F474160

General Info

Members Datasets Scaffolds Average Seq Length
671 317 1342 213

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10500161|Ga0207662_105001611
Length 245
Sequence MPAAPAGICGSGVVGSCAVCCWKRDVTYTVKEIFYTLQGEGANSGKAAVFCRFSGCNLWTGREADREKAVCQFCDTDFVGVGPDGGRFATADTLADAVLSRWPVVEHDRASGGRPLVVCTGGEPLLQLDVDAVRALHARGFEVAVETNGTQLAPPGIDHICVSPKSDAPLVLTRGNELKLVYPQQQADAQPERFESLDFEEFFLQPMDMGDAGLTQRNVRATLAYCLAHPRWRLSLQIHKQLDIR

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
314 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
315 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
316 2885266251 Ralstonia sp. SET104 Isolate Nodule
317 2928058823 Ralstonia sp. 1138 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.6
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0.45
Rhizoplane 2.53
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10500161 3300025918 Bacteria 837
2 JGI24752J21851_1001275 3300001976 Bacteria 3420
3 JGI24740J21852_10003102 3300001979 Bacteria 7332
4 JGI24739J22299_10005810 3300001989 Bacteria 4673
5 JGI25154J39366_1001115 3300002738 Bacteria 10446
6 JGI25151J46595_10002073 3300003187 Bacteria 12493
7 JGI25151J46595_10003616 3300003187 Bacteria 8454
8 JGI25151J46595_10022029 3300003187 Bacteria 2653
9 Ga0055538_1003819 3300003751 Bacteria 1824
10 Ga0055538_1004772 3300003751 Bacteria 1481
11 Ga0055539_1000071 3300003752 Bacteria 131539
12 Ga0055533_1006294 3300003756 Bacteria 1770
13 Ga0055533_1006720 3300003756 Bacteria 1654
14 Ga0055532_1000019 3300003758 Bacteria 286358
15 Ga0055525_1000311 3300003759 Bacteria 39735
16 Ga0055535_1000014 3300003761 Bacteria 286358
17 Ga0055542_1000998 3300003762 Bacteria 18140
18 Ga0055529_1000096 3300003763 Bacteria 133329
19 Ga0055537_1007219 3300003773 Bacteria 2708
20 Ga0055524_1000463 3300003775 Bacteria 32858
21 Ga0055536_1000211 3300003781 Bacteria 47611
22 Ga0055534_1001050 3300003784 Bacteria 11984
23 Ga0055534_1007213 3300003784 Bacteria 2686
24 Ga0065704_10074982 3300005289 Bacteria 5868
25 Ga0065707_10091984 3300005295 Bacteria 3846
26 Ga0070658_10005500 3300005327 Bacteria 10284
27 Ga0070658_10014403 3300005327 Bacteria 6345
28 Ga0070658_10095373 3300005327 Bacteria 2456
29 Ga0070658_10286069 3300005327 Bacteria 1404
30 Ga0070658_10291825 3300005327 Bacteria 1390
31 Ga0070676_10006296 3300005328 Bacteria 6339
32 Ga0070676_10462500 3300005328 Bacteria 894
33 Ga0070683_100004157 3300005329 Bacteria 11857
34 Ga0070683_100028490 3300005329 Bacteria 5048
35 Ga0070683_100083114 3300005329 Bacteria 2999
36 Ga0070683_100103853 3300005329 Bacteria 2678
37 Ga0070683_100158331 3300005329 Bacteria 2148
38 Ga0070683_100275481 3300005329 Bacteria 1601
39 Ga0070683_100393341 3300005329 Bacteria 1322
40 Ga0070690_100204788 3300005330 Bacteria 1375
41 Ga0070670_100000168 3300005331 Bacteria 59111
42 Ga0070670_100091585 3300005331 Bacteria 2614
43 Ga0070670_100124438 3300005331 Bacteria 2225
44 Ga0070670_100246962 3300005331 Bacteria 1554
45 Ga0068869_100001885 3300005334 Bacteria 12597
46 Ga0070666_10282214 3300005335 Bacteria 1181
47 Ga0070682_100263919 3300005337 Bacteria 1248
48 Ga0068868_100052863 3300005338 Bacteria 3198
49 Ga0070660_100005806 3300005339 Bacteria 8549
50 Ga0070660_100008667 3300005339 Bacteria 7124
51 Ga0070689_100008884 3300005340 Bacteria 7102
52 Ga0070689_100016731 3300005340 Bacteria 5371
53 Ga0070689_100336799 3300005340 Bacteria 1263
54 Ga0070687_100014096 3300005343 Bacteria 3583
55 Ga0070661_100000119 3300005344 Bacteria 65829
56 Ga0070661_100020483 3300005344 Bacteria 4717
57 Ga0070661_100021067 3300005344 Bacteria 4655
58 Ga0070661_100446113 3300005344 Bacteria 1029
59 Ga0070692_10050054 3300005345 Bacteria 2169
60 Ga0070668_100006861 3300005347 Bacteria 8443
61 Ga0070668_100027965 3300005347 Bacteria 4279
62 Ga0070668_100096917 3300005347 Bacteria 2332
63 Ga0070669_100002733 3300005353 Bacteria 12728
64 Ga0070669_100014992 3300005353 Bacteria 5525
65 Ga0070675_100034409 3300005354 Bacteria 4112
66 Ga0070675_100052880 3300005354 Bacteria 3340
67 Ga0070671_100035251 3300005355 Bacteria 4145
68 Ga0070671_100330363 3300005355 Bacteria 1300
69 Ga0070674_100168628 3300005356 Bacteria 1667
70 Ga0070674_100171621 3300005356 Bacteria 1654
71 Ga0070674_100203051 3300005356 Bacteria 1532
72 Ga0070674_100346515 3300005356 Bacteria 1198
73 Ga0070673_100052483 3300005364 Bacteria 3199
74 Ga0070673_100095669 3300005364 Bacteria 2436
75 Ga0070673_100248339 3300005364 Bacteria 1550
76 Ga0070673_100319832 3300005364 Bacteria 1370
77 Ga0070673_100592720 3300005364 Bacteria 1010
78 Ga0070688_100016349 3300005365 Bacteria 4241
79 Ga0070688_100421336 3300005365 Bacteria 992
80 Ga0070659_100001403 3300005366 Bacteria 17373
81 Ga0070659_100006904 3300005366 Bacteria 8220
82 Ga0070659_100009727 3300005366 Bacteria 7062
83 Ga0070659_100153191 3300005366 Bacteria 1882
84 Ga0070659_100276950 3300005366 Bacteria 1395
85 Ga0070659_100379186 3300005366 Bacteria 1191
86 Ga0070667_100001061 3300005367 Bacteria 25118
87 Ga0070667_100006247 3300005367 Bacteria 9906
88 Ga0070667_100117080 3300005367 Bacteria 2314
89 Ga0070667_100139572 3300005367 Bacteria 2121
90 Ga0070709_10413565 3300005434 Bacteria 1009
91 Ga0070713_100021999 3300005436 Bacteria 4918
92 Ga0070713_100090306 3300005436 Bacteria 2633
93 Ga0070713_100160883 3300005436 Bacteria 2004
94 Ga0070701_10011373 3300005438 Bacteria 3977
95 Ga0070705_100208534 3300005440 Bacteria 1345
96 Ga0070700_100106470 3300005441 Bacteria 1856
97 Ga0070694_100031871 3300005444 Bacteria 3458
98 Ga0070663_100000036 3300005455 Bacteria 63282
99 Ga0070663_100016913 3300005455 Bacteria 4747
100 Ga0070662_100007883 3300005457 Bacteria 6920
101 Ga0070662_100078729 3300005457 Bacteria 2449
102 Ga0070662_100095821 3300005457 Bacteria 2237
103 Ga0070662_100402069 3300005457 Bacteria 1130
104 Ga0070681_10156173 3300005458 Bacteria 2206
105 Ga0070681_10273890 3300005458 Bacteria 1599
106 Ga0068867_100019857 3300005459 Bacteria 4789
107 Ga0068867_100022202 3300005459 Bacteria 4536
108 Ga0068867_100252587 3300005459 Bacteria 1434
109 Ga0068867_100352259 3300005459 Bacteria 1229
110 Ga0068867_100429642 3300005459 Unclassified 1121
111 Ga0070685_10027886 3300005466 Bacteria 3125
112 Ga0070685_10105778 3300005466 Bacteria 1725
113 Ga0070699_100170185 3300005518 Bacteria 1930
