F474216

General Info

Members Datasets Scaffolds Average Seq Length
672 319 1344 93

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101688370|Ga0070665_1016883702
Length 115
Sequence MRGEHEKAPHIASLMRATCYNPPMIRVLDPTNELKASGIAAAPRPISLAGKTVGFISNGKEGTKGFFAHVDRMMREELGVAEVVWRTKSNYSAPADAHIVAEISRWHAVVTGVGD

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
104 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
105 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 7.59
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 9.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_101688370 3300005548 Bacteria 641
2 JGI25405J52794_10003649 3300003911 Bacteria 2712
3 JGI25405J52794_10094052 3300003911 Unclassified 665
4 Ga0065707_10235969 3300005295 Unclassified 1106
5 Ga0070676_10461910 3300005328 Bacteria 895
6 Ga0070683_100034047 3300005329 Bacteria 4651
7 Ga0070683_100253279 3300005329 Unclassified 1674
8 Ga0070683_100341449 3300005329 Unclassified 1426
9 Ga0070670_100190319 3300005331 Bacteria 1782
10 Ga0070670_101952619 3300005331 Bacteria 540
11 Ga0070677_10635201 3300005333 Bacteria 595
12 Ga0068869_100731510 3300005334 Bacteria 846
13 Ga0070666_10017204 3300005335 Bacteria 4634
14 Ga0070666_10654873 3300005335 Bacteria 769
15 Ga0070666_11298042 3300005335 Bacteria 543
16 Ga0070680_100572499 3300005336 Bacteria 969
17 Ga0070682_100260674 3300005337 Bacteria 1254
18 Ga0068868_100270464 3300005338 Bacteria 1436
19 Ga0068868_101717516 3300005338 Bacteria 592
20 Ga0070660_100251710 3300005339 Bacteria 1441
21 Ga0070660_100544897 3300005339 Bacteria 967
22 Ga0070689_100064441 3300005340 Bacteria 2852
23 Ga0070689_100186004 3300005340 Bacteria 1689
24 Ga0070689_101080518 3300005340 Bacteria 716
25 Ga0070687_100569424 3300005343 Bacteria 773
26 Ga0070661_100102285 3300005344 Bacteria 2132
27 Ga0070661_100185946 3300005344 Bacteria 1583
28 Ga0070668_100338259 3300005347 Bacteria 1271
29 Ga0070669_100412010 3300005353 Bacteria 1108
30 Ga0070669_100793475 3300005353 Bacteria 804
31 Ga0070675_100158239 3300005354 Bacteria 1946
32 Ga0070675_100165627 3300005354 Bacteria 1903
33 Ga0070675_100277911 3300005354 Bacteria 1471
34 Ga0070675_101887836 3300005354 Bacteria 551
35 Ga0070671_100111043 3300005355 Bacteria 2303
36 Ga0070671_100907678 3300005355 Bacteria 770
37 Ga0070674_101824910 3300005356 Bacteria 552
38 Ga0070673_100081800 3300005364 Bacteria 2620
39 Ga0070673_101204223 3300005364 Bacteria 710
40 Ga0070688_100094932 3300005365 Bacteria 1956
41 Ga0070659_100092072 3300005366 Bacteria 2431
42 Ga0070659_101016059 3300005366 Bacteria 728
43 Ga0070659_101138933 3300005366 Bacteria 688
44 Ga0070667_100429918 3300005367 Bacteria 1205
45 Ga0070667_100435593 3300005367 Bacteria 1197
46 Ga0070709_10021709 3300005434 Bacteria 3743
47 Ga0070714_100029055 3300005435 Bacteria 4593
48 Ga0070714_101006904 3300005435 Unclassified 811
49 Ga0070713_100017481 3300005436 Bacteria 5424
50 Ga0070713_100090707 3300005436 Bacteria 2628
51 Ga0070713_100107029 3300005436 Bacteria 2432
52 Ga0070713_100326324 3300005436 Bacteria 1419
53 Ga0070713_102121741 3300005436 Bacteria 545
54 Ga0070710_10018873 3300005437 Bacteria 3555
55 Ga0070710_10029310 3300005437 Bacteria 2952
56 Ga0070710_10228182 3300005437 Bacteria 1188
57 Ga0070710_11522141 3300005437 Bacteria 503
58 Ga0070701_10316545 3300005438 Bacteria 964
59 Ga0070711_100275794 3300005439 Bacteria 1328
60 Ga0070711_100828388 3300005439 Bacteria 786
61 Ga0070711_101476586 3300005439 Bacteria 593
62 Ga0070705_100587951 3300005440 Bacteria 859
63 Ga0070700_100035982 3300005441 Bacteria 3000
64 Ga0070700_100150833 3300005441 Bacteria 1590
65 Ga0070700_100449649 3300005441 Bacteria 980
66 Ga0070700_100492989 3300005441 Bacteria 941
67 Ga0070694_100059721 3300005444 Bacteria 2598
68 Ga0070694_101470640 3300005444 Bacteria 576
69 Ga0070663_100563799 3300005455 Bacteria 953
70 Ga0070663_101203789 3300005455 Bacteria 666
71 Ga0070663_101545764 3300005455 Bacteria 591
72 Ga0070678_100061286 3300005456 Bacteria 2772
73 Ga0070678_100089777 3300005456 Bacteria 2353
74 Ga0070678_102210459 3300005456 Bacteria 522
75 Ga0070662_100735547 3300005457 Bacteria 836
76 Ga0070662_101126042 3300005457 Bacteria 674
77 Ga0068867_100031810 3300005459 Bacteria 3812
78 Ga0068867_100268422 3300005459 Bacteria 1394
79 Ga0068867_100654632 3300005459 Bacteria 922
80 Ga0068867_101640307 3300005459 Bacteria 602
81 Ga0070685_10066050 3300005466 Bacteria 2131
82 Ga0070707_102025876 3300005468 Bacteria 543
83 Ga0070684_100011059 3300005535 Bacteria 7178
84 Ga0070684_100185557 3300005535 Bacteria 1891
85 Ga0070684_101117926 3300005535 Bacteria 740
86 Ga0070684_101685873 3300005535 Bacteria 598
87 Ga0068853_100373588 3300005539 Bacteria 1330
88 Ga0068853_101948526 3300005539 Bacteria 570
89 Ga0070672_100303091 3300005543 Bacteria 1355
90 Ga0070672_100409326 3300005543 Bacteria 1163
91 Ga0070672_100413961 3300005543 Bacteria 1157
92 Ga0070672_100765924 3300005543 Bacteria 848
93 Ga0070672_100805436 3300005543 Bacteria 827
94 Ga0070672_101411383 3300005543 Bacteria 623
95 Ga0070672_101943531 3300005543 Bacteria 530
96 Ga0070686_100145702 3300005544 Bacteria 1653
97 Ga0070686_100210994 3300005544 Bacteria 1398
98 Ga0070686_100556878 3300005544 Bacteria 898
99 Ga0070686_100727806 3300005544 Bacteria 794
100 Ga0070695_100002139 3300005545 Bacteria 11330
101 Ga0070693_100214536 3300005547 Bacteria 1258
102 Ga0070693_100392550 3300005547 Bacteria 960
103 Ga0070665_100088644 3300005548 Bacteria 3100
104 Ga0070665_100121837 3300005548 Bacteria 2610
105 Ga0070665_100275493 3300005548 Bacteria 1684
106 Ga0070665_100628778 3300005548 Bacteria 1086
107 Ga0068855_100222013 3300005563 Bacteria 2118
108 Ga0068855_101434824 3300005563 Bacteria 710
109 Ga0070664_100038843 3300005564 Bacteria 4008
110 Ga0070664_100056973 3300005564 Bacteria 3321
111 Ga0070664_101995026 3300005564 Bacteria 551
112 Ga0068857_102473842 3300005577 Unclassified 510
113 Ga0068856_100041817 3300005614 Bacteria 4506
114 Ga0068856_100730242 3300005614 Bacteria 1011
115 Ga0068856_100813038 3300005614 Bacteria 954
116 Ga0070702_100209539 3300005615 Bacteria 1296
117 Ga0070702_100561622 3300005615 Bacteria 849
118 Ga0070702_101575098 3300005615 Bacteria 543
119 Ga0068852_100082655 3300005616 Bacteria 2854
