_107976212 149
18 3300030760 Ga0265762_1019361 Ga0265762_10193612 149
19 3300031090 Ga0265760_10367073 Ga0265760_103670731 149
20 3300031247 Ga0265340_10001287 Ga0265340_100012873 149
21 3300031249 Ga0265339_10018854 Ga0265339_100188542 149
22 3300031250 Ga0265331_10073469 Ga0265331_100734692 149
23 3300031344 Ga0265316_10524620 Ga0265316_105246202 149
24 3300031711 Ga0265314_10042452 Ga0265314_100424522 149
25 3300031712 Ga0265342_10000109 Ga0265342_1000010950 149
26 3300035086 Ga0373934_0010104 Ga0373934_0010104_2543_3088 149
27 3300035112 Ga0373932_0359426 Ga0373932_0359426_30_479 149
28 3300035117 Ga0373953_0009761 Ga0373953_0009761_495_1040 149
29 3300035118 Ga0373954_0088618 Ga0373954_0088618_792_1337 149
30 3300035120 Ga0373957_0008590 Ga0373957_0008590_1171_1716 149
31 3300035170 Ga0373943_0027681 Ga0373943_0027681_1199_1744 149
32 3300035171 Ga0373946_0048763 Ga0373946_0048763_409_954 149
33 3300035172 Ga0373955_0063123 Ga0373955_0063123_1327_1872 149
34 3300035410 Ga0373924_0047785 Ga0373924_0047785_1069_1614 149
35 3300035692 Ga0373935_0125527 Ga0373935_0125527_149_694 149
36 3300035695 Ga0373927_0029458 Ga0373927_0029458_2822_3367 149
37 3300035724 Ga0373933_0027005 Ga0373933_0027005_2039_2584 149
38 3300035725 Ga0373947_0103560 Ga0373947_0103560_495_1040 149
39 3300036401 Ga0373937_0003814 Ga0373937_0003814_9887_10432 149
40 3300037068 Ga0373925_0568910 Ga0373925_0568910_190_735 149
41 3300044712 Ga0453684_0237254 Ga0453684_0237254_389_838 149
42 3300046454 Ga0495592_0002605 Ga0495592_0002605_7907_8452 149
43 3300046455 Ga0495603_0065539 Ga0495603_0065539_1281_1826 149
44 3300046459 Ga0495629_0038051 Ga0495629_0038051_500_1045 149
45 3300046462 Ga0495651_0001716 Ga0495651_0001716_12905_13450 149
46 3300046463 Ga0495653_0002378 Ga0495653_0002378_12092_12637 149
47 3300046473 Ga0495582_0349506 Ga0495582_0349506_99_548 149
48 3300046476 Ga0495662_0047410 Ga0495662_0047410_530_1075 149
49 3300046477 Ga0495664_0022046 Ga0495664_0022046_572_1117 149
50 3300046511 Ga0495608_0092397 Ga0495608_0092397_401_946 149
51 3300046514 Ga0495618_0004476 Ga0495618_0004476_3717_4262 149
52 3300046516 Ga0495628_0008038 Ga0495628_0008038_4983_5528 149
53 3300046529 Ga0495652_0003013 Ga0495652_0003013_12677_13222 149
54 3300046531 Ga0495665_0079677 Ga0495665_0079677_28_477 149
55 3300046533 Ga0495640_0032361 Ga0495640_0032361_756_1301 149
56 3300046536 Ga0495587_0004244 Ga0495587_0004244_6648_7193 149
57 3300046543 Ga0495645_0011818 Ga0495645_0011818_1092_1637 149
58 3300046559 Ga0495667_0000399 Ga0495667_0000399_9330_9875 149
59 3300046642 Ga0495634_0024003 Ga0495634_0024003_1491_2036 149
60 3300046663 Ga0495635_0008931 Ga0495635_0008931_4023_4568 149
61 3300046675 Ga0495657_0035957 Ga0495657_0035957_2352_2897 149
62 3300046678 Ga0495599_0010464 Ga0495599_0010464_3001_3546 149
63 3300046679 Ga0495623_0028719 Ga0495623_0028719_547_1092 149
64 3300046680 Ga0495646_0022469 Ga0495646_0022469_2777_3322 149
65 3300046690 Ga0495624_0138856 Ga0495624_0138856_1018_1467 149
66 3300046809 Ga0495600_0004886 Ga0495600_0004886_606_1151 149
67 3300047315 Ga0495581_0230185 Ga0495581_0230185_278_823 149
68 3300047317 Ga0495604_0106800 Ga0495604_0106800_1093_1638 149
69 3300047319 Ga0495674_0052759 Ga0495674_0052759_2219_2764 149
70 3300047322 Ga0495680_0001112 Ga0495680_0001112_2377_2922 149
71 3300047444 Ga0495675_0001163 Ga0495675_0001163_2249_2794 149
72 3300047471 Ga0495684_0012837 Ga0495684_0012837_3563_4108 149
73 3300047673 Ga0495593_0030114 Ga0495593_0030114_1904_2449 149
74 3300048088 Ga0495602_0023384 Ga0495602_0023384_4746_5291 149
75 3300048089 Ga0495614_0142563 Ga0495614_0142563_449_994 149
76 3300048918 Ga0496115_0970370 Ga0496115_0970370_124_573 149
77 3300053077 Ga0495601_0008313 Ga0495601_0008313_1093_1638 149
78 3300053078 Ga0495612_0001797 Ga0495612_0001797_8187_8732 149
79 3300053084 Ga0495595_0003758 Ga0495595_0003758_4529_5074 149
80 3300053085 Ga0495619_0000973 Ga0495619_0000973_5699_6244 149
81 3300005289 Ga0065704_10785888 Ga0065704_107858881 150
82 3300005333 Ga0070677_10374496 Ga0070677_103744962 150
83 3300005334 Ga0068869_100389709 Ga0068869_1003897092 150
84 3300005336 Ga0070680_100032648 Ga0070680_1000326482 150
85 3300005336 Ga0070680_100262602 Ga0070680_1002626022 150
86 3300005336 Ga0070680_100624075 Ga0070680_1006240751 150
87 3300005339 Ga0070660_101419699 Ga0070660_1014196991 150
88 3300005343 Ga0070687_100126458 Ga0070687_1001264582 150
89 3300005345 Ga0070692_10090294 Ga0070692_100902942 150
90 3300005353 Ga0070669_100022862 Ga0070669_1000228623 150
91 3300005354 Ga0070675_100183795 Ga0070675_1001837952 150
92 3300005356 Ga0070674_101144444 Ga0070674_1011444442 150
93 3300005364 Ga0070673_100356908 Ga0070673_1003569082 150
94 3300005365 Ga0070688_100805501 Ga0070688_1008055012 150
95 3300005435 Ga0070714_100175915 Ga0070714_1001759153 150
96 3300005440 Ga0070705_100073272 Ga0070705_1000732722 150
97 3300005441 Ga0070700_100013138 Ga0070700_1000131382 150
98 3300005441 Ga0070700_100194672 Ga0070700_1001946722 150
99 3300005441 Ga0070700_100711916 Ga0070700_1007119161 150
100 3300005444 Ga0070694_100003882 Ga0070694_1000038822 150
101 3300005458 Ga0070681_10814770 Ga0070681_108147701 150