114 Ga0070679_100153930 3300005530 Bacteria 2275
115 Ga0070679_100234074 3300005530 Bacteria 1796
116 Ga0070684_100006670 3300005535 Bacteria 8946
117 Ga0070684_100010879 3300005535 Bacteria 7229
118 Ga0070684_100016078 3300005535 Bacteria 6112
119 Ga0070684_100017600 3300005535 Bacteria 5871
120 Ga0070684_100090813 3300005535 Bacteria 2716
121 Ga0070684_100167468 3300005535 Bacteria 1995
122 Ga0070697_100610618 3300005536 Bacteria 959
123 Ga0068853_100003053 3300005539 Bacteria 12780
124 Ga0068853_100072181 3300005539 Bacteria 3007
125 Ga0068853_100078846 3300005539 Bacteria 2879
126 Ga0068853_100355725 3300005539 Bacteria 1363
127 Ga0070672_100001892 3300005543 Bacteria 13109
128 Ga0070672_100029219 3300005543 Bacteria 4132
129 Ga0070672_100227622 3300005543 Bacteria 1565
130 Ga0070672_100263035 3300005543 Bacteria 1455
131 Ga0070672_100516269 3300005543 Bacteria 1035
132 Ga0070686_100165952 3300005544 Bacteria 1558
133 Ga0068855_100019501 3300005563 Bacteria 8149
134 Ga0068855_100138850 3300005563 Bacteria 2772
135 Ga0068855_100265642 3300005563 Bacteria 1910
136 Ga0070664_100000096 3300005564 Bacteria 56242
137 Ga0070664_100001558 3300005564 Bacteria 18316
138 Ga0070664_100008265 3300005564 Bacteria 8418
139 Ga0070664_100015576 3300005564 Bacteria 6221
140 Ga0070664_100024965 3300005564 Bacteria 4953
141 Ga0070664_100075248 3300005564 Bacteria 2899
142 Ga0070664_100105148 3300005564 Bacteria 2458
143 Ga0070664_100119705 3300005564 Bacteria 2304
144 Ga0070664_100524122 3300005564 Bacteria 1094
145 Ga0068857_100006092 3300005577 Bacteria 10299
146 Ga0068857_100006504 3300005577 Bacteria 10025
147 Ga0068857_100009996 3300005577 Bacteria 8236
148 Ga0068857_100016468 3300005577 Bacteria 6477
149 Ga0068857_100190797 3300005577 Bacteria 1866
150 Ga0068857_100653641 3300005577 Bacteria 996
151 Ga0068854_100000425 3300005578 Bacteria 26328
152 Ga0068854_100199592 3300005578 Bacteria 1572
153 Ga0068854_100215780 3300005578 Bacteria 1516
154 Ga0068856_100000203 3300005614 Bacteria 63370
155 Ga0068856_100445821 3300005614 Bacteria 1315
156 Ga0070702_100273406 3300005615 Bacteria 1156
157 Ga0070702_100361340 3300005615 Bacteria 1026
158 Ga0070702_100406059 3300005615 Unclassified 976
159 Ga0068852_100003130 3300005616 Bacteria 11525
160 Ga0068852_100036025 3300005616 Bacteria 4135
161 Ga0068852_100501287 3300005616 Bacteria 1209
162 Ga0068859_100054546 3300005617 Bacteria 4021
163 Ga0068859_100143872 3300005617 Bacteria 2458
164 Ga0068864_100000063 3300005618 Bacteria 119845
165 Ga0068864_100005041 3300005618 Bacteria 10817
166 Ga0068864_100020018 3300005618 Bacteria 5595
167 Ga0068864_100065913 3300005618 Bacteria 3142
168 Ga0068866_10131669 3300005718 Bacteria 1423
169 Ga0068861_100002121 3300005719 Bacteria 12833
170 Ga0068861_100190561 3300005719 Bacteria 1714
171 Ga0068861_100448756 3300005719 Bacteria 1155
172 Ga0068861_100613680 3300005719 Bacteria 1000
173 Ga0068851_10023469 3300005834 Bacteria 3016
174 Ga0068851_10123244 3300005834 Bacteria 1395
175 Ga0068851_10231898 3300005834 Bacteria 1041
176 Ga0068870_10007965 3300005840 Bacteria 4744
177 Ga0068870_10067515 3300005840 Bacteria 1940
178 Ga0068863_100000062 3300005841 Bacteria 119845
179 Ga0068863_100391453 3300005841 Bacteria 1358
180 Ga0068863_100426106 3300005841 Bacteria 1300
181 Ga0068858_100056891 3300005842 Bacteria 3614
182 Ga0068860_100015858 3300005843 Bacteria 7355
183 Ga0068860_100030425 3300005843 Bacteria 5193
184 Ga0068860_100144278 3300005843 Bacteria 2290
185 Ga0068862_100000069 3300005844 Bacteria 122535
186 Ga0068862_100009387 3300005844 Bacteria 8091
187 Ga0068862_100140220 3300005844 Bacteria 2145
188 Ga0068862_100464055 3300005844 Bacteria 1196
189 Ga0081455_10001124 3300005937 Bacteria 33435
190 Ga0070717_10796342 3300006028 Bacteria 860
191 Ga0070712_100141407 3300006175 Bacteria 1837
192 Ga0097621_100470958 3300006237 Bacteria 1134
193 Ga0097621_100494657 3300006237 Bacteria 1107
194 Ga0097621_100943885 3300006237 Unclassified 805
195 Ga0068871_100408104 3300006358 Bacteria 1211
196 Ga0075428_100057692 3300006844 Bacteria 4250
197 Ga0075428_100324200 3300006844 Bacteria 1655
198 Ga0075430_100000978 3300006846 Bacteria 22539
199 Ga0075430_100010724 3300006846 Bacteria 7767
200 Ga0075431_100093902 3300006847 Bacteria 3096
201 Ga0075431_100124950 3300006847 Bacteria 2655
202 Ga0075431_100235541 3300006847 Bacteria 1864
203 Ga0075431_100473823 3300006847 Bacteria 1245
204 Ga0075433_10006543 3300006852 Bacteria 9218
205 Ga0075433_10040782 3300006852 Bacteria 4020
206 Ga0075434_100084545 3300006871 Bacteria 3172
207 Ga0075434_100309210 3300006871 Bacteria 1601
208 Ga0075429_100013113 3300006880 Bacteria 7191
209 Ga0075429_100121915 3300006880 Bacteria 2279
210 Ga0075429_100708262 3300006880 Bacteria 882
211 Ga0068865_100014146 3300006881 Bacteria 5066
212 Ga0068865_100097773 3300006881 Bacteria 2143
213 Ga0097620_100054546 3300006931 Bacteria 4021
214 Ga0097620_100143897 3300006931 Bacteria 2458
215 Ga0099826_10000012 3300006948 Bacteria 283499
216 Ga0105251_10000833 3300009011 Bacteria 27645
217 Ga0105240_10028358 3300009093 Bacteria 7315
218 Ga0111539_10020779 3300009094 Bacteria 8081
219 Ga0111539_10385569 3300009094 Unclassified 1632
220 Ga0111539_10539889 3300009094 Bacteria 1358
221 Ga0105245_10739204 3300009098 Bacteria 1019
222 Ga0105247_10005002 3300009101 Bacteria 8419
223 Ga0114129_10020103 3300009147 Bacteria 9502
224 Ga0114129_10040315 3300009147 Bacteria 6583
225 Ga0105243_10097283 3300009148 Bacteria 2436
226 Ga0105241_10310738 3300009174 Bacteria 1356
227 Ga0105242_10041138 3300009176 Bacteria 3726
228 Ga0105242_10111998 3300009176 Bacteria 2328
229 Ga0105248_10000284 3300009177 Bacteria 59750
230 Ga0105248_10067012 3300009177 Bacteria 4030
231 Ga0105248_10117044 3300009177 Bacteria 3006
232 Ga0105248_10122704 3300009177 Bacteria 2931
233 Ga0105248_10148089 3300009177 Bacteria 2649
234 Ga0105248_10438379 3300009177 Bacteria 1472
235 Ga0105248_11504213 3300009177 Bacteria 762
236 Ga0105249_10001169 3300009553 Bacteria 23239
237 Ga0105249_10003292 3300009553 Bacteria 14000
238 Ga0105249_10278599 3300009553 Bacteria 1669
239 Ga0105249_10362073 3300009553 Bacteria 1472
240 Ga0105239_10009120 3300010375 Bacteria 11223
241 Ga0105239_10190409 3300010375 Bacteria 2296