120 Ga0068852_101605663 3300005616 Unclassified 673
121 Ga0068859_100154476 3300005617 Bacteria 2372
122 Ga0068859_100428876 3300005617 Bacteria 1418
123 Ga0068859_100694166 3300005617 Bacteria 1109
124 Ga0068859_101022953 3300005617 Bacteria 908
125 Ga0068864_100162386 3300005618 Bacteria 2031
126 Ga0068866_10270318 3300005718 Bacteria 1049
127 Ga0068861_100186629 3300005719 Bacteria 1730
128 Ga0068861_102039617 3300005719 Bacteria 573
129 Ga0068870_10588187 3300005840 Bacteria 755
130 Ga0068863_100754609 3300005841 Bacteria 969
131 Ga0068863_100755234 3300005841 Bacteria 969
132 Ga0068863_101549149 3300005841 Bacteria 672
133 Ga0068858_100058660 3300005842 Bacteria 3559
134 Ga0068860_100134130 3300005843 Bacteria 2377
135 Ga0068860_102398103 3300005843 Bacteria 548
136 Ga0068860_102626124 3300005843 Bacteria 523
137 Ga0068862_100103206 3300005844 Bacteria 2497
138 Ga0068862_100585322 3300005844 Bacteria 1069
139 Ga0068862_101172323 3300005844 Bacteria 766
140 Ga0081455_10000069 3300005937 Bacteria 111044
141 Ga0081455_10141429 3300005937 Bacteria 1868
142 Ga0081540_1000080 3300005983 Bacteria 103320
143 Ga0081540_1014173 3300005983 Bacteria 5128
144 Ga0081539_10003222 3300005985 Bacteria 20592
145 Ga0081539_10089877 3300005985 Bacteria 1590
146 Ga0081539_10256821 3300005985 Bacteria 773
147 Ga0070717_10002633 3300006028 Bacteria 12639
148 Ga0070717_10136985 3300006028 Bacteria 2109
149 Ga0070717_10972326 3300006028 Unclassified 773
150 Ga0075365_11078508 3300006038 Bacteria 565
151 Ga0075368_10465374 3300006042 Unclassified 561
152 Ga0075363_100392936 3300006048 Unclassified 814
153 Ga0075432_10066168 3300006058 Bacteria 1293
154 Ga0070715_10021901 3300006163 Bacteria 2485
155 Ga0070715_10032652 3300006163 Bacteria 2122
156 Ga0070716_100001521 3300006173 Bacteria 10382
157 Ga0070716_100454875 3300006173 Unclassified 934
158 Ga0070712_100027934 3300006175 Bacteria 3770
159 Ga0070712_100084213 3300006175 Bacteria 2311
160 Ga0070712_100366996 3300006175 Unclassified 1182
161 Ga0070712_100675777 3300006175 Bacteria 879
162 Ga0070712_101964958 3300006175 Bacteria 512
163 Ga0075367_10081149 3300006178 Bacteria 1962
164 Ga0097621_100130461 3300006237 Bacteria 2139
165 Ga0097621_100691316 3300006237 Bacteria 938
166 Ga0097621_101327732 3300006237 Bacteria 680
167 Ga0068871_100064471 3300006358 Bacteria 3000
168 Ga0068871_100073854 3300006358 Bacteria 2812
169 Ga0075428_100218789 3300006844 Bacteria 2057
170 Ga0075430_100116126 3300006846 Bacteria 2230
171 Ga0075430_100389239 3300006846 Bacteria 1150
172 Ga0075430_100836343 3300006846 Bacteria 758
173 Ga0075431_100031043 3300006847 Bacteria 5504
174 Ga0075431_100164321 3300006847 Bacteria 2282
175 Ga0075433_10001540 3300006852 Bacteria 17038
176 Ga0075434_100001062 3300006871 Bacteria 22435
177 Ga0075434_100076472 3300006871 Bacteria 3343
178 Ga0075434_100320852 3300006871 Bacteria 1569
179 Ga0075434_101303946 3300006871 Unclassified 737
180 Ga0075434_101499235 3300006871 Bacteria 684
181 Ga0075429_100252442 3300006880 Bacteria 1544
182 Ga0068865_100115801 3300006881 Bacteria 1985
183 Ga0068865_100138918 3300006881 Bacteria 1830
184 Ga0068865_100886618 3300006881 Bacteria 775
185 Ga0075436_100274426 3300006914 Bacteria 1205
186 Ga0097620_100154466 3300006931 Bacteria 2372
187 Ga0097620_100428878 3300006931 Bacteria 1418
188 Ga0097620_100694164 3300006931 Bacteria 1109
189 Ga0097620_101022873 3300006931 Bacteria 908
190 Ga0075435_100008763 3300007076 Bacteria 7282
191 Ga0075435_100259086 3300007076 Bacteria 1481
192 Ga0099795_10238984 3300007788 Bacteria 779
193 Ga0105251_10269418 3300009011 Bacteria 769
194 Ga0105251_10399013 3300009011 Bacteria 632
195 Ga0105240_10531629 3300009093 Bacteria 1303
196 Ga0105240_10641028 3300009093 Bacteria 1166
197 Ga0105240_12320022 3300009093 Bacteria 556
198 Ga0111539_10053564 3300009094 Bacteria 4802
199 Ga0111539_10077299 3300009094 Bacteria 3917
200 Ga0111539_10269469 3300009094 Bacteria 1982
201 Ga0111539_11163073 3300009094 Bacteria 896
202 Ga0105245_10220540 3300009098 Bacteria 1830
203 Ga0105245_10448643 3300009098 Bacteria 1298
204 Ga0105245_11698959 3300009098 Unclassified 684
205 Ga0105247_10015267 3300009101 Bacteria 4603
206 Ga0105247_10365402 3300009101 Bacteria 1019
207 Ga0105247_10462255 3300009101 Bacteria 917
208 Ga0105247_10493606 3300009101 Bacteria 891
209 Ga0114129_10722181 3300009147 Unclassified 1278
210 Ga0114129_11489941 3300009147 Bacteria 832
211 Ga0105243_10027418 3300009148 Bacteria 4365
212 Ga0105243_10142829 3300009148 Bacteria 2044
213 Ga0105243_10416715 3300009148 Bacteria 1251
214 Ga0105241_10201713 3300009174 Bacteria 1662
215 Ga0105241_10927603 3300009174 Bacteria 810
216 Ga0105241_11861204 3300009174 Bacteria 589
217 Ga0105241_12534421 3300009174 Bacteria 514
218 Ga0105242_10406372 3300009176 Bacteria 1272
219 Ga0105242_10938604 3300009176 Bacteria 868
220 Ga0105242_13108567 3300009176 Bacteria 515
221 Ga0105248_10227627 3300009177 Bacteria 2099
222 Ga0105237_10031800 3300009545 Bacteria 5345
223 Ga0105237_10208161 3300009545 Bacteria 1956
224 Ga0105237_10265237 3300009545 Bacteria 1720
225 Ga0105237_10809527 3300009545 Bacteria 944
226 Ga0105238_10009682 3300009551 Bacteria 9647
227 Ga0105238_10051881 3300009551 Bacteria 4124
228 Ga0105238_10106523 3300009551 Bacteria 2785
229 Ga0105238_10163953 3300009551 Bacteria 2198
230 Ga0105249_10543647 3300009553 Bacteria 1211
231 Ga0105249_10714159 3300009553 Bacteria 1063
232 Ga0105249_11104981 3300009553 Bacteria 863
233 Ga0099796_10586426 3300010159 Bacteria 502
234 Ga0105239_10159207 3300010375 Bacteria 2522
235 Ga0105239_10249373 3300010375 Bacteria 1994
236 Ga0105239_12274259 3300010375 Bacteria 631
237 Ga0105246_10176647 3300011119 Bacteria 1640
238 Ga0105246_11989369 3300011119 Bacteria 560
239 Ga0105246_12194543 3300011119 Bacteria 537
240 Ga0157344_1002160 3300012476 Bacteria 1019
241 Ga0157321_1007562 3300012487 Bacteria 768
242 Ga0157316_1003760 3300012510 Bacteria 1114
243 Ga0157370_10261535 3300013104 Bacteria 1599
244 Ga0157369_10549688 3300013105 Bacteria 1193
245 Ga0157369_11612656 3300013105 Bacteria 660
246 Ga0157374_10034212 3300013296 Bacteria 4640
247 Ga0157374_11825695 3300013296 Bacteria 633
248 Ga0157374_12968797 3300013296 Unclassified 501