102 3300005459 Ga0068867_100017351 Ga0068867_1000173515 150
103 3300005466 Ga0070685_10202602 Ga0070685_102026022 150
104 3300005543 Ga0070672_100384043 Ga0070672_1003840431 150
105 3300005544 Ga0070686_100142741 Ga0070686_1001427412 150
106 3300005544 Ga0070686_101258202 Ga0070686_1012582021 150
107 3300005546 Ga0070696_100029970 Ga0070696_1000299704 150
108 3300005546 Ga0070696_100665171 Ga0070696_1006651712 150
109 3300005548 Ga0070665_101824417 Ga0070665_1018244171 150
110 3300005549 Ga0070704_100016121 Ga0070704_1000161212 150
111 3300005577 Ga0068857_100248290 Ga0068857_1002482902 150
112 3300005577 Ga0068857_100377497 Ga0068857_1003774972 150
113 3300005615 Ga0070702_100027865 Ga0070702_1000278654 150
114 3300005617 Ga0068859_100978902 Ga0068859_1009789022 150
115 3300005718 Ga0068866_10011993 Ga0068866_100119933 150
116 3300005719 Ga0068861_100340354 Ga0068861_1003403542 150
117 3300005840 Ga0068870_10308294 Ga0068870_103082942 150
118 3300005841 Ga0068863_100210284 Ga0068863_1002102842 150
119 3300005842 Ga0068858_100072052 Ga0068858_1000720522 150
120 3300005842 Ga0068858_100190310 Ga0068858_1001903102 150
121 3300005843 Ga0068860_100117945 Ga0068860_1001179453 150
122 3300005844 Ga0068862_100018505 Ga0068862_1000185052 150
123 3300005844 Ga0068862_100030714 Ga0068862_1000307143 150
124 3300006051 Ga0075364_10052349 Ga0075364_100523492 150
125 3300006051 Ga0075364_10343313 Ga0075364_103433132 150
126 3300006237 Ga0097621_100004686 Ga0097621_1000046868 150
127 3300006237 Ga0097621_100336478 Ga0097621_1003364782 150
128 3300006358 Ga0068871_100013670 Ga0068871_1000136702 150
129 3300006846 Ga0075430_100091457 Ga0075430_1000914573 150
130 3300006881 Ga0068865_101172128 Ga0068865_1011721281 150
131 3300006931 Ga0097620_100978924 Ga0097620_1009789241 150
132 3300007076 Ga0075435_101121401 Ga0075435_1011214011 150
133 3300009094 Ga0111539_10110001 Ga0111539_101100012 150
134 3300009094 Ga0111539_10425782 Ga0111539_104257823 150
135 3300009094 Ga0111539_10615131 Ga0111539_106151312 150
136 3300009094 Ga0111539_10737742 Ga0111539_107377422 150
137 3300009147 Ga0114129_11575763 Ga0114129_115757632 150
138 3300009174 Ga0105241_10089297 Ga0105241_100892972 150
139 3300009176 Ga0105242_11150771 Ga0105242_111507712 150
140 3300009177 Ga0105248_10055417 Ga0105248_100554175 150
141 3300009545 Ga0105237_10033765 Ga0105237_100337654 150
142 3300009551 Ga0105238_10428155 Ga0105238_104281552 150
143 3300009553 Ga0105249_10043312 Ga0105249_100433124 150
144 3300009553 Ga0105249_10063052 Ga0105249_100630522 150
145 3300013297 Ga0157378_10109439 Ga0157378_101094392 150
146 3300013297 Ga0157378_10947184 Ga0157378_109471841 150
147 3300014325 Ga0163163_10229684 Ga0163163_102296842 150
148 3300014326 Ga0157380_10854994 Ga0157380_108549942 150
149 3300014745 Ga0157377_10145134 Ga0157377_101451342 150
150 3300014969 Ga0157376_10191352 Ga0157376_101913522 150
151 3300021384 Ga0213876_10116268 Ga0213876_101162682 150
152 3300025893 Ga0207682_10020194 Ga0207682_100201942 150
153 3300025899 Ga0207642_10005153 Ga0207642_100051533 150
154 3300025903 Ga0207680_10126377 Ga0207680_101263771 150
155 3300025907 Ga0207645_10052237 Ga0207645_100522373 150
156 3300025908 Ga0207643_10005479 Ga0207643_100054793 150
157 3300025911 Ga0207654_10322068 Ga0207654_103220682 150
158 3300025914 Ga0207671_10127053 Ga0207671_101270532 150
159 3300025917 Ga0207660_10036634 Ga0207660_100366342 150
160 3300025917 Ga0207660_10105982 Ga0207660_101059822 150
161 3300025918 Ga0207662_10104710 Ga0207662_101047102 150
162 3300025923 Ga0207681_10028116 Ga0207681_100281163 150
163 3300025924 Ga0207694_10296906 Ga0207694_102969062 150
164 3300025924 Ga0207694_10412054 Ga0207694_104120542 150
165 3300025926 Ga0207659_10048920 Ga0207659_100489202 150
166 3300025936 Ga0207670_10259347 Ga0207670_102593472 150
167 3300025936 Ga0207670_10595100 Ga0207670_105951002 150
168 3300025937 Ga0207669_10146882 Ga0207669_101468822 150
169 3300025938 Ga0207704_10033814 Ga0207704_100338142 150
170 3300025938 Ga0207704_10477024 Ga0207704_104770241 150
171 3300025940 Ga0207691_10061457 Ga0207691_100614573 150
172 3300025941 Ga0207711_10044988 Ga0207711_100449882 150
173 3300025942 Ga0207689_10268154 Ga0207689_102681542 150
174 3300025944 Ga0207661_10038807 Ga0207661_100388074 150
175 3300025960 Ga0207651_10659154 Ga0207651_106591542 150
176 3300025961 Ga0207712_10032388 Ga0207712_100323883 150
177 3300025961 Ga0207712_10148088 Ga0207712_101480881 150
178 3300025972 Ga0207668_10045719 Ga0207668_100457192 150
179 3300026035 Ga0207703_10083819 Ga0207703_100838193 150
180 3300026041 Ga0207639_10219061 Ga0207639_102190612 150
181 3300026075 Ga0207708_10045668 Ga0207708_100456684 150
182 3300026075 Ga0207708_10432984 Ga0207708_104329842 150
183 3300026075 Ga0207708_10532312 Ga0207708_105323122 150
184 3300026088 Ga0207641_10051878 Ga0207641_100518782 150
185 3300026089 Ga0207648_10001980 Ga0207648_1000198019 150
186 3300026095 Ga0207676_12015047 Ga0207676_120150472 150
187 3300026116 Ga0207674_10449795 Ga0207674_104497952 150
188 3300026116 Ga0207674_10835889 Ga0207674_108358892 150
189 3300026118 Ga0207675_100044837 Ga0207675_1000448372 150
190 3300026118 Ga0207675_100101000 Ga0207675_1001010004 150