242 Ga0105246_10531581 3300011119 Eukaryota 1004
243 Ga0105246_10547814 3300011119 Bacteria 991
244 Ga0157373_10001880 3300013100 Bacteria 15927
245 Ga0157373_10064327 3300013100 Bacteria 2597
246 Ga0157371_10002837 3300013102 Bacteria 16203
247 Ga0157371_10054768 3300013102 Bacteria 2831
248 Ga0157370_10004547 3300013104 Bacteria 15886
249 Ga0157369_10004643 3300013105 Bacteria 16140
250 Ga0157369_10087714 3300013105 Bacteria 3322
251 Ga0157374_10027032 3300013296 Bacteria 5169
252 Ga0157378_10016448 3300013297 Bacteria 6478
253 Ga0157378_10265521 3300013297 Bacteria 1648
254 Ga0163162_10003542 3300013306 Bacteria 14937
255 Ga0163162_10102412 3300013306 Bacteria 2956
256 Ga0163162_10135256 3300013306 Bacteria 2575
257 Ga0163162_10220158 3300013306 Bacteria 2028
258 Ga0163162_10329682 3300013306 Bacteria 1659
259 Ga0157372_10003833 3300013307 Bacteria 16163
260 Ga0157372_10046708 3300013307 Bacteria 4807
261 Ga0157372_10085274 3300013307 Bacteria 3582
262 Ga0157372_10115239 3300013307 Bacteria 3081
263 Ga0157372_10399200 3300013307 Bacteria 1602
264 Ga0157372_10587505 3300013307 Bacteria 1298
265 Ga0157372_10695751 3300013307 Bacteria 1183
266 Ga0157375_10018313 3300013308 Bacteria 6349
267 Ga0157375_10123299 3300013308 Bacteria 2704
268 Ga0157375_10467918 3300013308 Bacteria 1426
269 Ga0157375_10491423 3300013308 Bacteria 1392
270 Ga0163163_10011129 3300014325 Bacteria 8146
271 Ga0163163_10262250 3300014325 Bacteria 1779
272 Ga0163163_10359858 3300014325 Bacteria 1512
273 Ga0157380_10328424 3300014326 Bacteria 1421
274 Ga0157380_10346431 3300014326 Bacteria 1388
275 Ga0157380_10958180 3300014326 Bacteria 886
276 Ga0182008_10189261 3300014497 Bacteria 1044
277 Ga0157377_10015260 3300014745 Bacteria 3925
278 Ga0157379_10001783 3300014968 Bacteria 17764
279 Ga0157379_10031039 3300014968 Bacteria 4761
280 Ga0182006_1003375 3300015261 Bacteria 8193
281 Ga0182006_1014448 3300015261 Bacteria 3404
282 Ga0182007_10011314 3300015262 Bacteria 3477
283 Ga0182007_10077635 3300015262 Bacteria 1089
284 Ga0182005_1044055 3300015265 Bacteria 1213
285 Ga0163161_10012509 3300017792 Bacteria 5891
286 Ga0163161_10071727 3300017792 Bacteria 2535
287 Ga0163161_10112071 3300017792 Bacteria 2041
288 Ga0206356_10961560 3300020070 Bacteria 1391
289 Ga0206354_10206077 3300020081 Bacteria 796
290 Ga0154015_1653377 3300020610 Bacteria 3678
291 Ga0213876_10069224 3300021384 Bacteria 1864
292 Ga0209784_100003 3300025224 Bacteria 1379451
293 Ga0209784_100463 3300025224 Bacteria 16904
294 Ga0209566_100002 3300025225 Bacteria 2614868
295 Ga0209566_100238 3300025225 Bacteria 52918
296 Ga0209566_101131 3300025225 Bacteria 10111
297 Ga0209674_100008 3300025226 Bacteria 1076909
298 Ga0209674_100118 3300025226 Bacteria 135635
299 Ga0209672_100451 3300025228 Bacteria 23242
300 Ga0209147_100002 3300025229 Bacteria 2158988
301 Ga0209563_100004 3300025230 Bacteria 1814108
302 Ga0209258_100002 3300025242 Bacteria 2158988
303 Ga0209646_1000203 3300025246 Bacteria 70126
304 Ga0209026_1006349 3300025250 Bacteria 2915
305 Ga0209677_100009 3300025253 Bacteria 749530
306 Ga0209148_1000021 3300025254 Bacteria 714645
307 Ga0209148_1004987 3300025254 Bacteria 3126
308 Ga0209565_1000021 3300025263 Bacteria 406281
309 Ga0209455_1000076 3300025272 Bacteria 284092
310 Ga0209130_1018981 3300025284 Bacteria 1604
311 Ga0207673_1017657 3300025290 Bacteria 953
312 Ga0209675_1000149 3300025291 Bacteria 93109
313 Ga0209675_1005403 3300025291 Bacteria 5360
314 Ga0209675_1023317 3300025291 Bacteria 1605
315 Ga0209676_1000014 3300025292 Bacteria 793514
316 Ga0209025_1000781 3300025294 Bacteria 52410
317 Ga0209025_1001089 3300025294 Bacteria 39299
318 Ga0209025_1002125 3300025294 Bacteria 22289
319 Ga0209564_1001428 3300025295 Bacteria 24530
320 Ga0209758_1005893 3300025297 Bacteria 9134
321 Ga0209256_1000345 3300025299 Bacteria 75475
322 Ga0209256_1000502 3300025299 Bacteria 57469
323 Ga0209051_1005584 3300025303 Bacteria 7303
324 Ga0207697_10001524 3300025315 Bacteria 12566
325 Ga0207656_10014939 3300025321 Bacteria 3000
326 Ga0207656_10151869 3300025321 Bacteria 1097
327 Ga0207713_1004356 3300025735 Bacteria 9202
328 Ga0207682_10017102 3300025893 Bacteria 2831
329 Ga0207642_10016113 3300025899 Bacteria 2806
330 Ga0207688_10034244 3300025901 Bacteria 2812
331 Ga0207680_10223208 3300025903 Bacteria 1292
332 Ga0207647_10012380 3300025904 Bacteria 5940
333 Ga0207647_10116468 3300025904 Bacteria 1577
334 Ga0207645_10007248 3300025907 Bacteria 7853
335 Ga0207643_10001697 3300025908 Bacteria 12354
336 Ga0207643_10040223 3300025908 Bacteria 2632
337 Ga0207705_10019668 3300025909 Bacteria 4828
338 Ga0207705_10066463 3300025909 Bacteria 2608
339 Ga0207705_10132299 3300025909 Bacteria 1857
340 Ga0207705_10158835 3300025909 Bacteria 1697
341 Ga0207654_10326519 3300025911 Bacteria 1050
342 Ga0207707_10004198 3300025912 Bacteria 12761
343 Ga0207695_10002210 3300025913 Bacteria 29273
344 Ga0207695_10196214 3300025913 Bacteria 1935
345 Ga0207693_10055183 3300025915 Bacteria 3117
346 Ga0207660_10065734 3300025917 Bacteria 2621
347 Ga0207660_10102913 3300025917 Bacteria 2136
348 Ga0207662_10000455 3300025918 Bacteria 18166
349 Ga0207662_10023642 3300025918 Bacteria 3532
350 Ga0207657_10004575 3300025919 Bacteria 14623
351 Ga0207657_10018092 3300025919 Bacteria 6742
352 Ga0207657_10134900 3300025919 Bacteria 2021
353 Ga0207657_10389449 3300025919 Bacteria 1097
354 Ga0207657_10456236 3300025919 Bacteria 1003
355 Ga0207649_10000340 3300025920 Bacteria 35555
356 Ga0207649_10008507 3300025920 Bacteria 5596
357 Ga0207649_10064948 3300025920 Bacteria 2309
358 Ga0207649_10114459 3300025920 Bacteria 1808
359 Ga0207652_10148880 3300025921 Bacteria 2095
360 Ga0207681_10003831 3300025923 Bacteria 9331
361 Ga0207681_10008351 3300025923 Bacteria 6332
362 Ga0207681_10834265 3300025923 Bacteria 771
363 Ga0207694_10138531 3300025924 Bacteria 1956
364 Ga0207650_10000142 3300025925 Bacteria 87599
365 Ga0207650_10082659 3300025925 Bacteria 2438
366 Ga0207650_10085932 3300025925 Bacteria 2394
367 Ga0207650_10092596 3300025925 Bacteria 2312
368 Ga0207659_10025846 3300025926 Bacteria 3952
369 Ga0207659_10079810 3300025926 Bacteria 2415
370 Ga0207659_10977459 3300025926 Bacteria 728
371 Ga0207700_10294342 3300025928 Bacteria 1400