249 Ga0157378_10380372 3300013297 Bacteria 1386
250 Ga0157378_12486485 3300013297 Bacteria 570
251 Ga0157378_12515361 3300013297 Bacteria 567
252 Ga0163162_10134376 3300013306 Bacteria 2584
253 Ga0163162_10446158 3300013306 Bacteria 1426
254 Ga0163162_10897165 3300013306 Bacteria 1000
255 Ga0163162_11443641 3300013306 Bacteria 783
256 Ga0163162_11878016 3300013306 Bacteria 685
257 Ga0163162_12239922 3300013306 Bacteria 627
258 Ga0157372_10128361 3300013307 Bacteria 2916
259 Ga0157372_11223024 3300013307 Bacteria 868
260 Ga0157372_11551305 3300013307 Bacteria 763
261 Ga0157372_11974895 3300013307 Bacteria 670
262 Ga0157372_12702991 3300013307 Bacteria 569
263 Ga0157375_10130268 3300013308 Bacteria 2634
264 Ga0157375_10246096 3300013308 Bacteria 1948
265 Ga0157375_10565758 3300013308 Bacteria 1297
266 Ga0163163_10047641 3300014325 Bacteria 4214
267 Ga0163163_10123585 3300014325 Bacteria 2624
268 Ga0163163_10215052 3300014325 Bacteria 1971
269 Ga0163163_10223100 3300014325 Bacteria 1934
270 Ga0163163_10627929 3300014325 Bacteria 1138
271 Ga0163163_11805730 3300014325 Unclassified 672
272 Ga0157380_10100720 3300014326 Bacteria 2406
273 Ga0157380_10715155 3300014326 Bacteria 1008
274 Ga0157380_12004279 3300014326 Bacteria 641
275 Ga0182008_10069695 3300014497 Bacteria 1730
276 Ga0182008_10861605 3300014497 Bacteria 530
277 Ga0157377_10528577 3300014745 Bacteria 829
278 Ga0157377_10601123 3300014745 Bacteria 785
279 Ga0157377_11576560 3300014745 Bacteria 525
280 Ga0157379_10290957 3300014968 Bacteria 1488
281 Ga0157379_10358796 3300014968 Bacteria 1335
282 Ga0157379_11117167 3300014968 Bacteria 755
283 Ga0157379_11466470 3300014968 Bacteria 663
284 Ga0157376_10374843 3300014969 Bacteria 1369
285 Ga0157376_10546672 3300014969 Bacteria 1145
286 Ga0157376_10994672 3300014969 Bacteria 861
287 Ga0157376_11529942 3300014969 Bacteria 700
288 Ga0157376_12488896 3300014969 Bacteria 557
289 Ga0163161_10073779 3300017792 Bacteria 2501
290 Ga0163161_10175544 3300017792 Unclassified 1640
291 Ga0163161_10502662 3300017792 Bacteria 987
292 Ga0206353_10061467 3300020082 Bacteria 762
293 Ga0213874_10379608 3300021377 Bacteria 546
294 Ga0213871_10085708 3300021441 Bacteria 908
295 Ga0207692_10000597 3300025898 Bacteria 12800
296 Ga0207692_10157621 3300025898 Bacteria 1306
297 Ga0207692_10208113 3300025898 Unclassified 1153
298 Ga0207692_10478269 3300025898 Bacteria 788
299 Ga0207710_10094401 3300025900 Bacteria 1404
300 Ga0207710_10467450 3300025900 Bacteria 652
301 Ga0207688_10036233 3300025901 Bacteria 2735
302 Ga0207680_10171209 3300025903 Bacteria 1463
303 Ga0207680_10269975 3300025903 Bacteria 1179
304 Ga0207685_10002398 3300025905 Bacteria 4284
305 Ga0207685_10500094 3300025905 Bacteria 640
306 Ga0207699_10167214 3300025906 Bacteria 1469
307 Ga0207699_10790917 3300025906 Bacteria 697
308 Ga0207645_10044514 3300025907 Bacteria 2840
309 Ga0207645_10118304 3300025907 Bacteria 1719
310 Ga0207645_10550779 3300025907 Bacteria 782
311 Ga0207684_11527734 3300025910 Bacteria 543
312 Ga0207654_10563583 3300025911 Bacteria 810
313 Ga0207654_11357841 3300025911 Bacteria 518
314 Ga0207671_10037323 3300025914 Bacteria 3603
315 Ga0207671_10150800 3300025914 Bacteria 1796
316 Ga0207693_10017333 3300025915 Bacteria 5743
317 Ga0207693_10028294 3300025915 Bacteria 4429
318 Ga0207693_11404546 3300025915 Bacteria 518
319 Ga0207663_10259913 3300025916 Bacteria 1282
320 Ga0207663_10510076 3300025916 Bacteria 935
321 Ga0207663_10658285 3300025916 Bacteria 827
322 Ga0207663_10789753 3300025916 Bacteria 756
323 Ga0207663_11563550 3300025916 Bacteria 531
324 Ga0207660_11496415 3300025917 Bacteria 545
325 Ga0207660_11647658 3300025917 Bacteria 516
326 Ga0207662_10567500 3300025918 Bacteria 787
327 Ga0207657_10115291 3300025919 Bacteria 2214
328 Ga0207657_10420152 3300025919 Bacteria 1051
329 Ga0207649_10344545 3300025920 Bacteria 1101
330 Ga0207649_11033540 3300025920 Bacteria 647
331 Ga0207681_10088392 3300025923 Bacteria 2207
332 Ga0207681_11583812 3300025923 Bacteria 549
333 Ga0207694_10065803 3300025924 Bacteria 2827
334 Ga0207694_10084860 3300025924 Bacteria 2491
335 Ga0207694_10178060 3300025924 Bacteria 1723
336 Ga0207650_10542900 3300025925 Bacteria 974
337 Ga0207650_10614346 3300025925 Bacteria 915
338 Ga0207659_10123019 3300025926 Bacteria 1991
339 Ga0207659_10284994 3300025926 Bacteria 1352
340 Ga0207687_10034717 3300025927 Bacteria 3426
341 Ga0207687_10501681 3300025927 Bacteria 1013
342 Ga0207687_10590027 3300025927 Bacteria 935
343 Ga0207700_10016861 3300025928 Bacteria 4864
344 Ga0207700_10066274 3300025928 Bacteria 2759
345 Ga0207700_10131086 3300025928 Bacteria 2047
346 Ga0207700_10482827 3300025928 Bacteria 1095
347 Ga0207664_10046442 3300025929 Bacteria 3408
348 Ga0207664_10254722 3300025929 Unclassified 1533
349 Ga0207664_10262785 3300025929 Bacteria 1510
350 Ga0207664_10884328 3300025929 Bacteria 802
351 Ga0207664_11849660 3300025929 Bacteria 526
352 Ga0207664_11940944 3300025929 Bacteria 511
353 Ga0207644_10009076 3300025931 Bacteria 6519
354 Ga0207644_10272178 3300025931 Bacteria 1357
355 Ga0207706_10779318 3300025933 Bacteria 813
356 Ga0207686_10162836 3300025934 Bacteria 1565
357 Ga0207686_10824491 3300025934 Bacteria 745
358 Ga0207709_10417499 3300025935 Bacteria 1030
359 Ga0207670_10440145 3300025936 Bacteria 1049
360 Ga0207670_10450064 3300025936 Bacteria 1038
361 Ga0207704_10121021 3300025938 Bacteria 1791
362 Ga0207704_11261322 3300025938 Bacteria 631
363 Ga0207665_10003014 3300025939 Bacteria 11306
364 Ga0207691_10407442 3300025940 Bacteria 1159
365 Ga0207691_10578258 3300025940 Bacteria 952
366 Ga0207691_11192928 3300025940 Bacteria 631
367 Ga0207711_10148257 3300025941 Bacteria 2115
368 Ga0207711_10219544 3300025941 Bacteria 1738
369 Ga0207711_11569673 3300025941 Bacteria 601
370 Ga0207689_10259091 3300025942 Bacteria 1439
371 Ga0207661_10147158 3300025944 Bacteria 2033
372 Ga0207661_10409938 3300025944 Bacteria 1230
373 Ga0207679_10241862 3300025945 Bacteria 1530
374 Ga0207679_10872683 3300025945 Bacteria 822
375 Ga0207667_10227351 3300025949 Bacteria 1911
376 Ga0207667_11192620 3300025949 Bacteria 741
377 Ga0207651_10530260 3300025960 Bacteria 1021
378 Ga0207651_10867046 3300025960 Bacteria 803
379 Ga0207651_11004890 3300025960 Bacteria 745
380 Ga0207712_10282647 3300025961 Bacteria 1355