191 3300026118 Ga0207675_100301871 Ga0207675_1003018712 150
192 3300026121 Ga0207683_10288639 Ga0207683_102886392 150
193 3300027111 Ga0209281_1000355 Ga0209281_100035538 150
194 3300027360 Ga0209969_1003462 Ga0209969_10034622 150
195 3300027364 Ga0209967_1000380 Ga0209967_10003802 150
196 3300027378 Ga0209981_1000383 Ga0209981_10003833 150
197 3300027395 Ga0209996_1002235 Ga0209996_10022352 150
198 3300027462 Ga0210000_1000816 Ga0210000_10008163 150
199 3300027462 Ga0210000_1015477 Ga0210000_10154772 150
200 3300027471 Ga0209995_1001625 Ga0209995_10016252 150
201 3300027526 Ga0209968_1001752 Ga0209968_10017522 150
202 3300027543 Ga0209999_1000730 Ga0209999_10007303 150
203 3300027682 Ga0209971_1103681 Ga0209971_11036811 150
204 3300027695 Ga0209966_1029280 Ga0209966_10292802 150
205 3300028379 Ga0268266_10166657 Ga0268266_101666572 150
206 3300028380 Ga0268265_10359437 Ga0268265_103594372 150
207 3300028380 Ga0268265_10436948 Ga0268265_104369481 150
208 3300028381 Ga0268264_10333309 Ga0268264_103333093 150
209 3300031548 Ga0307408_101542368 Ga0307408_1015423681 150
210 3300031731 Ga0307405_11083172 Ga0307405_110831722 150
211 3300031852 Ga0307410_11251882 Ga0307410_112518821 150
212 3300031901 Ga0307406_10794605 Ga0307406_107946051 150
213 3300031903 Ga0307407_10652696 Ga0307407_106526962 150
214 3300031903 Ga0307407_10770593 Ga0307407_107705932 150
215 3300031911 Ga0307412_10329375 Ga0307412_103293752 150
216 3300031911 Ga0307412_10507456 Ga0307412_105074562 150
217 3300032002 Ga0307416_100035032 Ga0307416_1000350324 150
218 3300032005 Ga0307411_11682142 Ga0307411_116821422 150
219 3300032126 Ga0307415_101267430 Ga0307415_1012674302 150
220 3300034817 Ga0373948_0005827 Ga0373948_0005827_926_1387 150
221 3300034819 Ga0373958_0009143 Ga0373958_0009143_492_953 150
222 3300034819 Ga0373958_0022336 Ga0373958_0022336_287_739 150
223 3300034957 Ga0373938_0016063 Ga0373938_0016063_65_517 150
224 3300035084 Ga0373928_0154603 Ga0373928_0154603_131_583 150
225 3300035085 Ga0373929_0043265 Ga0373929_0043265_77_538 150
226 3300035088 Ga0373940_0066491 Ga0373940_0066491_362_823 150
227 3300035091 Ga0373951_0015760 Ga0373951_0015760_314_775 150
228 3300035112 Ga0373932_0042735 Ga0373932_0042735_173_634 150
229 3300035115 Ga0373941_0007309 Ga0373941_0007309_1010_1462 150
230 3300035115 Ga0373941_0034247 Ga0373941_0034247_680_1141 150
231 3300035242 Ga0373962_0003240 Ga0373962_0003240_62_523 150
232 3300035691 Ga0373931_0000460 Ga0373931_0000460_12286_12747 150
233 3300035691 Ga0373931_0034279 Ga0373931_0034279_1484_1936 150
234 3300035691 Ga0373931_0208677 Ga0373931_0208677_17_478 150
235 3300037471 Ga0395905_0878070 Ga0395905_0878070_60_512 150
236 3300039437 Ga0436365_1074131 Ga0436365_1074131_462_920 150
237 3300042009 Ga0439451_086549 Ga0439451_086549_46_504 150
238 3300042013 Ga0439456_087818 Ga0439456_087818_185_637 150
239 3300042125 Ga0450923_036570 Ga0450923_036570_378_830 150
240 3300046524 Ga0495648_0197556 Ga0495648_0197556_470_943 150
241 3300046537 Ga0495598_0158798 Ga0495598_0158798_58_510 150
242 3300046539 Ga0495621_0051166 Ga0495621_0051166_309_761 150
243 3300046615 Ga0495656_0134506 Ga0495656_0134506_633_1100 150
244 3300046660 Ga0495625_0371188 Ga0495625_0371188_169_642 150
245 3300046684 Ga0495669_0080402 Ga0495669_0080402_38_490 150
246 3300047318 Ga0495636_0263674 Ga0495636_0263674_26_478 150
247 3300047318 Ga0495636_0366164 Ga0495636_0366164_14_466 150
248 3300048923 Ga0496120_0094524 Ga0496120_0094524_1086_1559 150
249 3300049521 Ga0501298_042792 Ga0501298_042792_390_842 150
250 3300049522 Ga0501299_098622 Ga0501299_098622_81_533 150
251 3300049569 Ga0501032_0832354 Ga0501032_0832354_48_500 150
252 3300049570 Ga0501033_0224770 Ga0501033_0224770_504_956 150
253 3300049570 Ga0501033_0474699 Ga0501033_0474699_157_732 150
254 3300049571 Ga0501034_0095341 Ga0501034_0095341_1557_2009 150
255 3300049572 Ga0501036_0144874 Ga0501036_0144874_357_809 150
256 3300049573 Ga0501037_0341375 Ga0501037_0341375_54_506 150
257 3300049574 Ga0501038_0156816 Ga0501038_0156816_299_751 150
258 3300049574 Ga0501038_0971669 Ga0501038_0971669_34_486 150
259 3300049575 Ga0501039_0017403 Ga0501039_0017403_1085_1537 150
260 3300049576 Ga0501040_0022746 Ga0501040_0022746_1739_2191 150
261 3300049577 Ga0501041_0006065 Ga0501041_0006065_2056_2508 150
262 3300049577 Ga0501041_0133905 Ga0501041_0133905_636_1088 150
263 3300049578 Ga0501042_0208178 Ga0501042_0208178_814_1266 150
264 3300049578 Ga0501042_0226997 Ga0501042_0226997_64_516 150
265 3300049579 Ga0501043_0491311 Ga0501043_0491311_85_537 150
266 3300049579 Ga0501043_0669116 Ga0501043_0669116_242_694 150
267 3300049580 Ga0501046_0027302 Ga0501046_0027302_3759_4211 150
268 3300049580 Ga0501046_0346226 Ga0501046_0346226_177_629 150
269 3300049581 Ga0501047_0068048 Ga0501047_0068048_456_908 150
270 3300049582 Ga0501048_0188131 Ga0501048_0188131_555_1007 150
271 3300049582 Ga0501048_0211324 Ga0501048_0211324_676_1128 150
272 3300049587 Ga0501071_0742196 Ga0501071_0742196_174_626 150
273 3300049588 Ga0501072_1006602 Ga0501072_1006602_144_596 150
274 3300049591 Ga0501075_0041908 Ga0501075_0041908_2816_3268 150
275 3300049592 Ga0501076_0161930 Ga0501076_0161930_1307_1759 150