372 Ga0207700_10382834 3300025928 Bacteria 1230
373 Ga0207644_10010005 3300025931 Bacteria 6245
374 Ga0207644_10285212 3300025931 Bacteria 1327
375 Ga0207690_10001075 3300025932 Bacteria 17471
376 Ga0207690_10004821 3300025932 Bacteria 7959
377 Ga0207690_10033585 3300025932 Bacteria 3300
378 Ga0207690_10270581 3300025932 Bacteria 1320
379 Ga0207690_10289030 3300025932 Bacteria 1279
380 Ga0207690_10365011 3300025932 Bacteria 1144
381 Ga0207706_10000947 3300025933 Bacteria 29655
382 Ga0207706_10013604 3300025933 Bacteria 7392
383 Ga0207706_10169536 3300025933 Bacteria 1918
384 Ga0207706_10183597 3300025933 Bacteria 1837
385 Ga0207686_10086461 3300025934 Bacteria 2059
386 Ga0207686_10787739 3300025934 Bacteria 761
387 Ga0207670_10016096 3300025936 Bacteria 4486
388 Ga0207670_10748422 3300025936 Bacteria 811
389 Ga0207669_10056776 3300025937 Bacteria 2380
390 Ga0207669_10297872 3300025937 Bacteria 1224
391 Ga0207704_10206799 3300025938 Bacteria 1441
392 Ga0207704_10278420 3300025938 Bacteria 1270
393 Ga0207691_10000311 3300025940 Bacteria 48455
394 Ga0207691_10010346 3300025940 Bacteria 8947
395 Ga0207691_10010505 3300025940 Bacteria 8884
396 Ga0207691_10012035 3300025940 Bacteria 8299
397 Ga0207691_10085326 3300025940 Bacteria 2834
398 Ga0207691_10281882 3300025940 Bacteria 1430
399 Ga0207711_10000017 3300025941 Bacteria 441730
400 Ga0207711_10015397 3300025941 Bacteria 6347
401 Ga0207711_10106905 3300025941 Bacteria 2483
402 Ga0207711_10128356 3300025941 Bacteria 2270
403 Ga0207711_10198882 3300025941 Unclassified 1828
404 Ga0207711_10748219 3300025941 Bacteria 911
405 Ga0207689_10002676 3300025942 Bacteria 16470
406 Ga0207661_10006329 3300025944 Bacteria 8374
407 Ga0207661_10014460 3300025944 Bacteria 5786
408 Ga0207661_10022042 3300025944 Bacteria 4788
409 Ga0207661_10050110 3300025944 Bacteria 3325
410 Ga0207661_10071055 3300025944 Bacteria 2843
411 Ga0207661_10136818 3300025944 Bacteria 2105
412 Ga0207679_10000122 3300025945 Bacteria 63505
413 Ga0207679_10001366 3300025945 Bacteria 15379
414 Ga0207679_10016218 3300025945 Bacteria 4942
415 Ga0207679_10027139 3300025945 Bacteria 3957
416 Ga0207679_10027460 3300025945 Bacteria 3936
417 Ga0207679_10038056 3300025945 Bacteria 3425
418 Ga0207679_10067931 3300025945 Bacteria 2676
419 Ga0207679_10180512 3300025945 Bacteria 1746
420 Ga0207679_10283508 3300025945 Bacteria 1421
421 Ga0207667_10020830 3300025949 Bacteria 7281
422 Ga0207667_10056209 3300025949 Bacteria 4135
423 Ga0207667_10256324 3300025949 Bacteria 1789
424 Ga0207667_10471572 3300025949 Bacteria 1275
425 Ga0207667_10817212 3300025949 Bacteria 928
426 Ga0207651_10071932 3300025960 Bacteria 2453
427 Ga0207651_10201535 3300025960 Bacteria 1595
428 Ga0207651_10290960 3300025960 Bacteria 1354
429 Ga0207651_10318749 3300025960 Bacteria 1299
430 Ga0207651_10540238 3300025960 Bacteria 1012
431 Ga0207712_10000527 3300025961 Bacteria 31373
432 Ga0207712_10546657 3300025961 Bacteria 996
433 Ga0207668_10003563 3300025972 Bacteria 9149
434 Ga0207668_10048757 3300025972 Bacteria 2908
435 Ga0207668_10069048 3300025972 Bacteria 2515
436 Ga0207668_10723834 3300025972 Bacteria 876
437 Ga0207640_10000017 3300025981 Bacteria 208145
438 Ga0207640_10057578 3300025981 Bacteria 2557
439 Ga0207658_10000815 3300025986 Bacteria 26046
440 Ga0207658_10046428 3300025986 Bacteria 3172
441 Ga0207658_10106193 3300025986 Bacteria 2210
442 Ga0207658_10170369 3300025986 Bacteria 1793
443 Ga0207677_10090517 3300026023 Bacteria 2223
444 Ga0207677_10206468 3300026023 Bacteria 1565
445 Ga0207703_10138757 3300026035 Bacteria 2108
446 Ga0207703_10214320 3300026035 Bacteria 1719
447 Ga0207703_10874734 3300026035 Bacteria 860
448 Ga0207639_10002668 3300026041 Bacteria 11977
449 Ga0207639_10288810 3300026041 Bacteria 1445
450 Ga0207639_10551067 3300026041 Bacteria 1059
451 Ga0207639_10560796 3300026041 Bacteria 1049
452 Ga0207678_10000129 3300026067 Bacteria 63305
453 Ga0207678_10029284 3300026067 Bacteria 4805
454 Ga0207708_10007740 3300026075 Bacteria 7957
455 Ga0207708_10052029 3300026075 Bacteria 3119
456 Ga0207702_10000024 3300026078 Bacteria 187719
457 Ga0207641_10000022 3300026088 Bacteria 279334
458 Ga0207641_10056046 3300026088 Bacteria 3348
459 Ga0207641_10090301 3300026088 Bacteria 2679
460 Ga0207641_11155388 3300026088 Bacteria 773
461 Ga0207648_10013733 3300026089 Bacteria 7519
462 Ga0207648_10020920 3300026089 Bacteria 5890
463 Ga0207648_10225350 3300026089 Bacteria 1667
464 Ga0207648_10592854 3300026089 Bacteria 1021
465 Ga0207676_10000056 3300026095 Bacteria 124484
466 Ga0207676_10003671 3300026095 Bacteria 10851
467 Ga0207676_10161460 3300026095 Bacteria 1942
468 Ga0207676_10205692 3300026095 Bacteria 1742
469 Ga0207676_10644959 3300026095 Bacteria 1021
470 Ga0207674_10000737 3300026116 Bacteria 42799
471 Ga0207674_10003739 3300026116 Bacteria 18566
472 Ga0207674_10004051 3300026116 Bacteria 17774
473 Ga0207674_10011124 3300026116 Bacteria 10120
474 Ga0207674_10022074 3300026116 Bacteria 6843
475 Ga0207674_10023319 3300026116 Bacteria 6631
476 Ga0207675_100000107 3300026118 Bacteria 66968
477 Ga0207675_100083438 3300026118 Bacteria 2997
478 Ga0207675_100534984 3300026118 Bacteria 1170
479 Ga0207698_10010895 3300026142 Bacteria 5871
480 Ga0207698_10188673 3300026142 Bacteria 1834
481 Ga0207698_10217340 3300026142 Bacteria 1724
482 Ga0209282_1000175 3300027666 Bacteria 36168
483 Ga0207428_10209361 3300027907 Bacteria 1465
484 Ga0268266_10089258 3300028379 Bacteria 2699
485 Ga0268265_10000044 3300028380 Bacteria 182545
486 Ga0268265_10003081 3300028380 Bacteria 12165
487 Ga0268265_10928033 3300028380 Bacteria 856
488 Ga0268264_10026238 3300028381 Bacteria 4759
489 Ga0268264_10034537 3300028381 Bacteria 4160
490 Ga0268264_10230558 3300028381 Bacteria 1710
491 Ga0307408_100004111 3300031548 Bacteria 9922
492 Ga0307408_100041481 3300031548 Bacteria 3263
493 Ga0307408_100196902 3300031548 Bacteria 1628
494 Ga0307408_100733434 3300031548 Bacteria 891
495 Ga0307405_10000947 3300031731 Bacteria 11591
496 Ga0307405_10096243 3300031731 Bacteria 1973
497 Ga0307405_10097110 3300031731 Bacteria 1966
498 Ga0307405_10138800 3300031731 Bacteria 1691
499 Ga0307405_10236440 3300031731 Bacteria 1350
500 Ga0307405_10482428 3300031731 Bacteria 990
501 Ga0307413_10000218 3300031824 Bacteria 16743