381 Ga0207668_10202207 3300025972 Bacteria 1583
382 Ga0207668_10554319 3300025972 Bacteria 996
383 Ga0207668_11099026 3300025972 Bacteria 713
384 Ga0207677_10270054 3300026023 Bacteria 1391
385 Ga0207703_10300273 3300026035 Bacteria 1464
386 Ga0207639_10188855 3300026041 Bacteria 1758
387 Ga0207678_10017092 3300026067 Bacteria 6370
388 Ga0207678_11232227 3300026067 Bacteria 662
389 Ga0207678_11436022 3300026067 Bacteria 610
390 Ga0207708_10066701 3300026075 Bacteria 2751
391 Ga0207708_10412803 3300026075 Bacteria 1118
392 Ga0207708_10564590 3300026075 Bacteria 961
393 Ga0207708_10841283 3300026075 Bacteria 792
394 Ga0207702_10206829 3300026078 Bacteria 1822
395 Ga0207702_10235526 3300026078 Bacteria 1713
396 Ga0207641_10061748 3300026088 Bacteria 3196
397 Ga0207641_11956892 3300026088 Bacteria 588
398 Ga0207648_10149250 3300026089 Bacteria 2062
399 Ga0207648_11557218 3300026089 Bacteria 621
400 Ga0207676_10214099 3300026095 Bacteria 1711
401 Ga0207676_11818968 3300026095 Bacteria 608
402 Ga0207676_11901535 3300026095 Bacteria 594
403 Ga0207674_11478154 3300026116 Bacteria 649
404 Ga0207675_101190535 3300026118 Bacteria 782
405 Ga0207675_101295459 3300026118 Bacteria 749
406 Ga0207683_10001712 3300026121 Bacteria 19628
407 Ga0207683_10022411 3300026121 Bacteria 5422
408 Ga0207698_12371709 3300026142 Unclassified 542
409 Ga0209179_1084935 3300027512 Bacteria 700
410 Ga0207428_10087324 3300027907 Bacteria 2427
411 Ga0207428_10639896 3300027907 Unclassified 764
412 Ga0207428_10664147 3300027907 Bacteria 747
413 Ga0268266_10027147 3300028379 Bacteria 4870
414 Ga0268266_10059492 3300028379 Bacteria 3292
415 Ga0268266_10157732 3300028379 Bacteria 2051
416 Ga0268266_10223753 3300028379 Bacteria 1731
417 Ga0268264_10307277 3300028381 Bacteria 1495
418 Ga0268264_11184324 3300028381 Unclassified 773
419 Ga0268264_11801593 3300028381 Bacteria 622
420 Ga0265338_10885305 3300028800 Bacteria 609
421 Ga0265332_10178004 3300031238 Bacteria 886
422 Ga0265320_10061021 3300031240 Bacteria 1798
423 Ga0265320_10061866 3300031240 Bacteria 1783
424 Ga0265329_10175065 3300031242 Bacteria 701
425 Ga0265329_10267754 3300031242 Bacteria 572
426 Ga0307410_10707599 3300031852 Bacteria 850
427 Ga0373930_0154610 3300034816 Bacteria 577
428 Ga0373930_0166401 3300034816 Bacteria 560
429 Ga0373948_0054765 3300034817 Bacteria 864
430 Ga0373958_0078926 3300034819 Bacteria 742
431 Ga0373959_0140577 3300034820 Unclassified 604
432 Ga0373938_0179941 3300034957 Bacteria 577
433 Ga0373928_0189447 3300035084 Bacteria 588
434 Ga0373929_0005469 3300035085 Bacteria 2287
435 Ga0373940_0013754 3300035088 Bacteria 1965
436 Ga0373949_0099155 3300035090 Bacteria 796
437 Ga0373949_0186020 3300035090 Unclassified 617
438 Ga0373951_0028374 3300035091 Bacteria 1311
439 Ga0373951_0127865 3300035091 Bacteria 696
440 Ga0373952_0177385 3300035092 Bacteria 612
441 Ga0373932_0035972 3300035112 Bacteria 1403
442 Ga0373932_0071121 3300035112 Bacteria 1079
443 Ga0373932_0123851 3300035112 Unclassified 865
444 Ga0373936_0022479 3300035113 Bacteria 2455
445 Ga0373936_0207505 3300035113 Unclassified 866
446 Ga0373939_0006537 3300035114 Bacteria 2811
447 Ga0373939_0072205 3300035114 Unclassified 1127
448 Ga0373941_0022815 3300035115 Bacteria 1781
449 Ga0373941_0033670 3300035115 Bacteria 1541
450 Ga0373941_0165682 3300035115 Unclassified 820
451 Ga0373945_0340391 3300035116 Bacteria 649
452 Ga0373960_0013179 3300035121 Bacteria 2069
453 Ga0373960_0014576 3300035121 Bacteria 1994
454 Ga0373960_0121936 3300035121 Unclassified 866
455 Ga0373960_0418114 3300035121 Bacteria 520
456 Ga0373943_0042998 3300035170 Bacteria 2192
457 Ga0373946_0040515 3300035171 Bacteria 1906
458 Ga0373946_0180375 3300035171 Bacteria 1002
459 Ga0373946_0374573 3300035171 Bacteria 715
460 Ga0373955_0027385 3300035172 Bacteria 2946
461 Ga0373942_0008981 3300035207 Bacteria 2336
462 Ga0373961_0010008 3300035241 Unclassified 2331
463 Ga0373961_0021172 3300035241 Bacteria 1727
464 Ga0373961_0096942 3300035241 Bacteria 950
465 Ga0373931_0001394 3300035691 Bacteria 10355
466 Ga0373931_0007132 3300035691 Bacteria 5257
467 Ga0373931_0494691 3300035691 Bacteria 788
468 Ga0373931_0543399 3300035691 Bacteria 754
469 Ga0373935_0039113 3300035692 Bacteria 2972
470 Ga0373935_0150461 3300035692 Bacteria 1579
471 Ga0373935_1101900 3300035692 Unclassified 591
472 Ga0373935_1317559 3300035692 Bacteria 539
473 Ga0373927_0017182 3300035695 Unclassified 4766
474 Ga0373927_0090593 3300035695 Bacteria 1986
475 Ga0373927_0110902 3300035695 Bacteria 1787
476 Ga0373927_0587394 3300035695 Bacteria 736
477 Ga0373927_0860493 3300035695 Unclassified 598
478 Ga0373933_1113923 3300035724 Bacteria 520
479 Ga0373947_0007622 3300035725 Bacteria 6264
480 Ga0373947_0227290 3300035725 Bacteria 1228
481 Ga0373937_0910905 3300036401 Bacteria 828
482 Ga0373925_0010435 3300037068 Bacteria 6739
483 Ga0373925_0098755 3300037068 Bacteria 2241
484 Ga0373925_0108927 3300037068 Bacteria 2138
485 Ga0373925_0727572 3300037068 Bacteria 818
486 Ga0373925_0932548 3300037068 Unclassified 715
487 Ga0395899_0063076 3300037312 Bacteria 2727
488 Ga0395899_0218959 3300037312 Bacteria 1319
489 Ga0395900_0245914 3300037418 Bacteria 1792
490 Ga0395900_0390663 3300037418 Bacteria 1357
491 Ga0395898_0232628 3300037466 Bacteria 1757
492 Ga0436360_0384754 3300039438 Bacteria 859
493 Ga0436360_0511379 3300039438 Bacteria 549
494 Ga0436360_0939981 3300039438 Bacteria 651
495 Ga0436360_1231394 3300039438 Bacteria 765
496 Ga0436360_1251955 3300039438 Bacteria 1970
497 Ga0436363_0463420 3300039450 Unclassified 649
498 Ga0436363_1295325 3300039450 Bacteria 949
499 Ga0436363_1310107 3300039450 Bacteria 596
500 Ga0451793_0249486 3300041452 Bacteria 580
501 Ga0451807_1921160 3300041486 Bacteria 641
502 Ga0451835_0673288 3300041492 Bacteria 582
503 Ga0466963_0009031 3300044694 Bacteria 5988
504 Ga0466964_0542902 3300044706 Bacteria 630
505 Ga0466968_0482774 3300044735 Bacteria 616
506 Ga0466957_0115228 3300044842 Bacteria 1708
507 Ga0451576_1006086 3300045051 Bacteria 874
508 Ga0466967_0052746 3300045976 Bacteria 3571
509 Ga0495592_0041060 3300046454 Bacteria 3468
510 Ga0495603_0028699 3300046455 Bacteria 3357
511 Ga0495603_0061764 3300046455 Bacteria 2212
512 Ga0495603_0334886 3300046455 Unclassified 868