276 3300049592 Ga0501076_0296267 Ga0501076_0296267_368_820 150
277 3300049741 Ga0501079_0081315 Ga0501079_0081315_756_1208 150
278 3300049741 Ga0501079_1221784 Ga0501079_1221784_11_463 150
279 3300049742 Ga0501080_0696526 Ga0501080_0696526_288_740 150
280 3300049743 Ga0501081_0103375 Ga0501081_0103375_929_1381 150
281 3300049779 Ga0501283_043946 Ga0501283_043946_211_663 150
282 3300049822 Ga0501035_0767972 Ga0501035_0767972_191_643 150
283 3300049823 Ga0501044_0108990 Ga0501044_0108990_2181_2633 150
284 3300049824 Ga0501045_0047507 Ga0501045_0047507_101_553 150
285 3300049824 Ga0501045_0617821 Ga0501045_0617821_219_671 150
286 3300050492 nmdc:mga0yw44_667525_c1 nmdc:mga0yw44_667525_c1_165_617 150
287 3300050507 nmdc:mga05p37_964886_c1 nmdc:mga05p37_964886_c1_411_863 150
288 3300050508 nmdc:mga09592_416614_c1 nmdc:mga09592_416614_c1_211_663 150
289 3300050509 nmdc:mga0qj67_10268_c1 nmdc:mga0qj67_10268_c1_2184_2636 150
290 3300050509 nmdc:mga0qj67_404038_c1 nmdc:mga0qj67_404038_c1_526_978 150
291 3300050511 nmdc:mga08y16_1671324_c1 nmdc:mga08y16_1671324_c1_16_483 150
292 3300050511 nmdc:mga08y16_234293_c1 nmdc:mga08y16_234293_c1_558_1025 150
293 3300050511 nmdc:mga08y16_79407_c1 nmdc:mga08y16_79407_c1_1767_2219 150
294 3300050511 nmdc:mga08y16_97268_c1 nmdc:mga08y16_97268_c1_2083_2535 150
295 3300050516 nmdc:mga0sz30_47199_c1 nmdc:mga0sz30_47199_c1_1324_1776 150
296 3300053730 Ga0500645_110932 Ga0500645_110932_40_513 150
297 3300054114 Ga0501084_0406068 Ga0501084_0406068_345_797 150
298 3300005330 Ga0070690_100006106 Ga0070690_1000061065 151
299 3300005334 Ga0068869_100391792 Ga0068869_1003917922 151
300 3300005334 Ga0068869_100440164 Ga0068869_1004401642 151
301 3300005337 Ga0070682_100302877 Ga0070682_1003028772 151
302 3300005343 Ga0070687_100342959 Ga0070687_1003429592 151
303 3300005347 Ga0070668_100519804 Ga0070668_1005198042 151
304 3300005355 Ga0070671_100025538 Ga0070671_1000255382 151
305 3300005356 Ga0070674_100227535 Ga0070674_1002275352 151
306 3300005364 Ga0070673_100342201 Ga0070673_1003422012 151
307 3300005365 Ga0070688_100029086 Ga0070688_1000290862 151
308 3300005441 Ga0070700_100615643 Ga0070700_1006156432 151
309 3300005458 Ga0070681_10133520 Ga0070681_101335202 151
310 3300005543 Ga0070672_100260719 Ga0070672_1002607192 151
311 3300005548 Ga0070665_100974124 Ga0070665_1009741242 151
312 3300005549 Ga0070704_100418576 Ga0070704_1004185762 151
313 3300005563 Ga0068855_100977352 Ga0068855_1009773522 151
314 3300005615 Ga0070702_100151106 Ga0070702_1001511062 151
315 3300005616 Ga0068852_100858171 Ga0068852_1008581711 151
316 3300005617 Ga0068859_101608328 Ga0068859_1016083281 151
317 3300005618 Ga0068864_100429786 Ga0068864_1004297862 151
318 3300005618 Ga0068864_100717558 Ga0068864_1007175582 151
319 3300005718 Ga0068866_10425324 Ga0068866_104253242 151
320 3300005719 Ga0068861_100479378 Ga0068861_1004793782 151
321 3300005843 Ga0068860_100079095 Ga0068860_1000790953 151
322 3300005843 Ga0068860_101594448 Ga0068860_1015944481 151
323 3300005985 Ga0081539_10026344 Ga0081539_100263443 151
324 3300005985 Ga0081539_10269674 Ga0081539_102696741 151
325 3300006048 Ga0075363_100081654 Ga0075363_1000816541 151
326 3300006048 Ga0075363_100304863 Ga0075363_1003048631 151
327 3300006051 Ga0075364_10336997 Ga0075364_103369971 151
328 3300006177 Ga0075362_10077944 Ga0075362_100779442 151
329 3300006186 Ga0075369_10109332 Ga0075369_101093321 151
330 3300006195 Ga0075366_10016671 Ga0075366_100166712 151
331 3300006195 Ga0075366_10457563 Ga0075366_104575632 151
332 3300006237 Ga0097621_100287900 Ga0097621_1002879002 151
333 3300006353 Ga0075370_10158882 Ga0075370_101588822 151
334 3300006353 Ga0075370_10253411 Ga0075370_102534111 151
335 3300006881 Ga0068865_101101125 Ga0068865_1011011252 151
336 3300006931 Ga0097620_101608286 Ga0097620_1016082862 151
337 3300007076 Ga0075435_100486238 Ga0075435_1004862382 151
338 3300007076 Ga0075435_101631938 Ga0075435_1016319382 151
339 3300009098 Ga0105245_12674415 Ga0105245_126744151 151
340 3300009101 Ga0105247_10203139 Ga0105247_102031392 151
341 3300009148 Ga0105243_10456059 Ga0105243_104560592 151
342 3300009148 Ga0105243_11195999 Ga0105243_111959992 151
343 3300009177 Ga0105248_10243440 Ga0105248_102434402 151
344 3300009551 Ga0105238_11087630 Ga0105238_110876302 151
345 3300009553 Ga0105249_10246742 Ga0105249_102467422 151
346 3300011119 Ga0105246_10878079 Ga0105246_108780792 151
347 3300013297 Ga0157378_10692996 Ga0157378_106929961 151
348 3300013306 Ga0163162_10412216 Ga0163162_104122162 151
349 3300014325 Ga0163163_10103638 Ga0163163_101036382 151
350 3300014745 Ga0157377_10189293 Ga0157377_101892931 151
351 3300014969 Ga0157376_10266040 Ga0157376_102660402 151
352 3300025899 Ga0207642_10027764 Ga0207642_100277642 151
353 3300025900 Ga0207710_10398813 Ga0207710_103988131 151
354 3300025907 Ga0207645_10043281 Ga0207645_100432812 151
355 3300025912 Ga0207707_10157578 Ga0207707_101575781 151
356 3300025917 Ga0207660_10256230 Ga0207660_102562302 151
357 3300025918 Ga0207662_10120656 Ga0207662_101206562 151
358 3300025921 Ga0207652_10627665 Ga0207652_106276652 151
359 3300025923 Ga0207681_10122467 Ga0207681_101224671 151
360 3300025924 Ga0207694_11558802 Ga0207694_115588021 151