502 Ga0307413_10000244 3300031824 Bacteria 16299
503 Ga0307413_10000464 3300031824 Bacteria 13193
504 Ga0307413_10232670 3300031824 Bacteria 1354
505 Ga0307413_10685589 3300031824 Bacteria 849
506 Ga0307410_10000712 3300031852 Bacteria 13895
507 Ga0307410_10015301 3300031852 Bacteria 4546
508 Ga0307410_10034785 3300031852 Bacteria 3267
509 Ga0307410_10072762 3300031852 Bacteria 2388
510 Ga0307410_10583492 3300031852 Bacteria 930
511 Ga0307406_10002593 3300031901 Bacteria 9851
512 Ga0307406_10131897 3300031901 Bacteria 1755
513 Ga0307406_10355290 3300031901 Bacteria 1147
514 Ga0307406_10440265 3300031901 Bacteria 1043
515 Ga0307406_10604978 3300031901 Bacteria 904
516 Ga0307407_10017469 3300031903 Bacteria 3600
517 Ga0307407_10021047 3300031903 Bacteria 3355
518 Ga0307407_10048225 3300031903 Bacteria 2423
519 Ga0307407_10090784 3300031903 Bacteria 1872
520 Ga0307412_10007157 3300031911 Bacteria 6334
521 Ga0307412_10069120 3300031911 Bacteria 2403
522 Ga0307409_100021691 3300031995 Bacteria 4409
523 Ga0307409_100070860 3300031995 Bacteria 2769
524 Ga0307409_100080618 3300031995 Bacteria 2627
525 Ga0307409_100148028 3300031995 Bacteria 2034
526 Ga0307409_100279644 3300031995 Bacteria 1542
527 Ga0307409_100381439 3300031995 Bacteria 1340
528 Ga0307409_100860482 3300031995 Bacteria 918
529 Ga0307409_100966111 3300031995 Bacteria 868
530 Ga0307409_101207129 3300031995 Bacteria 780
531 Ga0307416_100002566 3300032002 Bacteria 10487
532 Ga0307416_100008480 3300032002 Bacteria 6636
533 Ga0307416_100010616 3300032002 Bacteria 6094
534 Ga0307416_100856352 3300032002 Bacteria 1007
535 Ga0307416_101234104 3300032002 Bacteria 853
536 Ga0307414_10037490 3300032004 Bacteria 3247
537 Ga0307414_10106013 3300032004 Bacteria 2126
538 Ga0307411_10002189 3300032005 Bacteria 8492
539 Ga0307415_100006475 3300032126 Bacteria 6323
540 Ga0307415_100009298 3300032126 Bacteria 5498
541 Ga0307415_100016358 3300032126 Bacteria 4419
542 Ga0307415_100397611 3300032126 Bacteria 1175
543 Ga0373956_0066388 3300035119 Bacteria 1641
544 Ga0373956_0147494 3300035119 Bacteria 1106
545 Ga0373943_0213948 3300035170 Bacteria 1071
546 Ga0373935_0082642 3300035692 Bacteria 2090
547 Ga0373925_0585206 3300037068 Bacteria 919
548 Ga0395899_0243028 3300037312 Bacteria 1238
549 Ga0395900_0017272 3300037418 Bacteria 7364
550 Ga0395900_0036708 3300037418 Bacteria 5052
551 Ga0395900_0108205 3300037418 Bacteria 2856
552 Ga0395898_0022822 3300037466 Bacteria 6330
553 Ga0395898_0507538 3300037466 Bacteria 1147
554 Ga0395905_0011696 3300037471 Bacteria 8473
555 Ga0395905_0288828 3300037471 Bacteria 1527
556 Ga0395905_0625816 3300037471 Bacteria 978
557 Ga0395901_0006146 3300038443 Bacteria 12165
558 Ga0395901_0346003 3300038443 Bacteria 1535
559 Ga0436365_1094760 3300039437 Bacteria 1080
560 Ga0439439_0078366 3300041406 Bacteria 891
561 Ga0451847_0560490 3300041503 Bacteria 999
562 Ga0451853_1516051 3300041512 Bacteria 637
563 Ga0451577_0000001 3300042876 Bacteria 2461803
564 Ga0451577_0219362 3300042876 Bacteria 1719
565 Ga0451577_0275313 3300042876 Bacteria 1524
566 Ga0466986_0126562 3300044650 Bacteria 1744
567 Ga0466961_0143719 3300044693 Bacteria 1493
568 Ga0466960_0163166 3300044901 Bacteria 1198
569 Ga0466959_0295128 3300045049 Bacteria 1111
570 Ga0451576_0025678 3300045051 Bacteria 6345
571 Ga0466967_0479360 3300045976 Bacteria 1219
572 Ga0495629_0132216 3300046459 Bacteria 1738
573 Ga0495594_0114113 3300046499 Bacteria 1525
574 Ga0495596_0000753 3300046500 Bacteria 19853
575 Ga0495596_0018942 3300046500 Bacteria 2833
576 Ga0495607_0006795 3300046501 Bacteria 7991
577 Ga0495610_0003561 3300046512 Bacteria 12051
578 Ga0495616_0003905 3300046513 Bacteria 9495
579 Ga0495620_0134428 3300046515 Bacteria 969
580 Ga0495637_0183774 3300046520 Bacteria 774
581 Ga0495663_0007168 3300046525 Bacteria 3078
582 Ga0495663_0118154 3300046525 Bacteria 886
583 Ga0495654_0003556 3300046530 Bacteria 9496
584 Ga0495665_0078819 3300046531 Bacteria 1733
585 Ga0495586_0308079 3300046535 Bacteria 908
586 Ga0495598_0061358 3300046537 Bacteria 1161
587 Ga0495609_0003546 3300046538 Bacteria 8896
588 Ga0495621_0207387 3300046539 Bacteria 790
589 Ga0495597_0015770 3300046542 Bacteria 3576
590 Ga0495667_0102610 3300046559 Bacteria 1850
591 Ga0495667_0149689 3300046559 Bacteria 1503
592 Ga0495656_0349311 3300046615 Bacteria 766
593 Ga0495668_0011031 3300046616 Bacteria 5435
594 Ga0495668_0159367 3300046616 Bacteria 1236
595 Ga0495659_0188156 3300046664 Bacteria 843
596 Ga0495661_0010644 3300046665 Bacteria 6269
597 Ga0495657_0203648 3300046675 Bacteria 1205
598 Ga0495669_0082445 3300046684 Bacteria 1477
599 Ga0495613_0130270 3300046689 Bacteria 1801
600 Ga0495671_0002270 3300046692 Bacteria 12227
601 Ga0495600_0076213 3300046809 Bacteria 2190
602 Ga0495604_0296259 3300047317 Bacteria 1088
603 Ga0495674_0229861 3300047319 Unclassified 1531
604 Ga0495672_0018898 3300047320 Bacteria 4561
605 Ga0495675_0430444 3300047444 Bacteria 766
606 Ga0495685_013242 3300047447 Bacteria 2798
607 Ga0495685_014217 3300047447 Bacteria 2704
608 Ga0495602_0097300 3300048088 Bacteria 2425
609 Ga0496101_0070999 3300048904 Bacteria 2552
610 Ga0496102_0427594 3300048905 Bacteria 1244
611 Ga0496102_0512747 3300048905 Bacteria 1122
612 Ga0496104_0273134 3300048907 Bacteria 1603
613 Ga0496105_0187010 3300048908 Bacteria 1695
614 Ga0496105_0263498 3300048908 Bacteria 1393
615 Ga0496106_0059966 3300048909 Bacteria 2884
616 Ga0496106_0083509 3300048909 Bacteria 2457
617 Ga0496107_0082833 3300048910 Bacteria 2339
618 Ga0496107_0828324 3300048910 Bacteria 677
619 Ga0496108_0197978 3300048911 Bacteria 1743
620 Ga0496109_0090876 3300048912 Bacteria 2824
621 Ga0496109_0342426 3300048912 Bacteria 1412
622 Ga0496112_0184516 3300048915 Bacteria 2050
623 Ga0496112_0300848 3300048915 Bacteria 1550
624 Ga0496114_0057671 3300048917 Bacteria 3242
625 Ga0496116_0016431 3300048919 Bacteria 5790
626 Ga0496116_0019109 3300048919 Bacteria 5257
627 Ga0496117_0008846 3300048920 Bacteria 9502
628 Ga0496118_0003910 3300048921 Bacteria 18240
629 Ga0496121_0052554 3300048924 Bacteria 3420
630 Ga0496122_0007225 3300048925 Bacteria 12426
631 Ga0496123_0023583 3300048926 Bacteria 4705
632 Ga0496125_0116105 3300048928 Bacteria 1923
633 Ga0495678_054784 3300049459 Bacteria 1525
634 Ga0501032_0040311 3300049569 Bacteria 3175