513 Ga0495629_0001552 3300046459 Bacteria 18040
514 Ga0495629_0254215 3300046459 Bacteria 1208
515 Ga0495641_0009545 3300046461 Bacteria 5753
516 Ga0495651_0352825 3300046462 Bacteria 972
517 Ga0495653_0098094 3300046463 Unclassified 2128
518 Ga0495653_0381464 3300046463 Bacteria 900
519 Ga0495650_0309050 3300046471 Bacteria 528
520 Ga0495580_0022927 3300046472 Unclassified 4589
521 Ga0495580_1017365 3300046472 Bacteria 527
522 Ga0495582_0039601 3300046473 Bacteria 2594
523 Ga0495582_0085220 3300046473 Bacteria 1757
524 Ga0495639_0008987 3300046475 Unclassified 4283
525 Ga0495639_0126788 3300046475 Bacteria 1220
526 Ga0495639_0369258 3300046475 Bacteria 722
527 Ga0495662_0025820 3300046476 Unclassified 2837
528 Ga0495662_0545829 3300046476 Bacteria 568
529 Ga0495584_0069428 3300046491 Bacteria 1771
530 Ga0495585_0014505 3300046492 Plasmid 4588
531 Ga0495594_0064579 3300046499 Bacteria 2029
532 Ga0495594_0080168 3300046499 Bacteria 1822
533 Ga0495607_0011263 3300046501 Bacteria 5965
534 Ga0495616_0073374 3300046513 Unclassified 1651
535 Ga0495618_0054124 3300046514 Bacteria 2538
536 Ga0495630_0153836 3300046517 Bacteria 1750
537 Ga0495637_0019677 3300046520 Unclassified 3118
538 Ga0495644_0001007 3300046523 Bacteria 11735
539 Ga0495663_0003699 3300046525 Bacteria 4374
540 Ga0495666_0103890 3300046526 Bacteria 1338
541 Ga0495652_0645637 3300046529 Unclassified 717
542 Ga0495640_0156890 3300046533 Unclassified 1460
543 Ga0495587_0036940 3300046536 Unclassified 2936
544 Ga0495598_0249791 3300046537 Bacteria 656
545 Ga0495621_0051994 3300046539 Unclassified 1467
546 Ga0495622_0004771 3300046557 Bacteria 6280
547 Ga0495633_0004191 3300046558 Bacteria 9253
548 Ga0495656_0003817 3300046615 Bacteria 5122
549 Ga0495611_0025323 3300046648 Unclassified 2585
550 Ga0495659_0000937 3300046664 Bacteria 10349
551 Ga0495661_0088317 3300046665 Bacteria 1770
552 Ga0495599_0148158 3300046678 Bacteria 1454
553 Ga0495646_0023718 3300046680 Unclassified 3861
554 Ga0495647_0007588 3300046681 Bacteria 3641
555 Ga0495647_0022787 3300046681 Bacteria 2265
556 Ga0495647_0079595 3300046681 Bacteria 1327
557 Ga0495658_0025714 3300046683 Bacteria 3149
558 Ga0495658_0039249 3300046683 Unclassified 2626
559 Ga0495658_0063402 3300046683 Bacteria 2127
560 Ga0495613_0010730 3300046689 Bacteria 6795
561 Ga0495613_0114776 3300046689 Bacteria 1938
562 Ga0495624_0324252 3300046690 Unclassified 927
563 Ga0495670_0001110 3300046691 Bacteria 13063
564 Ga0495600_0741061 3300046809 Bacteria 589
565 Ga0495581_0029591 3300047315 Bacteria 3174
566 Ga0495581_0037457 3300047315 Bacteria 2807
567 Ga0495604_0014339 3300047317 Bacteria 6321
568 Ga0495636_0015624 3300047318 Bacteria 3026
569 Ga0495674_0139316 3300047319 Bacteria 2040
570 Ga0495676_0094356 3300047321 Bacteria 2229
571 Ga0495676_0427006 3300047321 Unclassified 876
572 Ga0495680_0030745 3300047322 Bacteria 4380
573 Ga0495679_162564 3300047446 Bacteria 596
574 Ga0495684_0417658 3300047471 Bacteria 938
575 Ga0495593_0008606 3300047673 Bacteria 5935
576 Ga0495614_0113235 3300048089 Bacteria 1192
577 Ga0496100_0028430 3300048903 Bacteria 3448
578 Ga0496100_0070590 3300048903 Bacteria 2329
579 Ga0496100_0192325 3300048903 Bacteria 1482
580 Ga0496101_0030674 3300048904 Bacteria 3772
581 Ga0496101_0139938 3300048904 Bacteria 1844
582 Ga0496102_0743625 3300048905 Bacteria 904
583 Ga0496102_0797682 3300048905 Unclassified 867
584 Ga0496102_0824955 3300048905 Bacteria 850
585 Ga0496103_0215542 3300048906 Bacteria 1234
586 Ga0496104_0029111 3300048907 Bacteria 5122
587 Ga0496104_0085840 3300048907 Bacteria 3004
588 Ga0496104_0648772 3300048907 Unclassified 964
589 Ga0496104_0661467 3300048907 Bacteria 953
590 Ga0496104_1155499 3300048907 Bacteria 677
591 Ga0496105_0030599 3300048908 Bacteria 4411
592 Ga0496105_0051361 3300048908 Bacteria 3406
593 Ga0496105_0135300 3300048908 Bacteria 2030
594 Ga0496105_0169449 3300048908 Bacteria 1790
595 Ga0496105_0171225 3300048908 Bacteria 1780
596 Ga0496106_0231134 3300048909 Bacteria 1476
597 Ga0496106_0420574 3300048909 Bacteria 1074
598 Ga0496106_1093401 3300048909 Bacteria 625
599 Ga0496107_0110767 3300048910 Bacteria 2017
600 Ga0496107_1222863 3300048910 Bacteria 539
601 Ga0496108_0194325 3300048911 Bacteria 1759
602 Ga0496108_0433835 3300048911 Bacteria 1147
603 Ga0496109_0004891 3300048912 Bacteria 11189
604 Ga0496109_0053933 3300048912 Bacteria 3668
605 Ga0496109_0135855 3300048912 Bacteria 2297
606 Ga0496109_0316288 3300048912 Bacteria 1473
607 Ga0496110_0030492 3300048913 Bacteria 4649
608 Ga0496110_0033520 3300048913 Bacteria 4442
609 Ga0496110_0308093 3300048913 Bacteria 1442
610 Ga0496110_0617778 3300048913 Bacteria 982
611 Ga0496111_0880394 3300048914 Unclassified 645
612 Ga0496112_0103246 3300048915 Bacteria 2820
613 Ga0496112_0154289 3300048915 Bacteria 2264
614 Ga0496112_0207803 3300048915 Bacteria 1915
615 Ga0496112_1194422 3300048915 Bacteria 677
616 Ga0496113_0035081 3300048916 Bacteria 3665
617 Ga0496113_0107316 3300048916 Bacteria 2169
618 Ga0496113_0547155 3300048916 Bacteria 928
619 Ga0496113_1018920 3300048916 Bacteria 652
620 Ga0496113_1558957 3300048916 Bacteria 509
621 Ga0496114_0019242 3300048917 Bacteria 5531
622 Ga0496115_0046769 3300048918 Bacteria 3459
623 Ga0496115_0074487 3300048918 Bacteria 2756
624 Ga0496115_0167147 3300048918 Bacteria 1819
625 Ga0496115_1059468 3300048918 Unclassified 617
626 Ga0496119_0279824 3300048922 Bacteria 830
627 Ga0496121_0765645 3300048924 Bacteria 572
628 Ga0496124_0605555 3300048927 Bacteria 712
629 Ga0501034_0001879 3300049571 Bacteria 26611
630 Ga0501034_0004530 3300049571 Bacteria 15448
631 Ga0501034_0144030 3300049571 Bacteria 2361
632 Ga0501034_0417554 3300049571 Bacteria 1263
633 Ga0501034_0498566 3300049571 Bacteria 1131
634 Ga0501034_1013234 3300049571 Bacteria 714
635 Ga0501034_1358296 3300049571 Bacteria 586
636 Ga0501034_1554029 3300049571 Bacteria 535
637 Ga0501037_0292851 3300049573 Bacteria 1132
638 Ga0501043_0285757 3300049579 Bacteria 1264
639 Ga0501046_0326252 3300049580 Bacteria 1118
640 Ga0501046_1033749 3300049580 Bacteria 569
641 Ga0501047_0335463 3300049581 Bacteria 1350
642 Ga0501068_0236578 3300049584 Bacteria 1162
643 Ga0501069_0535128 3300049585 Unclassified 700
644 Ga0501217_337906 3300049661 Bacteria 505