361 3300025925 Ga0207650_10170269 Ga0207650_101702691 151
362 3300025931 Ga0207644_11529297 Ga0207644_115292971 151
363 3300025935 Ga0207709_10415542 Ga0207709_104155421 151
364 3300025936 Ga0207670_10096618 Ga0207670_100966181 151
365 3300025937 Ga0207669_10447434 Ga0207669_104474342 151
366 3300025938 Ga0207704_10261039 Ga0207704_102610392 151
367 3300025938 Ga0207704_10650780 Ga0207704_106507802 151
368 3300025940 Ga0207691_10702797 Ga0207691_107027971 151
369 3300025941 Ga0207711_11796824 Ga0207711_117968241 151
370 3300025942 Ga0207689_10835276 Ga0207689_108352761 151
371 3300025960 Ga0207651_10524397 Ga0207651_105243971 151
372 3300026075 Ga0207708_10432756 Ga0207708_104327562 151
373 3300026088 Ga0207641_10205364 Ga0207641_102053642 151
374 3300026089 Ga0207648_10058327 Ga0207648_100583272 151
375 3300026095 Ga0207676_10175290 Ga0207676_101752902 151
376 3300028379 Ga0268266_11297671 Ga0268266_112976712 151
377 3300028380 Ga0268265_10199458 Ga0268265_101994581 151
378 3300028381 Ga0268264_10249852 Ga0268264_102498522 151
379 3300028800 Ga0265338_10017679 Ga0265338_100176792 151
380 3300031903 Ga0307407_10568972 Ga0307407_105689722 151
381 3300034817 Ga0373948_0024118 Ga0373948_0024118_320_775 151
382 3300034818 Ga0373950_0113986 Ga0373950_0113986_68_523 151
383 3300034820 Ga0373959_0133529 Ga0373959_0133529_33_488 151
384 3300034957 Ga0373938_0020622 Ga0373938_0020622_812_1267 151
385 3300035092 Ga0373952_0027214 Ga0373952_0027214_101_556 151
386 3300035113 Ga0373936_0023451 Ga0373936_0023451_1725_2183 151
387 3300035121 Ga0373960_0077047 Ga0373960_0077047_482_937 151
388 3300035242 Ga0373962_0044643 Ga0373962_0044643_20_475 151
389 3300035691 Ga0373931_0054787 Ga0373931_0054787_1656_2111 151
390 3300048905 Ga0496102_0470386 Ga0496102_0470386_285_740 151
391 3300048907 Ga0496104_0453429 Ga0496104_0453429_213_668 151
392 3300048910 Ga0496107_0363311 Ga0496107_0363311_346_801 151
393 3300048912 Ga0496109_0272893 Ga0496109_0272893_939_1394 151
394 3300048915 Ga0496112_0271320 Ga0496112_0271320_564_1019 151
395 3300048916 Ga0496113_0035614 Ga0496113_0035614_1626_2081 151
396 3300048917 Ga0496114_0062312 Ga0496114_0062312_1191_1646 151
397 3300048918 Ga0496115_0042463 Ga0496115_0042463_2576_3031 151
398 3300049590 Ga0501074_0435638 Ga0501074_0435638_304_759 151
399 3300049590 Ga0501074_0437308 Ga0501074_0437308_134_595 151
400 3300049744 Ga0501083_0778045 Ga0501083_0778045_80_535 151
401 3300050489 nmdc:mga03683_65702_c1 nmdc:mga03683_65702_c1_630_1085 151
402 3300050490 nmdc:mga03n38_264242_c1 nmdc:mga03n38_264242_c1_443_898 151
403 3300050490 nmdc:mga03n38_91499_c1 nmdc:mga03n38_91499_c1_817_1272 151
404 3300050493 nmdc:mga0k408_134429_c1 nmdc:mga0k408_134429_c1_597_1052 151
405 3300050493 nmdc:mga0k408_31294_c1 nmdc:mga0k408_31294_c1_369_824 151
406 3300050494 nmdc:mga06z11_338928_c1 nmdc:mga06z11_338928_c1_174_629 151
407 3300050494 nmdc:mga06z11_472306_c1 nmdc:mga06z11_472306_c1_287_742 151
408 3300050494 nmdc:mga06z11_58079_c1 nmdc:mga06z11_58079_c1_418_873 151
409 3300050496 nmdc:mga07m45_230274_c1 nmdc:mga07m45_230274_c1_556_1011 151
410 3300050496 nmdc:mga07m45_67187_c2 nmdc:mga07m45_67187_c2_725_1180 151
411 3300050510 nmdc:mga06r32_1212198_c1 nmdc:mga06r32_1212198_c1_86_541 151
412 3300053117 Ga0500593_005031 Ga0500593_005031_4548_5003 151
413 3300059426 Ga0590077_067956 Ga0590077_067956_28_483 151
414 3300061734 Ga0530510_0496892 Ga0530510_0496892_210_665 151
415 3300003373 JGI25407J50210_10128726 JGI25407J50210_101287261 152
416 3300003659 JGI25404J52841_10016510 JGI25404J52841_100165101 152
417 3300005337 Ga0070682_100048610 Ga0070682_1000486102 152
418 3300005344 Ga0070661_100020373 Ga0070661_1000203733 152
419 3300005347 Ga0070668_100654926 Ga0070668_1006549262 152
420 3300005354 Ga0070675_100612894 Ga0070675_1006128941 152
421 3300005355 Ga0070671_100008579 Ga0070671_1000085793 152
422 3300005356 Ga0070674_102000651 Ga0070674_1020006511 152
423 3300005364 Ga0070673_100226801 Ga0070673_1002268012 152
424 3300005364 Ga0070673_100397972 Ga0070673_1003979722 152
425 3300005367 Ga0070667_100027878 Ga0070667_1000278782 152
426 3300005434 Ga0070709_10043323 Ga0070709_100433232 152
427 3300005435 Ga0070714_100123387 Ga0070714_1001233872 152
428 3300005435 Ga0070714_102161638 Ga0070714_1021616381 152
429 3300005436 Ga0070713_100009021 Ga0070713_1000090214 152
430 3300005436 Ga0070713_100040579 Ga0070713_1000405795 152
431 3300005440 Ga0070705_100290007 Ga0070705_1002900072 152
432 3300005440 Ga0070705_100453974 Ga0070705_1004539742 152
433 3300005444 Ga0070694_100719311 Ga0070694_1007193112 152
434 3300005445 Ga0070708_100188446 Ga0070708_1001884462 152
435 3300005445 Ga0070708_100419022 Ga0070708_1004190222 152
436 3300005456 Ga0070678_100049153 Ga0070678_1000491532 152
437 3300005458 Ga0070681_10427378 Ga0070681_104273782 152
438 3300005467 Ga0070706_100622432 Ga0070706_1006224322 152
439 3300005468 Ga0070707_100018789 Ga0070707_1000187894 152
440 3300005518 Ga0070699_100120113 Ga0070699_1001201131 152
441 3300005530 Ga0070679_100186952 Ga0070679_1001869522 152
442 3300005543 Ga0070672_100895312 Ga0070672_1008953122 152
443 3300005544 Ga0070686_100027561 Ga0070686_1000275613 152
444 3300005545 Ga0070695_100145469 Ga0070695_1001454691 152