635 Ga0501033_0254578 3300049570 Bacteria 1244
636 Ga0501034_0237024 3300049571 Bacteria 1772
637 Ga0501036_0246171 3300049572 Bacteria 1499
638 Ga0501038_0021706 3300049574 Bacteria 5760
639 Ga0501040_0545215 3300049576 Bacteria 837
640 Ga0501047_0003178 3300049581 Bacteria 15572
641 Ga0501069_0057132 3300049585 Bacteria 2175
642 Ga0501035_0231711 3300049822 Bacteria 1573
643 nmdc:mga05p37_173087_c1 3300050507 Bacteria 2632
644 nmdc:mga09592_113125_c1 3300050508 Bacteria 2329
645 nmdc:mga09592_23272_c1 3300050508 Bacteria 4092
646 nmdc:mga09592_318550_c1 3300050508 Bacteria 1347
647 nmdc:mga09592_671861_c1 3300050508 Bacteria 883
648 nmdc:mga0qj67_479_c1 3300050509 Bacteria 27322
649 nmdc:mga0qj67_5892_c1 3300050509 Bacteria 8980
650 nmdc:mga06r32_1699747_c1 3300050510 Bacteria 568
651 nmdc:mga06r32_58825_c1 3300050510 Bacteria 3694
652 nmdc:mga06r32_783685_c1 3300050510 Bacteria 915
653 nmdc:mga08y16_173816_c2 3300050511 Bacteria 1103
654 nmdc:mga08y16_199699_c1 3300050511 Bacteria 2072
655 nmdc:mga08y16_442740_c1 3300050511 Unclassified 1326
656 nmdc:mga0n895_112073_c1 3300050512 Bacteria 2745
657 nmdc:mga0n895_315442_c1 3300050512 Bacteria 1584
658 nmdc:mga0a205_65427_c1 3300050515 Bacteria 3512
659 nmdc:mga0a205_7147_c1 3300050515 Bacteria 10090
660 Ga0500592_000295 3300053116 Bacteria 8667
661 Ga0500604_0002414 3300053151 Bacteria 5102
662 Ga0500604_0090068 3300053151 Bacteria 1001
663 Ga0500627_0000538 3300053158 Bacteria 10235
664 Ga0501084_0199749 3300054114 Bacteria 1687
665 Ga0587088_008127 3300059508 Bacteria 1474
666 Ga0501082_0472988 3300060353 Bacteria 1095
667 2597028466 2596583598 Bacteria 5251611
668 2599444469 2599185178 Bacteria 5365746
669 2858693873 2858688981 Bacteria 8184122
670 2885267182 2885266251 Bacteria 4796748
671 2928063051 2928058823 Bacteria 5520022
672 Ga0207662_10500161
673 JGI24752J21851_1001275
674 JGI24740J21852_10003102
675 JGI24739J22299_10005810
676 JGI25154J39366_1001115
677 JGI25151J46595_10002073
678 JGI25151J46595_10003616
679 JGI25151J46595_10022029
680 Ga0055538_1003819
681 Ga0055538_1004772
682 Ga0055539_1000071
683 Ga0055533_1006294
684 Ga0055533_1006720
685 Ga0055532_1000019
686 Ga0055525_1000311
687 Ga0055535_1000014
688 Ga0055542_1000998
689 Ga0055529_1000096
690 Ga0055537_1007219
691 Ga0055524_1000463
692 Ga0055536_1000211
693 Ga0055534_1001050
694 Ga0055534_1007213
695 Ga0065704_10074982
696 Ga0065707_10091984
697 Ga0070658_10005500
698 Ga0070658_10014403
699 Ga0070658_10095373
700 Ga0070658_10286069
701 Ga0070658_10291825
702 Ga0070676_10006296
703 Ga0070676_10462500
704 Ga0070683_100004157
705 Ga0070683_100028490
706 Ga0070683_100083114
707 Ga0070683_100103853
708 Ga0070683_100158331
709 Ga0070683_100275481
710 Ga0070683_100393341
711 Ga0070690_100204788
712 Ga0070670_100000168
713 Ga0070670_100091585
714 Ga0070670_100124438
715 Ga0070670_100246962
716 Ga0068869_100001885
717 Ga0070666_10282214
718 Ga0070682_100263919
719 Ga0068868_100052863
720 Ga0070660_100005806
721 Ga0070660_100008667
722 Ga0070689_100008884
723 Ga0070689_100016731
724 Ga0070689_100336799
725 Ga0070687_100014096
726 Ga0070661_100000119
727 Ga0070661_100020483
728 Ga0070661_100021067
729 Ga0070661_100446113
730 Ga0070692_10050054
731 Ga0070668_100006861
732 Ga0070668_100027965
733 Ga0070668_100096917
734 Ga0070669_100002733
735 Ga0070669_100014992
736 Ga0070675_100034409
737 Ga0070675_100052880
738 Ga0070671_100035251
739 Ga0070671_100330363
740 Ga0070674_100168628
741 Ga0070674_100171621
742 Ga0070674_100203051
743 Ga0070674_100346515
744 Ga0070673_100052483
745 Ga0070673_100095669
746 Ga0070673_100248339
747 Ga0070673_100319832
748 Ga0070673_100592720
749 Ga0070688_100016349
750 Ga0070688_100421336
751 Ga0070659_100001403
752 Ga0070659_100006904
753 Ga0070659_100009727
754 Ga0070659_100153191
755 Ga0070659_100276950
756 Ga0070659_100379186
757 Ga0070667_100001061
758 Ga0070667_100006247
759 Ga0070667_100117080
760 Ga0070667_100139572
761 Ga0070709_10413565
762 Ga0070713_100021999
763 Ga0070713_100090306
764 Ga0070713_100160883
765 Ga0070701_10011373
766 Ga0070705_100208534
767 Ga0070700_100106470
768 Ga0070694_100031871
769 Ga0070663_100000036
770 Ga0070663_100016913
771 Ga0070662_100007883
772 Ga0070662_100078729
773 Ga0070662_100095821
774 Ga0070662_100402069
775 Ga0070681_10156173
776 Ga0070681_10273890
777 Ga0068867_100019857
778 Ga0068867_100022202
779 Ga0068867_100252587
780 Ga0068867_100352259
781 Ga0068867_100429642
782 Ga0070685_10027886
783 Ga0070685_10105778
784 Ga0070699_100170185
785 Ga0070679_100153930
786 Ga0070679_100234074
787 Ga0070684_100006670
788 Ga0070684_100010879
789 Ga0070684_100016078
790 Ga0070684_100017600
791 Ga0070684_100090813
792 Ga0070684_100167468
793 Ga0070697_100610618
794 Ga0068853_100003053
795 Ga0068853_100072181
796 Ga0068853_100078846
797 Ga0068853_100355725
798 Ga0070672_100001892
799 Ga0070672_100029219
800 Ga0070672_100227622
801 Ga0070672_100263035
802 Ga0070672_100516269
803 Ga0070686_100165952
804 Ga0068855_100019501
805 Ga0068855_100138850
806 Ga0068855_100265642
807 Ga0070664_100000096
808 Ga0070664_100001558
809 Ga0070664_100008265
810 Ga0070664_100015576
811 Ga0070664_100024965
812 Ga0070664_100075248
813 Ga0070664_100105148
814 Ga0070664_100119705
815 Ga0070664_100524122
816 Ga0068857_100006092
817 Ga0068857_100006504
818 Ga0068857_100009996
819 Ga0068857_100016468
820 Ga0068857_100190797
821 Ga0068857_100653641
822 Ga0068854_100000425
823 Ga0068854_100199592
824 Ga0068854_100215780
825 Ga0068856_100000203
826 Ga0068856_100445821
827 Ga0070702_100273406
828 Ga0070702_100361340
829 Ga0070702_100406059
830 Ga0068852_100003130
831 Ga0068852_100036025
832 Ga0068852_100501287
833 Ga0068859_100054546
834 Ga0068859_100143872
835 Ga0068864_100000063
836 Ga0068864_100005041
837 Ga0068864_100020018
838 Ga0068864_100065913
839 Ga0068866_10131669
840 Ga0068861_100002121
841 Ga0068861_100190561
842 Ga0068861_100448756
843 Ga0068861_100613680
844 Ga0068851_10023469
845 Ga0068851_10123244
846 Ga0068851_10231898
847 Ga0068870_10007965
848 Ga0068870_10067515
849 Ga0068863_100000062
850 Ga0068863_100391453
851 Ga0068863_100426106
852 Ga0068858_100056891
853 Ga0068860_100015858
854 Ga0068860_100030425
855 Ga0068860_100144278
856 Ga0068862_100000069
857 Ga0068862_100009387
858 Ga0068862_100140220