645 Ga0501035_1169749 3300049822 Bacteria 598
646 Ga0501044_0081785 3300049823 Bacteria 3269
647 Ga0501044_1317774 3300049823 Bacteria 588
648 nmdc:mga03n38_314679_c1 3300050490 Unclassified 844
649 nmdc:mga05p37_235597_c1 3300050507 Bacteria 2203
650 nmdc:mga0qj67_11402_c1 3300050509 Bacteria 6660
651 nmdc:mga0qj67_36168_c1 3300050509 Bacteria 3863
652 nmdc:mga06r32_1576251_c1 3300050510 Bacteria 596
653 nmdc:mga06r32_223388_c1 3300050510 Bacteria 1872
654 nmdc:mga06r32_9732_c1 3300050510 Bacteria 8682
655 nmdc:mga08y16_150797_c1 3300050511 Bacteria 2416
656 nmdc:mga08y16_176408_c1 3300050511 Unclassified 2219
657 nmdc:mga08y16_341745_c1 3300050511 Bacteria 1539
658 nmdc:mga08y16_42288_c1 3300050511 Bacteria 4773
659 nmdc:mga0n895_116515_c1 3300050512 Bacteria 2690
660 nmdc:mga0n895_4878_c1 3300050512 Bacteria 11111
661 nmdc:mga0n895_989387_c1 3300050512 Bacteria 823
662 nmdc:mga0rr50_38384_c1 3300050513 Bacteria 3465
663 nmdc:mga0rr50_60275_c1 3300050513 Bacteria 2854
664 nmdc:mga08x19_227436_c1 3300050514 Bacteria 1283
665 nmdc:mga0a205_1877_c1 3300050515 Bacteria 18205
666 Ga0495601_0602148 3300053077 Unclassified 705
667 Ga0495601_0936071 3300053077 Unclassified 546
668 Ga0495601_0947205 3300053077 Bacteria 543
669 Ga0495619_0001748 3300053085 Bacteria 14434
670 Ga0495619_0049239 3300053085 Unclassified 2778
671 Ga0500644_0012961 3300053088 Bacteria 2318
672 Ga0500595_045876 3300053119 Bacteria 1378
673 Ga0070665_101688370
674 JGI25405J52794_10003649
675 JGI25405J52794_10094052
676 Ga0065707_10235969
677 Ga0070676_10461910
678 Ga0070683_100034047
679 Ga0070683_100253279
680 Ga0070683_100341449
681 Ga0070670_100190319
682 Ga0070670_101952619
683 Ga0070677_10635201
684 Ga0068869_100731510
685 Ga0070666_10017204
686 Ga0070666_10654873
687 Ga0070666_11298042
688 Ga0070680_100572499
689 Ga0070682_100260674
690 Ga0068868_100270464
691 Ga0068868_101717516
692 Ga0070660_100251710
693 Ga0070660_100544897
694 Ga0070689_100064441
695 Ga0070689_100186004
696 Ga0070689_101080518
697 Ga0070687_100569424
698 Ga0070661_100102285
699 Ga0070661_100185946
700 Ga0070668_100338259
701 Ga0070669_100412010
702 Ga0070669_100793475
703 Ga0070675_100158239
704 Ga0070675_100165627
705 Ga0070675_100277911
706 Ga0070675_101887836
707 Ga0070671_100111043
708 Ga0070671_100907678
709 Ga0070674_101824910
710 Ga0070673_100081800
711 Ga0070673_101204223
712 Ga0070688_100094932
713 Ga0070659_100092072
714 Ga0070659_101016059
715 Ga0070659_101138933
716 Ga0070667_100429918
717 Ga0070667_100435593
718 Ga0070709_10021709
719 Ga0070714_100029055
720 Ga0070714_101006904
721 Ga0070713_100017481
722 Ga0070713_100090707
723 Ga0070713_100107029
724 Ga0070713_100326324
725 Ga0070713_102121741
726 Ga0070710_10018873
727 Ga0070710_10029310
728 Ga0070710_10228182
729 Ga0070710_11522141
730 Ga0070701_10316545
731 Ga0070711_100275794
732 Ga0070711_100828388
733 Ga0070711_101476586
734 Ga0070705_100587951
735 Ga0070700_100035982
736 Ga0070700_100150833
737 Ga0070700_100449649
738 Ga0070700_100492989
739 Ga0070694_100059721
740 Ga0070694_101470640
741 Ga0070663_100563799
742 Ga0070663_101203789
743 Ga0070663_101545764
744 Ga0070678_100061286
745 Ga0070678_100089777
746 Ga0070678_102210459
747 Ga0070662_100735547
748 Ga0070662_101126042
749 Ga0068867_100031810
750 Ga0068867_100268422
751 Ga0068867_100654632
752 Ga0068867_101640307
753 Ga0070685_10066050
754 Ga0070707_102025876
755 Ga0070684_100011059
756 Ga0070684_100185557
757 Ga0070684_101117926
758 Ga0070684_101685873
759 Ga0068853_100373588
760 Ga0068853_101948526
761 Ga0070672_100303091
762 Ga0070672_100409326
763 Ga0070672_100413961
764 Ga0070672_100765924
765 Ga0070672_100805436
766 Ga0070672_101411383
767 Ga0070672_101943531
768 Ga0070686_100145702
769 Ga0070686_100210994
770 Ga0070686_100556878
771 Ga0070686_100727806
772 Ga0070695_100002139
773 Ga0070693_100214536
774 Ga0070693_100392550
775 Ga0070665_100088644
776 Ga0070665_100121837
777 Ga0070665_100275493
778 Ga0070665_100628778
779 Ga0068855_100222013
780 Ga0068855_101434824
781 Ga0070664_100038843
782 Ga0070664_100056973
783 Ga0070664_101995026
784 Ga0068857_102473842
785 Ga0068856_100041817
786 Ga0068856_100730242
787 Ga0068856_100813038
788 Ga0070702_100209539
789 Ga0070702_100561622
790 Ga0070702_101575098
791 Ga0068852_100082655
792 Ga0068852_101605663
793 Ga0068859_100154476
794 Ga0068859_100428876
795 Ga0068859_100694166
796 Ga0068859_101022953
797 Ga0068864_100162386
798 Ga0068866_10270318
799 Ga0068861_100186629
800 Ga0068861_102039617
801 Ga0068870_10588187
802 Ga0068863_100754609
803 Ga0068863_100755234
804 Ga0068863_101549149
805 Ga0068858_100058660
806 Ga0068860_100134130
807 Ga0068860_102398103
808 Ga0068860_102626124
809 Ga0068862_100103206
810 Ga0068862_100585322
811 Ga0068862_101172323
812 Ga0081455_10000069
813 Ga0081455_10141429
814 Ga0081540_1000080
815 Ga0081540_1014173
816 Ga0081539_10003222
817 Ga0081539_10089877
818 Ga0081539_10256821
819 Ga0070717_10002633
820 Ga0070717_10136985
821 Ga0070717_10972326
822 Ga0075365_11078508
823 Ga0075368_10465374
824 Ga0075363_100392936
825 Ga0075432_10066168
826 Ga0070715_10021901
827 Ga0070715_10032652
828 Ga0070716_100001521
829 Ga0070716_100454875
830 Ga0070712_100027934
831 Ga0070712_100084213
832 Ga0070712_100366996
833 Ga0070712_100675777
834 Ga0070712_101964958
835 Ga0075367_10081149
836 Ga0097621_100130461
837 Ga0097621_100691316
838 Ga0097621_101327732
839 Ga0068871_100064471
840 Ga0068871_100073854
841 Ga0075428_100218789
842 Ga0075430_100116126
843 Ga0075430_100389239
844 Ga0075430_100836343
845 Ga0075431_100031043
846 Ga0075431_100164321
847 Ga0075433_10001540
848 Ga0075434_100001062
849 Ga0075434_100076472
850 Ga0075434_100320852
851 Ga0075434_101303946
852 Ga0075434_101499235
853 Ga0075429_100252442
854 Ga0068865_100115801
855 Ga0068865_100138918
856 Ga0068865_100886618
857 Ga0075436_100274426
858 Ga0097620_100154466
859 Ga0097620_100428878
860 Ga0097620_100694164
861 Ga0097620_101022873
862 Ga0075435_100008763
863 Ga0075435_100259086
864 Ga0099795_10238984
865 Ga0105251_10269418
866 Ga0105251_10399013
867 Ga0105240_10531629
868 Ga0105240_10641028
869 Ga0105240_12320022
870 Ga0111539_10053564
871 Ga0111539_10077299
872 Ga0111539_10269469
873 Ga0111539_11163073
874 Ga0105245_10220540
875 Ga0105245_10448643