445 3300005546 Ga0070696_100038929 Ga0070696_1000389292 152
446 3300005546 Ga0070696_100831509 Ga0070696_1008315091 152
447 3300005614 Ga0068856_100082302 Ga0068856_1000823022 152
448 3300005615 Ga0070702_100144172 Ga0070702_1001441722 152
449 3300005617 Ga0068859_100905611 Ga0068859_1009056112 152
450 3300005719 Ga0068861_101432359 Ga0068861_1014323592 152
451 3300005841 Ga0068863_101236766 Ga0068863_1012367662 152
452 3300005843 Ga0068860_100190478 Ga0068860_1001904782 152
453 3300005843 Ga0068860_100785953 Ga0068860_1007859531 152
454 3300005844 Ga0068862_101540753 Ga0068862_1015407531 152
455 3300005937 Ga0081455_10036231 Ga0081455_100362311 152
456 3300005937 Ga0081455_10107400 Ga0081455_101074004 152
457 3300005981 Ga0081538_10176651 Ga0081538_101766511 152
458 3300005981 Ga0081538_10181416 Ga0081538_101814162 152
459 3300005983 Ga0081540_1006133 Ga0081540_10061332 152
460 3300006028 Ga0070717_10287787 Ga0070717_102877873 152
461 3300006028 Ga0070717_10353656 Ga0070717_103536562 152
462 3300006042 Ga0075368_10371382 Ga0075368_103713822 152
463 3300006058 Ga0075432_10206958 Ga0075432_102069581 152
464 3300006173 Ga0070716_101562941 Ga0070716_1015629411 152
465 3300006175 Ga0070712_100045103 Ga0070712_1000451033 152
466 3300006175 Ga0070712_100454882 Ga0070712_1004548821 152
467 3300006237 Ga0097621_100034588 Ga0097621_1000345884 152
468 3300006237 Ga0097621_100230113 Ga0097621_1002301132 152
469 3300006358 Ga0068871_100074445 Ga0068871_1000744452 152
470 3300006358 Ga0068871_100996774 Ga0068871_1009967741 152
471 3300006844 Ga0075428_100753775 Ga0075428_1007537752 152
472 3300006844 Ga0075428_100760842 Ga0075428_1007608422 152
473 3300006847 Ga0075431_100082951 Ga0075431_1000829512 152
474 3300006847 Ga0075431_100748334 Ga0075431_1007483342 152
475 3300006852 Ga0075433_10094261 Ga0075433_100942613 152
476 3300006871 Ga0075434_100051055 Ga0075434_1000510554 152
477 3300006871 Ga0075434_100204221 Ga0075434_1002042213 152
478 3300006881 Ga0068865_100321596 Ga0068865_1003215962 152
479 3300006931 Ga0097620_100905567 Ga0097620_1009055672 152
480 3300007076 Ga0075435_100439953 Ga0075435_1004399532 152
481 3300007788 Ga0099795_10024280 Ga0099795_100242802 152
482 3300009094 Ga0111539_10029898 Ga0111539_100298982 152
483 3300009098 Ga0105245_10156120 Ga0105245_101561201 152
484 3300009101 Ga0105247_10167208 Ga0105247_101672082 152
485 3300009147 Ga0114129_10049013 Ga0114129_100490132 152
486 3300009147 Ga0114129_10188585 Ga0114129_101885852 152
487 3300009147 Ga0114129_10530805 Ga0114129_105308052 152
488 3300009148 Ga0105243_10601797 Ga0105243_106017971 152
489 3300009174 Ga0105241_10086385 Ga0105241_100863852 152
490 3300009545 Ga0105237_10196848 Ga0105237_101968482 152
491 3300009553 Ga0105249_10344694 Ga0105249_103446942 152
492 3300010159 Ga0099796_10083378 Ga0099796_100833782 152
493 3300010375 Ga0105239_10357835 Ga0105239_103578352 152
494 3300011119 Ga0105246_10105421 Ga0105246_101054212 152
495 3300012513 Ga0157326_1000011 Ga0157326_100001110 152
496 3300013102 Ga0157371_10299086 Ga0157371_102990861 152
497 3300013296 Ga0157374_10032393 Ga0157374_100323933 152
498 3300013297 Ga0157378_10027853 Ga0157378_100278533 152
499 3300013297 Ga0157378_11716754 Ga0157378_117167541 152
500 3300013308 Ga0157375_10620436 Ga0157375_106204362 152
501 3300014968 Ga0157379_10199129 Ga0157379_101991292 152
502 3300014968 Ga0157379_10346010 Ga0157379_103460102 152
503 3300014968 Ga0157379_11097995 Ga0157379_110979952 152
504 3300014969 Ga0157376_10816670 Ga0157376_108166702 152
505 3300017792 Ga0163161_10013562 Ga0163161_100135625 152
506 3300025885 Ga0207653_10018191 Ga0207653_100181912 152
507 3300025899 Ga0207642_10828535 Ga0207642_108285351 152
508 3300025900 Ga0207710_10093440 Ga0207710_100934402 152
509 3300025905 Ga0207685_10004676 Ga0207685_100046763 152
510 3300025907 Ga0207645_11053462 Ga0207645_110534621 152
511 3300025910 Ga0207684_10092822 Ga0207684_100928222 152
512 3300025911 Ga0207654_10112255 Ga0207654_101122551 152
513 3300025912 Ga0207707_10171922 Ga0207707_101719222 152
514 3300025915 Ga0207693_10032967 Ga0207693_100329673 152
515 3300025915 Ga0207693_10906886 Ga0207693_109068861 152
516 3300025916 Ga0207663_10334983 Ga0207663_103349832 152
517 3300025917 Ga0207660_10157734 Ga0207660_101577342 152
518 3300025919 Ga0207657_10061677 Ga0207657_100616772 152
519 3300025920 Ga0207649_10080347 Ga0207649_100803472 152
520 3300025922 Ga0207646_10040306 Ga0207646_100403062 152
521 3300025923 Ga0207681_11101096 Ga0207681_111010961 152
522 3300025927 Ga0207687_10046586 Ga0207687_100465861 152
523 3300025928 Ga0207700_10116224 Ga0207700_101162242 152
524 3300025929 Ga0207664_10105470 Ga0207664_101054703 152
525 3300025931 Ga0207644_10244927 Ga0207644_102449272 152
526 3300025932 Ga0207690_10071928 Ga0207690_100719282 152
527 3300025933 Ga0207706_10028029 Ga0207706_100280294 152
528 3300025935 Ga0207709_10098762 Ga0207709_100987622 152
529 3300025937 Ga0207669_10078957 Ga0207669_100789572 152
530 3300025939 Ga0207665_10410718 Ga0207665_104107181 152
531 3300025940 Ga0207691_10781744 Ga0207691_107817442 152
532 3300025945 Ga0207679_10595961 Ga0207679_105959611 152
533 3300025949 Ga0207667_10118586 Ga0207667_101185862 152