859 Ga0068862_100464055
860 Ga0081455_10001124
861 Ga0070717_10796342
862 Ga0070712_100141407
863 Ga0097621_100470958
864 Ga0097621_100494657
865 Ga0097621_100943885
866 Ga0068871_100408104
867 Ga0075428_100057692
868 Ga0075428_100324200
869 Ga0075430_100000978
870 Ga0075430_100010724
871 Ga0075431_100093902
872 Ga0075431_100124950
873 Ga0075431_100235541
874 Ga0075431_100473823
875 Ga0075433_10006543
876 Ga0075433_10040782
877 Ga0075434_100084545
878 Ga0075434_100309210
879 Ga0075429_100013113
880 Ga0075429_100121915
881 Ga0075429_100708262
882 Ga0068865_100014146
883 Ga0068865_100097773
884 Ga0097620_100054546
885 Ga0097620_100143897
886 Ga0099826_10000012
887 Ga0105251_10000833
888 Ga0105240_10028358
889 Ga0111539_10020779
890 Ga0111539_10385569
891 Ga0111539_10539889
892 Ga0105245_10739204
893 Ga0105247_10005002
894 Ga0114129_10020103
895 Ga0114129_10040315
896 Ga0105243_10097283
897 Ga0105241_10310738
898 Ga0105242_10041138
899 Ga0105242_10111998
900 Ga0105248_10000284
901 Ga0105248_10067012
902 Ga0105248_10117044
903 Ga0105248_10122704
904 Ga0105248_10148089
905 Ga0105248_10438379
906 Ga0105248_11504213
907 Ga0105249_10001169
908 Ga0105249_10003292
909 Ga0105249_10278599
910 Ga0105249_10362073
911 Ga0105239_10009120
912 Ga0105239_10190409
913 Ga0105246_10531581
914 Ga0105246_10547814
915 Ga0157373_10001880
916 Ga0157373_10064327
917 Ga0157371_10002837
918 Ga0157371_10054768
919 Ga0157370_10004547
920 Ga0157369_10004643
921 Ga0157369_10087714
922 Ga0157374_10027032
923 Ga0157378_10016448
924 Ga0157378_10265521
925 Ga0163162_10003542
926 Ga0163162_10102412
927 Ga0163162_10135256
928 Ga0163162_10220158
929 Ga0163162_10329682
930 Ga0157372_10003833
931 Ga0157372_10046708
932 Ga0157372_10085274
933 Ga0157372_10115239
934 Ga0157372_10399200
935 Ga0157372_10587505
936 Ga0157372_10695751
937 Ga0157375_10018313
938 Ga0157375_10123299
939 Ga0157375_10467918
940 Ga0157375_10491423
941 Ga0163163_10011129
942 Ga0163163_10262250
943 Ga0163163_10359858
944 Ga0157380_10328424
945 Ga0157380_10346431
946 Ga0157380_10958180
947 Ga0182008_10189261
948 Ga0157377_10015260
949 Ga0157379_10001783
950 Ga0157379_10031039
951 Ga0182006_1003375
952 Ga0182006_1014448
953 Ga0182007_10011314
954 Ga0182007_10077635
955 Ga0182005_1044055
956 Ga0163161_10012509
957 Ga0163161_10071727
958 Ga0163161_10112071
959 Ga0206356_10961560
960 Ga0206354_10206077
961 Ga0154015_1653377
962 Ga0213876_10069224
963 Ga0209784_100003
964 Ga0209784_100463
965 Ga0209566_100002
966 Ga0209566_100238
967 Ga0209566_101131
968 Ga0209674_100008
969 Ga0209674_100118
970 Ga0209672_100451
971 Ga0209147_100002
972 Ga0209563_100004
973 Ga0209258_100002
974 Ga0209646_1000203
975 Ga0209026_1006349
976 Ga0209677_100009
977 Ga0209148_1000021
978 Ga0209148_1004987
979 Ga0209565_1000021
980 Ga0209455_1000076
981 Ga0209130_1018981
982 Ga0207673_1017657
983 Ga0209675_1000149
984 Ga0209675_1005403
985 Ga0209675_1023317
986 Ga0209676_1000014
987 Ga0209025_1000781
988 Ga0209025_1001089
989 Ga0209025_1002125
990 Ga0209564_1001428
991 Ga0209758_1005893
992 Ga0209256_1000345
993 Ga0209256_1000502
994 Ga0209051_1005584
995 Ga0207697_10001524
996 Ga0207656_10014939
997 Ga0207656_10151869
998 Ga0207713_1004356
999 Ga0207682_10017102
1000 Ga0207642_10016113
1001 Ga0207688_10034244
1002 Ga0207680_10223208
1003 Ga0207647_10012380
1004 Ga0207647_10116468
1005 Ga0207645_10007248
1006 Ga0207643_10001697
1007 Ga0207643_10040223
1008 Ga0207705_10019668
1009 Ga0207705_10066463
1010 Ga0207705_10132299
1011 Ga0207705_10158835
1012 Ga0207654_10326519
1013 Ga0207707_10004198
1014 Ga0207695_10002210
1015 Ga0207695_10196214
1016 Ga0207693_10055183
1017 Ga0207660_10065734
1018 Ga0207660_10102913
1019 Ga0207662_10000455
1020 Ga0207662_10023642
1021 Ga0207657_10004575
1022 Ga0207657_10018092
1023 Ga0207657_10134900
1024 Ga0207657_10389449
1025 Ga0207657_10456236
1026 Ga0207649_10000340
1027 Ga0207649_10008507
1028 Ga0207649_10064948
1029 Ga0207649_10114459
1030 Ga0207652_10148880
1031 Ga0207681_10003831
1032 Ga0207681_10008351
1033 Ga0207681_10834265
1034 Ga0207694_10138531
1035 Ga0207650_10000142
1036 Ga0207650_10082659
1037 Ga0207650_10085932
1038 Ga0207650_10092596
1039 Ga0207659_10025846
1040 Ga0207659_10079810
1041 Ga0207659_10977459
1042 Ga0207700_10294342
1043 Ga0207700_10382834
1044 Ga0207644_10010005
1045 Ga0207644_10285212
1046 Ga0207690_10001075
1047 Ga0207690_10004821
1048 Ga0207690_10033585
1049 Ga0207690_10270581
1050 Ga0207690_10289030
1051 Ga0207690_10365011
1052 Ga0207706_10000947
1053 Ga0207706_10013604
1054 Ga0207706_10169536
1055 Ga0207706_10183597
1056 Ga0207686_10086461
1057 Ga0207686_10787739
1058 Ga0207670_10016096
1059 Ga0207670_10748422
1060 Ga0207669_10056776
1061 Ga0207669_10297872
1062 Ga0207704_10206799
1063 Ga0207704_10278420
1064 Ga0207691_10000311
1065 Ga0207691_10010346
1066 Ga0207691_10010505
1067 Ga0207691_10012035
1068 Ga0207691_10085326
1069 Ga0207691_10281882
1070 Ga0207711_10000017
1071 Ga0207711_10015397
1072 Ga0207711_10106905
1073 Ga0207711_10128356
1074 Ga0207711_10198882
1075 Ga0207711_10748219
1076 Ga0207689_10002676
1077 Ga0207661_10006329
1078 Ga0207661_10014460
1079 Ga0207661_10022042
1080 Ga0207661_10050110
1081 Ga0207661_10071055
1082 Ga0207661_10136818
1083 Ga0207679_10000122
1084 Ga0207679_10001366
1085 Ga0207679_10016218
1086 Ga0207679_10027139
1087 Ga0207679_10027460
1088 Ga0207679_10038056
1089 Ga0207679_10067931
1090 Ga0207679_10180512
1091 Ga0207679_10283508
1092 Ga0207667_10020830
1093 Ga0207667_10056209
1094 Ga0207667_10256324
1095 Ga0207667_10471572
1096 Ga0207667_10817212
1097 Ga0207651_10071932
1098 Ga0207651_10201535
1099 Ga0207651_10290960
1100 Ga0207651_10318749
1101 Ga0207651_10540238
1102 Ga0207712_10000527
1103 Ga0207712_10546657
1104 Ga0207668_10003563
1105 Ga0207668_10048757
1106 Ga0207668_10069048
1107 Ga0207668_10723834
1108 Ga0207640_10000017
1109 Ga0207640_10057578
1110 Ga0207658_10000815
1111 Ga0207658_10046428
1112 Ga0207658_10106193
1113 Ga0207658_10170369
1114 Ga0207677_10090517
1115 Ga0207677_10206468
1116 Ga0207703_10138757
1117 Ga0207703_10214320
1118 Ga0207703_10874734
1119 Ga0207639_10002668
1120 Ga0207639_10288810
1121 Ga0207639_10551067
1122 Ga0207639_10560796
1123 Ga0207678_10000129
1124 Ga0207678_10029284
1125 Ga0207708_10007740
1126 Ga0207708_10052029