876 Ga0105245_11698959
877 Ga0105247_10015267
878 Ga0105247_10365402
879 Ga0105247_10462255
880 Ga0105247_10493606
881 Ga0114129_10722181
882 Ga0114129_11489941
883 Ga0105243_10027418
884 Ga0105243_10142829
885 Ga0105243_10416715
886 Ga0105241_10201713
887 Ga0105241_10927603
888 Ga0105241_11861204
889 Ga0105241_12534421
890 Ga0105242_10406372
891 Ga0105242_10938604
892 Ga0105242_13108567
893 Ga0105248_10227627
894 Ga0105237_10031800
895 Ga0105237_10208161
896 Ga0105237_10265237
897 Ga0105237_10809527
898 Ga0105238_10009682
899 Ga0105238_10051881
900 Ga0105238_10106523
901 Ga0105238_10163953
902 Ga0105249_10543647
903 Ga0105249_10714159
904 Ga0105249_11104981
905 Ga0099796_10586426
906 Ga0105239_10159207
907 Ga0105239_10249373
908 Ga0105239_12274259
909 Ga0105246_10176647
910 Ga0105246_11989369
911 Ga0105246_12194543
912 Ga0157344_1002160
913 Ga0157321_1007562
914 Ga0157316_1003760
915 Ga0157370_10261535
916 Ga0157369_10549688
917 Ga0157369_11612656
918 Ga0157374_10034212
919 Ga0157374_11825695
920 Ga0157374_12968797
921 Ga0157378_10380372
922 Ga0157378_12486485
923 Ga0157378_12515361
924 Ga0163162_10134376
925 Ga0163162_10446158
926 Ga0163162_10897165
927 Ga0163162_11443641
928 Ga0163162_11878016
929 Ga0163162_12239922
930 Ga0157372_10128361
931 Ga0157372_11223024
932 Ga0157372_11551305
933 Ga0157372_11974895
934 Ga0157372_12702991
935 Ga0157375_10130268
936 Ga0157375_10246096
937 Ga0157375_10565758
938 Ga0163163_10047641
939 Ga0163163_10123585
940 Ga0163163_10215052
941 Ga0163163_10223100
942 Ga0163163_10627929
943 Ga0163163_11805730
944 Ga0157380_10100720
945 Ga0157380_10715155
946 Ga0157380_12004279
947 Ga0182008_10069695
948 Ga0182008_10861605
949 Ga0157377_10528577
950 Ga0157377_10601123
951 Ga0157377_11576560
952 Ga0157379_10290957
953 Ga0157379_10358796
954 Ga0157379_11117167
955 Ga0157379_11466470
956 Ga0157376_10374843
957 Ga0157376_10546672
958 Ga0157376_10994672
959 Ga0157376_11529942
960 Ga0157376_12488896
961 Ga0163161_10073779
962 Ga0163161_10175544
963 Ga0163161_10502662
964 Ga0206353_10061467
965 Ga0213874_10379608
966 Ga0213871_10085708
967 Ga0207692_10000597
968 Ga0207692_10157621
969 Ga0207692_10208113
970 Ga0207692_10478269
971 Ga0207710_10094401
972 Ga0207710_10467450
973 Ga0207688_10036233
974 Ga0207680_10171209
975 Ga0207680_10269975
976 Ga0207685_10002398
977 Ga0207685_10500094
978 Ga0207699_10167214
979 Ga0207699_10790917
980 Ga0207645_10044514
981 Ga0207645_10118304
982 Ga0207645_10550779
983 Ga0207684_11527734
984 Ga0207654_10563583
985 Ga0207654_11357841
986 Ga0207671_10037323
987 Ga0207671_10150800
988 Ga0207693_10017333
989 Ga0207693_10028294
990 Ga0207693_11404546
991 Ga0207663_10259913
992 Ga0207663_10510076
993 Ga0207663_10658285
994 Ga0207663_10789753
995 Ga0207663_11563550
996 Ga0207660_11496415
997 Ga0207660_11647658
998 Ga0207662_10567500
999 Ga0207657_10115291
1000 Ga0207657_10420152
1001 Ga0207649_10344545
1002 Ga0207649_11033540
1003 Ga0207681_10088392
1004 Ga0207681_11583812
1005 Ga0207694_10065803
1006 Ga0207694_10084860
1007 Ga0207694_10178060
1008 Ga0207650_10542900
1009 Ga0207650_10614346
1010 Ga0207659_10123019
1011 Ga0207659_10284994
1012 Ga0207687_10034717
1013 Ga0207687_10501681
1014 Ga0207687_10590027
1015 Ga0207700_10016861
1016 Ga0207700_10066274
1017 Ga0207700_10131086
1018 Ga0207700_10482827
1019 Ga0207664_10046442
1020 Ga0207664_10254722
1021 Ga0207664_10262785
1022 Ga0207664_10884328
1023 Ga0207664_11849660
1024 Ga0207664_11940944
1025 Ga0207644_10009076
1026 Ga0207644_10272178
1027 Ga0207706_10779318
1028 Ga0207686_10162836
1029 Ga0207686_10824491
1030 Ga0207709_10417499
1031 Ga0207670_10440145
1032 Ga0207670_10450064
1033 Ga0207704_10121021
1034 Ga0207704_11261322
1035 Ga0207665_10003014
1036 Ga0207691_10407442
1037 Ga0207691_10578258
1038 Ga0207691_11192928
1039 Ga0207711_10148257
1040 Ga0207711_10219544
1041 Ga0207711_11569673
1042 Ga0207689_10259091
1043 Ga0207661_10147158
1044 Ga0207661_10409938
1045 Ga0207679_10241862
1046 Ga0207679_10872683
1047 Ga0207667_10227351
1048 Ga0207667_11192620
1049 Ga0207651_10530260
1050 Ga0207651_10867046
1051 Ga0207651_11004890
1052 Ga0207712_10282647
1053 Ga0207668_10202207
1054 Ga0207668_10554319
1055 Ga0207668_11099026
1056 Ga0207677_10270054
1057 Ga0207703_10300273
1058 Ga0207639_10188855
1059 Ga0207678_10017092
1060 Ga0207678_11232227
1061 Ga0207678_11436022
1062 Ga0207708_10066701
1063 Ga0207708_10412803
1064 Ga0207708_10564590
1065 Ga0207708_10841283
1066 Ga0207702_10206829
1067 Ga0207702_10235526
1068 Ga0207641_10061748
1069 Ga0207641_11956892
1070 Ga0207648_10149250
1071 Ga0207648_11557218
1072 Ga0207676_10214099
1073 Ga0207676_11818968
1074 Ga0207676_11901535
1075 Ga0207674_11478154
1076 Ga0207675_101190535
1077 Ga0207675_101295459
1078 Ga0207683_10001712
1079 Ga0207683_10022411
1080 Ga0207698_12371709
1081 Ga0209179_1084935
1082 Ga0207428_10087324
1083 Ga0207428_10639896
1084 Ga0207428_10664147
1085 Ga0268266_10027147
1086 Ga0268266_10059492
1087 Ga0268266_10157732
1088 Ga0268266_10223753
1089 Ga0268264_10307277
1090 Ga0268264_11184324
1091 Ga0268264_11801593
1092 Ga0265338_10885305
1093 Ga0265332_10178004
1094 Ga0265320_10061021
1095 Ga0265320_10061866
1096 Ga0265329_10175065
1097 Ga0265329_10267754
1098 Ga0307410_10707599
1099 Ga0373930_0154610
1100 Ga0373930_0166401
1101 Ga0373948_0054765
1102 Ga0373958_0078926
1103 Ga0373959_0140577
1104 Ga0373938_0179941
1105 Ga0373928_0189447
1106 Ga0373929_0005469
1107 Ga0373940_0013754
1108 Ga0373949_0099155
1109 Ga0373949_0186020
1110 Ga0373951_0028374
1111 Ga0373951_0127865
1112 Ga0373952_0177385
1113 Ga0373932_0035972
1114 Ga0373932_0071121
1115 Ga0373932_0123851
1116 Ga0373936_0022479
1117 Ga0373936_0207505
1118 Ga0373939_0006537
1119 Ga0373939_0072205
1120 Ga0373941_0022815
1121 Ga0373941_0033670
1122 Ga0373941_0165682
1123 Ga0373945_0340391
1124 Ga0373960_0013179
1125 Ga0373960_0014576
1126 Ga0373960_0121936
1127 Ga0373960_0418114
1128 Ga0373943_0042998
1129 Ga0373946_0040515
1130 Ga0373946_0180375
1131 Ga0373946_0374573
1132 Ga0373955_0027385
1133 Ga0373942_0008981
1134 Ga0373961_0010008
1135 Ga0373961_0021172
1136 Ga0373961_0096942
1137 Ga0373931_0001394
1138 Ga0373931_0007132
1139 Ga0373931_0494691
1140 Ga0373931_0543399
1141 Ga0373935_0039113
1142 Ga0373935_0150461
1143 Ga0373935_1101900