534 3300025960 Ga0207651_10992272 Ga0207651_109922722 152
535 3300025961 Ga0207712_10441397 Ga0207712_104413972 152
536 3300026023 Ga0207677_10947889 Ga0207677_109478892 152
537 3300026067 Ga0207678_10019487 Ga0207678_100194874 152
538 3300026075 Ga0207708_10612094 Ga0207708_106120941 152
539 3300026088 Ga0207641_11862653 Ga0207641_118626532 152
540 3300026121 Ga0207683_10008812 Ga0207683_100088122 152
541 3300028381 Ga0268264_11853455 Ga0268264_118534551 152
542 3300031344 Ga0265316_10441418 Ga0265316_104414182 152
543 3300031711 Ga0265314_10004756 Ga0265314_100047566 152
544 3300031731 Ga0307405_10089397 Ga0307405_100893972 152
545 3300032126 Ga0307415_101385364 Ga0307415_1013853642 152
546 3300035084 Ga0373928_0053499 Ga0373928_0053499_244_702 152
547 3300035085 Ga0373929_0058729 Ga0373929_0058729_258_716 152
548 3300035086 Ga0373934_0006061 Ga0373934_0006061_3146_3604 152
549 3300035088 Ga0373940_0214361 Ga0373940_0214361_165_623 152
550 3300035089 Ga0373944_0071143 Ga0373944_0071143_551_1009 152
551 3300035115 Ga0373941_0107943 Ga0373941_0107943_328_786 152
552 3300035115 Ga0373941_0216671 Ga0373941_0216671_147_605 152
553 3300035116 Ga0373945_0012898 Ga0373945_0012898_1521_1979 152
554 3300035117 Ga0373953_0369930 Ga0373953_0369930_39_497 152
555 3300035119 Ga0373956_0004855 Ga0373956_0004855_4553_5011 152
556 3300035120 Ga0373957_0000553 Ga0373957_0000553_1365_1823 152
557 3300035170 Ga0373943_0012783 Ga0373943_0012783_2775_3233 152
558 3300035172 Ga0373955_0029726 Ga0373955_0029726_2139_2597 152
559 3300035172 Ga0373955_0053891 Ga0373955_0053891_594_1052 152
560 3300035242 Ga0373962_0084713 Ga0373962_0084713_492_950 152
561 3300035410 Ga0373924_0062531 Ga0373924_0062531_509_967 152
562 3300035691 Ga0373931_0012343 Ga0373931_0012343_2817_3275 152
563 3300035691 Ga0373931_0114727 Ga0373931_0114727_457_915 152
564 3300035692 Ga0373935_0018456 Ga0373935_0018456_1524_1982 152
565 3300035695 Ga0373927_0227446 Ga0373927_0227446_80_538 152
566 3300035724 Ga0373933_0009065 Ga0373933_0009065_607_1065 152
567 3300035725 Ga0373947_0016022 Ga0373947_0016022_1419_1877 152
568 3300036401 Ga0373937_0009081 Ga0373937_0009081_2656_3114 152
569 3300036401 Ga0373937_0629237 Ga0373937_0629237_418_876 152
570 3300037068 Ga0373925_0147391 Ga0373925_0147391_277_735 152
571 3300037068 Ga0373925_0496729 Ga0373925_0496729_35_493 152
572 3300037068 Ga0373925_0529298 Ga0373925_0529298_53_511 152
573 3300037418 Ga0395900_1296940 Ga0395900_1296940_85_543 152
574 3300038996 Ga0242420_047095 Ga0242420_047095_184_642 152
575 3300046454 Ga0495592_0137747 Ga0495592_0137747_55_513 152
576 3300046455 Ga0495603_0024250 Ga0495603_0024250_1997_2455 152
577 3300046455 Ga0495603_0120832 Ga0495603_0120832_858_1316 152
578 3300046459 Ga0495629_0049097 Ga0495629_0049097_123_581 152
579 3300046459 Ga0495629_0269233 Ga0495629_0269233_580_1038 152
580 3300046461 Ga0495641_0014791 Ga0495641_0014791_3497_3955 152
581 3300046462 Ga0495651_0002360 Ga0495651_0002360_7732_8190 152
582 3300046463 Ga0495653_0018310 Ga0495653_0018310_3185_3643 152
583 3300046472 Ga0495580_0077236 Ga0495580_0077236_1693_2151 152
584 3300046475 Ga0495639_0009155 Ga0495639_0009155_1309_1767 152
585 3300046476 Ga0495662_0016267 Ga0495662_0016267_841_1299 152
586 3300046477 Ga0495664_0276060 Ga0495664_0276060_65_523 152
587 3300046491 Ga0495584_0330817 Ga0495584_0330817_120_722 152
588 3300046499 Ga0495594_0008651 Ga0495594_0008651_3574_4032 152
589 3300046499 Ga0495594_0232640 Ga0495594_0232640_456_914 152
590 3300046501 Ga0495607_0009217 Ga0495607_0009217_1709_2167 152
591 3300046511 Ga0495608_0118096 Ga0495608_0118096_1188_1646 152
592 3300046514 Ga0495618_0002901 Ga0495618_0002901_1758_2216 152
593 3300046516 Ga0495628_0137068 Ga0495628_0137068_224_682 152
594 3300046529 Ga0495652_0076968 Ga0495652_0076968_2236_2694 152
595 3300046533 Ga0495640_0085749 Ga0495640_0085749_569_1027 152
596 3300046535 Ga0495586_0021826 Ga0495586_0021826_2752_3210 152
597 3300046536 Ga0495587_0001264 Ga0495587_0001264_12384_12842 152
598 3300046538 Ga0495609_0009437 Ga0495609_0009437_632_1090 152
599 3300046543 Ga0495645_0008282 Ga0495645_0008282_1188_1646 152
600 3300046557 Ga0495622_0299079 Ga0495622_0299079_111_569 152
601 3300046558 Ga0495633_0002046 Ga0495633_0002046_10287_10745 152
602 3300046559 Ga0495667_0003782 Ga0495667_0003782_2711_3169 152
603 3300046559 Ga0495667_0049529 Ga0495667_0049529_128_586 152
604 3300046642 Ga0495634_0029340 Ga0495634_0029340_2374_2832 152
605 3300046642 Ga0495634_0038969 Ga0495634_0038969_935_1393 152
606 3300046648 Ga0495611_0005086 Ga0495611_0005086_1775_2233 152
607 3300046665 Ga0495661_0052373 Ga0495661_0052373_1480_1938 152
608 3300046674 Ga0495588_0002506 Ga0495588_0002506_239_697 152
609 3300046674 Ga0495588_0233645 Ga0495588_0233645_394_852 152
610 3300046675 Ga0495657_0001799 Ga0495657_0001799_1755_2213 152
611 3300046678 Ga0495599_0005718 Ga0495599_0005718_6287_6745 152
612 3300046679 Ga0495623_0014717 Ga0495623_0014717_2547_3005 152
613 3300046680 Ga0495646_0005564 Ga0495646_0005564_5874_6332 152
614 3300046680 Ga0495646_0014811 Ga0495646_0014811_2850_3308 152
615 3300046689 Ga0495613_0072048 Ga0495613_0072048_599_1057 152