1127 Ga0207702_10000024
1128 Ga0207641_10000022
1129 Ga0207641_10056046
1130 Ga0207641_10090301
1131 Ga0207641_11155388
1132 Ga0207648_10013733
1133 Ga0207648_10020920
1134 Ga0207648_10225350
1135 Ga0207648_10592854
1136 Ga0207676_10000056
1137 Ga0207676_10003671
1138 Ga0207676_10161460
1139 Ga0207676_10205692
1140 Ga0207676_10644959
1141 Ga0207674_10000737
1142 Ga0207674_10003739
1143 Ga0207674_10004051
1144 Ga0207674_10011124
1145 Ga0207674_10022074
1146 Ga0207674_10023319
1147 Ga0207675_100000107
1148 Ga0207675_100083438
1149 Ga0207675_100534984
1150 Ga0207698_10010895
1151 Ga0207698_10188673
1152 Ga0207698_10217340
1153 Ga0209282_1000175
1154 Ga0207428_10209361
1155 Ga0268266_10089258
1156 Ga0268265_10000044
1157 Ga0268265_10003081
1158 Ga0268265_10928033
1159 Ga0268264_10026238
1160 Ga0268264_10034537
1161 Ga0268264_10230558
1162 Ga0307408_100004111
1163 Ga0307408_100041481
1164 Ga0307408_100196902
1165 Ga0307408_100733434
1166 Ga0307405_10000947
1167 Ga0307405_10096243
1168 Ga0307405_10097110
1169 Ga0307405_10138800
1170 Ga0307405_10236440
1171 Ga0307405_10482428
1172 Ga0307413_10000218
1173 Ga0307413_10000244
1174 Ga0307413_10000464
1175 Ga0307413_10232670
1176 Ga0307413_10685589
1177 Ga0307410_10000712
1178 Ga0307410_10015301
1179 Ga0307410_10034785
1180 Ga0307410_10072762
1181 Ga0307410_10583492
1182 Ga0307406_10002593
1183 Ga0307406_10131897
1184 Ga0307406_10355290
1185 Ga0307406_10440265
1186 Ga0307406_10604978
1187 Ga0307407_10017469
1188 Ga0307407_10021047
1189 Ga0307407_10048225
1190 Ga0307407_10090784
1191 Ga0307412_10007157
1192 Ga0307412_10069120
1193 Ga0307409_100021691
1194 Ga0307409_100070860
1195 Ga0307409_100080618
1196 Ga0307409_100148028
1197 Ga0307409_100279644
1198 Ga0307409_100381439
1199 Ga0307409_100860482
1200 Ga0307409_100966111
1201 Ga0307409_101207129
1202 Ga0307416_100002566
1203 Ga0307416_100008480
1204 Ga0307416_100010616
1205 Ga0307416_100856352
1206 Ga0307416_101234104
1207 Ga0307414_10037490
1208 Ga0307414_10106013
1209 Ga0307411_10002189
1210 Ga0307415_100006475
1211 Ga0307415_100009298
1212 Ga0307415_100016358
1213 Ga0307415_100397611
1214 Ga0373956_0066388
1215 Ga0373956_0147494
1216 Ga0373943_0213948
1217 Ga0373935_0082642
1218 Ga0373925_0585206
1219 Ga0395899_0243028
1220 Ga0395900_0017272
1221 Ga0395900_0036708
1222 Ga0395900_0108205
1223 Ga0395898_0022822
1224 Ga0395898_0507538
1225 Ga0395905_0011696
1226 Ga0395905_0288828
1227 Ga0395905_0625816
1228 Ga0395901_0006146
1229 Ga0395901_0346003
1230 Ga0436365_1094760
1231 Ga0439439_0078366
1232 Ga0451847_0560490
1233 Ga0451853_1516051
1234 Ga0451577_0000001
1235 Ga0451577_0219362
1236 Ga0451577_0275313
1237 Ga0466986_0126562
1238 Ga0466961_0143719
1239 Ga0466960_0163166
1240 Ga0466959_0295128
1241 Ga0451576_0025678
1242 Ga0466967_0479360
1243 Ga0495629_0132216
1244 Ga0495594_0114113
1245 Ga0495596_0000753
1246 Ga0495596_0018942
1247 Ga0495607_0006795
1248 Ga0495610_0003561
1249 Ga0495616_0003905
1250 Ga0495620_0134428
1251 Ga0495637_0183774
1252 Ga0495663_0007168
1253 Ga0495663_0118154
1254 Ga0495654_0003556
1255 Ga0495665_0078819
1256 Ga0495586_0308079
1257 Ga0495598_0061358
1258 Ga0495609_0003546
1259 Ga0495621_0207387
1260 Ga0495597_0015770
1261 Ga0495667_0102610
1262 Ga0495667_0149689
1263 Ga0495656_0349311
1264 Ga0495668_0011031
1265 Ga0495668_0159367
1266 Ga0495659_0188156
1267 Ga0495661_0010644
1268 Ga0495657_0203648
1269 Ga0495669_0082445
1270 Ga0495613_0130270
1271 Ga0495671_0002270
1272 Ga0495600_0076213
1273 Ga0495604_0296259
1274 Ga0495674_0229861
1275 Ga0495672_0018898
1276 Ga0495675_0430444
1277 Ga0495685_013242
1278 Ga0495685_014217
1279 Ga0495602_0097300
1280 Ga0496101_0070999
1281 Ga0496102_0427594
1282 Ga0496102_0512747
1283 Ga0496104_0273134
1284 Ga0496105_0187010
1285 Ga0496105_0263498
1286 Ga0496106_0059966
1287 Ga0496106_0083509
1288 Ga0496107_0082833
1289 Ga0496107_0828324
1290 Ga0496108_0197978
1291 Ga0496109_0090876
1292 Ga0496109_0342426
1293 Ga0496112_0184516
1294 Ga0496112_0300848
1295 Ga0496114_0057671
1296 Ga0496116_0016431
1297 Ga0496116_0019109
1298 Ga0496117_0008846
1299 Ga0496118_0003910
1300 Ga0496121_0052554
1301 Ga0496122_0007225
1302 Ga0496123_0023583
1303 Ga0496125_0116105
1304 Ga0495678_054784
1305 Ga0501032_0040311
1306 Ga0501033_0254578
1307 Ga0501034_0237024
1308 Ga0501036_0246171
1309 Ga0501038_0021706
1310 Ga0501040_0545215
1311 Ga0501047_0003178
1312 Ga0501069_0057132
1313 Ga0501035_0231711
1314 nmdc:mga05p37_173087_c1
1315 nmdc:mga09592_113125_c1
1316 nmdc:mga09592_23272_c1
1317 nmdc:mga09592_318550_c1
1318 nmdc:mga09592_671861_c1
1319 nmdc:mga0qj67_479_c1
1320 nmdc:mga0qj67_5892_c1
1321 nmdc:mga06r32_1699747_c1
1322 nmdc:mga06r32_58825_c1
1323 nmdc:mga06r32_783685_c1
1324 nmdc:mga08y16_173816_c2
1325 nmdc:mga08y16_199699_c1
1326 nmdc:mga08y16_442740_c1
1327 nmdc:mga0n895_112073_c1
1328 nmdc:mga0n895_315442_c1
1329 nmdc:mga0a205_65427_c1
1330 nmdc:mga0a205_7147_c1
1331 Ga0500592_000295
1332 Ga0500604_0002414
1333 Ga0500604_0090068
1334 Ga0500627_0000538
1335 Ga0501084_0199749
1336 Ga0587088_008127
1337 Ga0501082_0472988
1338 2597028466
1339 2599444469
1340 2858693873
1341 2885267182
1342 2928063051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.906 4 209
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.7324 3 206
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.7314 4 203
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.7197 1 206
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.7169 3 206
ID Description Score Start End Superfamily
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9041 4 209 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7308 4 207 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7119 4 207 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7119 5 206 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6877 5 206 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2D5I280-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.991 106 209
AF-A0A4Q2XTV5-F1-model_v4 deleted 0.9851 117 209
AF-A0A352RUK5-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.985 90 209 GO:0051539
AF-A0A383C4D5-F1-model_v4 Radical SAM core domain-containing protein 0.9826 84 207 GO:0051539
AF-A0A561C4D4-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9826 94 209 GO:0051539

Map