1144 Ga0373935_1317559
1145 Ga0373927_0017182
1146 Ga0373927_0090593
1147 Ga0373927_0110902
1148 Ga0373927_0587394
1149 Ga0373927_0860493
1150 Ga0373933_1113923
1151 Ga0373947_0007622
1152 Ga0373947_0227290
1153 Ga0373937_0910905
1154 Ga0373925_0010435
1155 Ga0373925_0098755
1156 Ga0373925_0108927
1157 Ga0373925_0727572
1158 Ga0373925_0932548
1159 Ga0395899_0063076
1160 Ga0395899_0218959
1161 Ga0395900_0245914
1162 Ga0395900_0390663
1163 Ga0395898_0232628
1164 Ga0436360_0384754
1165 Ga0436360_0511379
1166 Ga0436360_0939981
1167 Ga0436360_1231394
1168 Ga0436360_1251955
1169 Ga0436363_0463420
1170 Ga0436363_1295325
1171 Ga0436363_1310107
1172 Ga0451793_0249486
1173 Ga0451807_1921160
1174 Ga0451835_0673288
1175 Ga0466963_0009031
1176 Ga0466964_0542902
1177 Ga0466968_0482774
1178 Ga0466957_0115228
1179 Ga0451576_1006086
1180 Ga0466967_0052746
1181 Ga0495592_0041060
1182 Ga0495603_0028699
1183 Ga0495603_0061764
1184 Ga0495603_0334886
1185 Ga0495629_0001552
1186 Ga0495629_0254215
1187 Ga0495641_0009545
1188 Ga0495651_0352825
1189 Ga0495653_0098094
1190 Ga0495653_0381464
1191 Ga0495650_0309050
1192 Ga0495580_0022927
1193 Ga0495580_1017365
1194 Ga0495582_0039601
1195 Ga0495582_0085220
1196 Ga0495639_0008987
1197 Ga0495639_0126788
1198 Ga0495639_0369258
1199 Ga0495662_0025820
1200 Ga0495662_0545829
1201 Ga0495584_0069428
1202 Ga0495585_0014505
1203 Ga0495594_0064579
1204 Ga0495594_0080168
1205 Ga0495607_0011263
1206 Ga0495616_0073374
1207 Ga0495618_0054124
1208 Ga0495630_0153836
1209 Ga0495637_0019677
1210 Ga0495644_0001007
1211 Ga0495663_0003699
1212 Ga0495666_0103890
1213 Ga0495652_0645637
1214 Ga0495640_0156890
1215 Ga0495587_0036940
1216 Ga0495598_0249791
1217 Ga0495621_0051994
1218 Ga0495622_0004771
1219 Ga0495633_0004191
1220 Ga0495656_0003817
1221 Ga0495611_0025323
1222 Ga0495659_0000937
1223 Ga0495661_0088317
1224 Ga0495599_0148158
1225 Ga0495646_0023718
1226 Ga0495647_0007588
1227 Ga0495647_0022787
1228 Ga0495647_0079595
1229 Ga0495658_0025714
1230 Ga0495658_0039249
1231 Ga0495658_0063402
1232 Ga0495613_0010730
1233 Ga0495613_0114776
1234 Ga0495624_0324252
1235 Ga0495670_0001110
1236 Ga0495600_0741061
1237 Ga0495581_0029591
1238 Ga0495581_0037457
1239 Ga0495604_0014339
1240 Ga0495636_0015624
1241 Ga0495674_0139316
1242 Ga0495676_0094356
1243 Ga0495676_0427006
1244 Ga0495680_0030745
1245 Ga0495679_162564
1246 Ga0495684_0417658
1247 Ga0495593_0008606
1248 Ga0495614_0113235
1249 Ga0496100_0028430
1250 Ga0496100_0070590
1251 Ga0496100_0192325
1252 Ga0496101_0030674
1253 Ga0496101_0139938
1254 Ga0496102_0743625
1255 Ga0496102_0797682
1256 Ga0496102_0824955
1257 Ga0496103_0215542
1258 Ga0496104_0029111
1259 Ga0496104_0085840
1260 Ga0496104_0648772
1261 Ga0496104_0661467
1262 Ga0496104_1155499
1263 Ga0496105_0030599
1264 Ga0496105_0051361
1265 Ga0496105_0135300
1266 Ga0496105_0169449
1267 Ga0496105_0171225
1268 Ga0496106_0231134
1269 Ga0496106_0420574
1270 Ga0496106_1093401
1271 Ga0496107_0110767
1272 Ga0496107_1222863
1273 Ga0496108_0194325
1274 Ga0496108_0433835
1275 Ga0496109_0004891
1276 Ga0496109_0053933
1277 Ga0496109_0135855
1278 Ga0496109_0316288
1279 Ga0496110_0030492
1280 Ga0496110_0033520
1281 Ga0496110_0308093
1282 Ga0496110_0617778
1283 Ga0496111_0880394
1284 Ga0496112_0103246
1285 Ga0496112_0154289
1286 Ga0496112_0207803
1287 Ga0496112_1194422
1288 Ga0496113_0035081
1289 Ga0496113_0107316
1290 Ga0496113_0547155
1291 Ga0496113_1018920
1292 Ga0496113_1558957
1293 Ga0496114_0019242
1294 Ga0496115_0046769
1295 Ga0496115_0074487
1296 Ga0496115_0167147
1297 Ga0496115_1059468
1298 Ga0496119_0279824
1299 Ga0496121_0765645
1300 Ga0496124_0605555
1301 Ga0501034_0001879
1302 Ga0501034_0004530
1303 Ga0501034_0144030
1304 Ga0501034_0417554
1305 Ga0501034_0498566
1306 Ga0501034_1013234
1307 Ga0501034_1358296
1308 Ga0501034_1554029
1309 Ga0501037_0292851
1310 Ga0501043_0285757
1311 Ga0501046_0326252
1312 Ga0501046_1033749
1313 Ga0501047_0335463
1314 Ga0501068_0236578
1315 Ga0501069_0535128
1316 Ga0501217_337906
1317 Ga0501035_1169749
1318 Ga0501044_0081785
1319 Ga0501044_1317774
1320 nmdc:mga03n38_314679_c1
1321 nmdc:mga05p37_235597_c1
1322 nmdc:mga0qj67_11402_c1
1323 nmdc:mga0qj67_36168_c1
1324 nmdc:mga06r32_1576251_c1
1325 nmdc:mga06r32_223388_c1
1326 nmdc:mga06r32_9732_c1
1327 nmdc:mga08y16_150797_c1
1328 nmdc:mga08y16_176408_c1
1329 nmdc:mga08y16_341745_c1
1330 nmdc:mga08y16_42288_c1
1331 nmdc:mga0n895_116515_c1
1332 nmdc:mga0n895_4878_c1
1333 nmdc:mga0n895_989387_c1
1334 nmdc:mga0rr50_38384_c1
1335 nmdc:mga0rr50_60275_c1
1336 nmdc:mga08x19_227436_c1
1337 nmdc:mga0a205_1877_c1
1338 Ga0495601_0602148
1339 Ga0495601_0936071
1340 Ga0495601_0947205
1341 Ga0495619_0001748
1342 Ga0495619_0049239
1343 Ga0500644_0012961
1344 Ga0500595_045876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24696

26

115

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vbc-assembly1.cif.gz_A crystal structure of il-17 receptor b sefir domain 0.8864 29 63
7fcl-assembly2.cif.gz_C-2 zebrafish sigirr tir domain 0.7659 29 87
6hnk-assembly1.cif.gz_A the ligand-free, open structure of cd0873, a substrate binding protein with adhesive properties from clostridium difficile. 0.7158 29 87
2iob-assembly1.cif.gz_A e. coli bifunctional glutathionylspermidine synthetase/amidase apo protein 0.714 27 63
6ib8-assembly1.cif.gz_A structure of a complex of suhb and nusa ar2 domain 0.713 25 66
ID Description Score Start End Superfamily
3vbcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8864 29 63 3.40.50.11530
af_Q4D083_2_132_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7894 25 64 3.30.420.40
af_A4HYD8_6_169_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7873 26 65 3.30.420.40
af_Q9UUJ1_6_135_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7616 25 64 3.30.420.40
af_Q9NA64_474_626_3.40.50.11530 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7576 28 60 3.40.50.11530
ID Description Score Start End GO Terms
AF-A0A382LZ11-F1-model_v4 Uncharacterized protein 0.8888 13 93
AF-A0A2V8JB81-F1-model_v4 Alpha-D-phosphohexomutase C-terminal domain-containing protein 0.8858 25 87
AF-A0A3D3WS24-F1-model_v4 Uncharacterized protein 0.8721 25 93
AF-A0A1F3CC99-F1-model_v4 DAGKc domain-containing protein 0.864 18 93
AF-A0A2D8PI55-F1-model_v4 Uncharacterized protein 0.8638 28 93

Map