616 3300046809 Ga0495600_0001408 Ga0495600_0001408_1983_2441 152
617 3300046809 Ga0495600_0327237 Ga0495600_0327237_378_836 152
618 3300047315 Ga0495581_0055099 Ga0495581_0055099_607_1065 152
619 3300047315 Ga0495581_0096108 Ga0495581_0096108_114_572 152
620 3300047317 Ga0495604_0002929 Ga0495604_0002929_9189_9647 152
621 3300047319 Ga0495674_0004957 Ga0495674_0004957_8731_9189 152
622 3300047319 Ga0495674_0071452 Ga0495674_0071452_266_724 152
623 3300047322 Ga0495680_0007442 Ga0495680_0007442_1785_2243 152
624 3300047444 Ga0495675_0001604 Ga0495675_0001604_7599_8057 152
625 3300047446 Ga0495679_020259 Ga0495679_020259_1422_1880 152
626 3300047471 Ga0495684_0051773 Ga0495684_0051773_2423_2881 152
627 3300048088 Ga0495602_0001583 Ga0495602_0001583_6441_6899 152
628 3300048903 Ga0496100_0502118 Ga0496100_0502118_65_523 152
629 3300048904 Ga0496101_0024345 Ga0496101_0024345_1995_2453 152
630 3300048904 Ga0496101_0248886 Ga0496101_0248886_136_594 152
631 3300048905 Ga0496102_0019387 Ga0496102_0019387_5520_5978 152
632 3300048906 Ga0496103_0077901 Ga0496103_0077901_65_523 152
633 3300048907 Ga0496104_0030009 Ga0496104_0030009_1514_1972 152
634 3300048908 Ga0496105_0028251 Ga0496105_0028251_1631_2089 152
635 3300048908 Ga0496105_0723954 Ga0496105_0723954_94_552 152
636 3300048909 Ga0496106_0081601 Ga0496106_0081601_495_953 152
637 3300048909 Ga0496106_0197408 Ga0496106_0197408_1069_1527 152
638 3300048910 Ga0496107_0101059 Ga0496107_0101059_782_1240 152
639 3300048910 Ga0496107_0681911 Ga0496107_0681911_45_503 152
640 3300048912 Ga0496109_0174191 Ga0496109_0174191_212_670 152
641 3300048913 Ga0496110_0146876 Ga0496110_0146876_1110_1568 152
642 3300048913 Ga0496110_0336062 Ga0496110_0336062_697_1155 152
643 3300048913 Ga0496110_0628378 Ga0496110_0628378_319_777 152
644 3300048914 Ga0496111_0214600 Ga0496111_0214600_330_788 152
645 3300048914 Ga0496111_0471961 Ga0496111_0471961_411_869 152
646 3300048915 Ga0496112_0085280 Ga0496112_0085280_2561_3019 152
647 3300048915 Ga0496112_0341494 Ga0496112_0341494_413_871 152
648 3300048917 Ga0496114_0013459 Ga0496114_0013459_2243_2701 152
649 3300048917 Ga0496114_1733281 Ga0496114_1733281_21_479 152
650 3300048918 Ga0496115_0080953 Ga0496115_0080953_1198_1656 152
651 3300048924 Ga0496121_0210301 Ga0496121_0210301_718_1176 152
652 3300049576 Ga0501040_0103324 Ga0501040_0103324_553_1011 152
653 3300049582 Ga0501048_0096880 Ga0501048_0096880_968_1426 152
654 3300049592 Ga0501076_0026896 Ga0501076_0026896_3204_3662 152
655 3300049593 Ga0501077_0016657 Ga0501077_0016657_1962_2420 152
656 3300049743 Ga0501081_0008800 Ga0501081_0008800_2879_3337 152
657 3300050492 nmdc:mga0yw44_195218_c1 nmdc:mga0yw44_195218_c1_591_1265 152
658 3300050494 nmdc:mga06z11_256202_c1 nmdc:mga06z11_256202_c1_557_1015 152
659 3300050507 nmdc:mga05p37_16853_c1 nmdc:mga05p37_16853_c1_283_741 152
660 3300050507 nmdc:mga05p37_868586_c1 nmdc:mga05p37_868586_c1_447_917 152
661 3300050510 nmdc:mga06r32_91427_c1 nmdc:mga06r32_91427_c1_661_1119 152
662 3300050511 nmdc:mga08y16_587966_c1 nmdc:mga08y16_587966_c1_365_823 152
663 3300050512 nmdc:mga0n895_269598_c1 nmdc:mga0n895_269598_c1_427_885 152
664 3300050512 nmdc:mga0n895_46102_c1 nmdc:mga0n895_46102_c1_3207_3665 152
665 3300050513 nmdc:mga0rr50_701864_c1 nmdc:mga0rr50_701864_c1_21_479 152
666 3300050515 nmdc:mga0a205_1106149_c1 nmdc:mga0a205_1106149_c1_65_523 152
667 3300050515 nmdc:mga0a205_448320_c1 nmdc:mga0a205_448320_c1_585_1043 152
668 3300053077 Ga0495601_0016135 Ga0495601_0016135_2199_2657 152
669 3300053084 Ga0495595_0002645 Ga0495595_0002645_5853_6311 152
670 3300053085 Ga0495619_0004883 Ga0495619_0004883_6895_7353 152
671 3300053119 Ga0500595_034388 Ga0500595_034388_1094_1564 152
672 3300054114 Ga0501084_0607172 Ga0501084_0607172_277_735 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

106

178

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

38

110

0.88

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

54

127

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9769 2 151
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9608 2 151
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.96 1 151
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9585 1 151
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9584 1 151
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9744 2 76 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9686 2 74 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9669 84 151 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.963 2 76 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9567 1 76 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A095WSE8-F1-model_v4 (2Fe-2S)-binding protein 0.9931 4 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V9I141-F1-model_v4 (2Fe-2S)-binding protein 0.9926 4 114 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9919 2 151 GO:0046872
GO:0047121
GO:0051537
AF-A0A1H0H0N4-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9917 4 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A349TGJ4-F1-model_v4 (2Fe-2S)-binding protein 0.9916 2 142 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
93.8 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map